SMED-SMAD6/7-2

Overview
NameSMED-SMAD6/7-2 (AFK29380.1)
Smed IDSMED30019744
Length (bp)877
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED-SMAD6/7-2 (SMED30019744) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED-SMAD6/7-2 (SMED30019744) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED-SMAD6/7-2 (SMED30019744) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED-SMAD6/7-2 (SMED30019744) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019744

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30019744SMESG000021574.1 SmedASXL_014761SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30019744SMESG000021574.1 JQ278720.1smed_ncbi_20200123PMID:22451003
González-Sastre et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30019744SMESG000021574.1 JQ278720.1smed_ncbi_20200123PMID:22451003
González-Sastre et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30019744SMESG000021574.1 JQ278720smed_ncbi_20200123PMID:22451003
González-Sastre et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30019744SMESG000021574.1 JQ278720smed_ncbi_20200123PMID:22451003
González-Sastre et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30019744SMESG000021574.1 dd_Smed_v4_16758_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30019744SMESG000021574.1 dd_Smed_v6_16758_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30019744SMESG000021574.1 JQ278720.1smed_ncbi_20200123PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30019744SMESG000021574.1 OX_Smed_1.0.00840ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED-SMAD6/7-2 vs. Ensembl Celegans
Match: tag-68 (Dwarfin sma [Source:UniProtKB/TrEMBL;Acc:G5EDS9])

HSP 1 Score: 48.521 bits (114), Expect = 2.544e-6
Identity = 31/99 (31.31%), Postives = 48/99 (48.48%), Query Frame = 3
Query:  327 NVLIHNKESKPVFISSTTLQENAFSSGKWPVVRVAPGQSVTAFNKKLFAHLLQSETET--RPGQLSLLHSAVIHISPQKGWGPGYQRVQFIQCPVRYEI 617
            +V ++N  ++P+F+S T       SS K  + R++PG  +     ++ A    SE     RP +   L    + IS  KGWGP Y R+     P RYE+
Sbjct:  318 DVWLYNSGTRPLFLSMTP----NVSSTKDTLRRLSPGYCIRVHRGEVSASAPASERTKVRRPSKDPALAQQNLVISVGKGWGPNYSRLYLTDIPCRYEV 412          
BLAST of SMED-SMAD6/7-2 vs. Ensembl Zebrafish
Match: smad6a (SMAD family member 6a [Source:ZFIN;Acc:ZDB-GENE-011015-1])

HSP 1 Score: 46.9802 bits (110), Expect = 5.778e-6
Identity = 32/103 (31.07%), Postives = 48/103 (46.60%), Query Frame = 3
Query:  318 ESGNVLIHNKESKPVFISSTTLQENAFSSGKWPVVRVAPGQSVTAFNKKLFAHLLQSETETRPGQLSLLHSAVIHISPQKGWGPGYQRVQFIQCPVRYEIWLS 626
            E   V  +N+   P+F++S TL+ + + S    V RV PG S+  F+ +    +  +     P      +S  + IS  KGWGP Y R     CP   EI L+
Sbjct:   76 EPDGVWAYNRSQHPIFVNSPTLEHHPYLSLT--VRRVMPGYSIKVFDYEKSCQMQPASHPVHPEGPYDPNS--VRISFAKGWGPCYSRQFITSCPCWLEILLN 174          
BLAST of SMED-SMAD6/7-2 vs. Ensembl Zebrafish
Match: smad6a (SMAD family member 6a [Source:ZFIN;Acc:ZDB-GENE-011015-1])

HSP 1 Score: 46.9802 bits (110), Expect = 5.778e-6
Identity = 32/103 (31.07%), Postives = 48/103 (46.60%), Query Frame = 3
Query:  318 ESGNVLIHNKESKPVFISSTTLQENAFSSGKWPVVRVAPGQSVTAFNKKLFAHLLQSETETRPGQLSLLHSAVIHISPQKGWGPGYQRVQFIQCPVRYEIWLS 626
            E   V  +N+   P+F++S TL+ + + S    V RV PG S+  F+ +    +  +     P      +S  + IS  KGWGP Y R     CP   EI L+
Sbjct:   76 EPDGVWAYNRSQHPIFVNSPTLEHHPYLSLT--VRRVMPGYSIKVFDYEKSCQMQPASHPVHPEGPYDPNS--VRISFAKGWGPCYSRQFITSCPCWLEILLN 174          
BLAST of SMED-SMAD6/7-2 vs. TrEMBL
Match: I3RSU2 (SMED-SMAD6/7-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 4.887e-125
Identity = 176/176 (100.00%), Postives = 176/176 (100.00%), Query Frame = 3
Query:  123 MLSKLKIEIRKHIDQKHNDKEDKTKQISWCRIELWNNNNVNLSAYIYEKLVPLPVPHDRLWLELDESGNVLIHNKESKPVFISSTTLQENAFSSGKWPVVRVAPGQSVTAFNKKLFAHLLQSETETRPGQLSLLHSAVIHISPQKGWGPGYQRVQFIQCPVRYEIWLSLQGVYLIR 650
            MLSKLKIEIRKHIDQKHNDKEDKTKQISWCRIELWNNNNVNLSAYIYEKLVPLPVPHDRLWLELDESGNVLIHNKESKPVFISSTTLQENAFSSGKWPVVRVAPGQSVTAFNKKLFAHLLQSETETRPGQLSLLHSAVIHISPQKGWGPGYQRVQFIQCPVRYEIWLSLQGVYLIR
Sbjct:    1 MLSKLKIEIRKHIDQKHNDKEDKTKQISWCRIELWNNNNVNLSAYIYEKLVPLPVPHDRLWLELDESGNVLIHNKESKPVFISSTTLQENAFSSGKWPVVRVAPGQSVTAFNKKLFAHLLQSETETRPGQLSLLHSAVIHISPQKGWGPGYQRVQFIQCPVRYEIWLSLQGVYLIR 176          
BLAST of SMED-SMAD6/7-2 vs. TrEMBL
Match: A0A0R3UL14 (MH2 domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS8341 PE=4 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 6.290e-16
Identity = 44/118 (37.29%), Postives = 63/118 (53.39%), Query Frame = 3
Query:  291 HDRLWLELDESGNVLIHNKE-SKPVFISSTT-LQENAFSSGKWPVVRVAPGQSVTAFNKKLFAHLLQSETETRPGQLSLLHSAVIHISPQKGWGPGYQRVQFIQCPVRYEIWLSLQGV 638
            HD + L L   G +L+ NK  + P+F++S   +Q     +  WPV RVAP  S+  F+ +++   L    +  P     L   V+HIS  KGWGP Y+R  F  CP R EIWL+L  +
Sbjct:  133 HDGISLLLLPKGQILLTNKTLTTPIFVASPCFVQSGNLIASDWPVYRVAPACSLVVFDTRVYEDRLTEACKNTPWPGQSLFGPVLHISLGKGWGPAYRRTDFTHCPARLEIWLNLSTI 250          
BLAST of SMED-SMAD6/7-2 vs. TrEMBL
Match: A0A0R3W6J8 (MH2 domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5832 PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.254e-15
Identity = 44/118 (37.29%), Postives = 66/118 (55.93%), Query Frame = 3
Query:  291 HDRLWLELDESGNVLIHNKE-SKPVFISSTT-LQENAFSSGKWPVVRVAPGQSVTAFNKKLFAHLLQSETETRPGQLSLLHSAVIHISPQKGWGPGYQRVQFIQCPVRYEIWLSLQGV 638
            H+ + L L   G +L+ NK  + P+F++S   +Q+    +G WPV RVAP  S+  F+ +++   L    ++ P     L   V+HIS  KGWGP Y+R  F  CP R EIWL+L  +
Sbjct:  135 HEGISLLLLPKGQILLTNKTPATPIFVASPCFVQQGNLIAGDWPVYRVAPTCSLVVFDMRIYEDRLTEVCKSTPWPGKSLFGPVLHISLGKGWGPTYRRTDFTHCPARLEIWLNLSTI 252          
BLAST of SMED-SMAD6/7-2 vs. TrEMBL
Match: A0A068WCH9 (Mothers against decapentaplegic 6 OS=Echinococcus granulosus OX=6210 GN=EgrG_001052400 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 2.090e-15
Identity = 44/118 (37.29%), Postives = 64/118 (54.24%), Query Frame = 3
Query:  291 HDRLWLELDESGNVLIHNKE-SKPVFISSTT-LQENAFSSGKWPVVRVAPGQSVTAFNKKLFAHLLQSETETRPGQLSLLHSAVIHISPQKGWGPGYQRVQFIQCPVRYEIWLSLQGV 638
            H+ + L L   G +L+ NK  + P+F++S   +Q     +G WPV RVAP  S+  F+ +++   L    +  P     L   V+HIS  KGWGP Y+R  F  CP R EIWL+L  +
Sbjct:  153 HEGISLLLLPKGQILLTNKTPTTPIFVASPCFVQPGDLIAGDWPVYRVAPACSLVVFDTRIYEDRLTEAGKYTPWPGKSLFGPVLHISLGKGWGPAYRRTDFTHCPARLEIWLNLSTI 270          
BLAST of SMED-SMAD6/7-2 vs. TrEMBL
Match: A0A068YDZ8 (Mothers against decapentaplegic 6 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001052400 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 2.133e-15
Identity = 44/118 (37.29%), Postives = 64/118 (54.24%), Query Frame = 3
Query:  291 HDRLWLELDESGNVLIHNKE-SKPVFISSTT-LQENAFSSGKWPVVRVAPGQSVTAFNKKLFAHLLQSETETRPGQLSLLHSAVIHISPQKGWGPGYQRVQFIQCPVRYEIWLSLQGV 638
            H+ + L L   G +L+ NK  + P+F++S   +Q     +G WPV RVAP  S+  F+ +++   L    +  P     L   V+HIS  KGWGP Y+R  F  CP R EIWL+L  +
Sbjct:  153 HEGISLLLLPKGQILLTNKTLTTPIFVASPCFVQPGDLIAGDWPVYRVAPACSLVVFDTRIYEDRLTEAGKYTPWPGKSLFGPVLHISLGKGWGPAYRRTDFTHCPARLEIWLNLSTI 270          
BLAST of SMED-SMAD6/7-2 vs. Ensembl Cavefish
Match: smad6b (SMAD family member 6 [Source:NCBI gene;Acc:103029602])

HSP 1 Score: 50.447 bits (119), Expect = 1.093e-6
Identity = 34/103 (33.01%), Postives = 48/103 (46.60%), Query Frame = 3
Query:  318 ESGNVLIHNKESKPVFISSTTLQENAFSSGKWPVVRVAPGQSVTAFNKKLFAHLLQSETETRPGQLSLLHSA-VIHISPQKGWGPGYQRVQFIQCPVRYEIWL 623
            E   V  +N+   P+F++S TL+    + G   V +V PG S+  F+ +  A LL+   E  P      +    + IS  KGWGP Y R     CP   EI L
Sbjct:  376 EPDGVWAYNRSQHPIFVNSPTLEAGPATRGLLVVRKVMPGYSIKVFDYERSALLLRQGAE--PALPDGPYDPNSVRISFAKGWGPCYSRQFITSCPCWLEILL 476          
BLAST of SMED-SMAD6/7-2 vs. Ensembl Sea Lamprey
Match: smad6b (SMAD family member 6b [Source:ZFIN;Acc:ZDB-GENE-050419-198])

HSP 1 Score: 48.1358 bits (113), Expect = 1.089e-6
Identity = 37/108 (34.26%), Postives = 51/108 (47.22%), Query Frame = 3
Query:  318 ESGNVLIHNKESKPVFISSTTLQENAFSSGKWPVVR-VAPGQSVTAFN--KKLFAHLLQSETETRPGQLSLLHSAVIHISPQKGWGPGYQRVQFIQCPVRYEIWLSLQ 632
            E+  V  +N+   P+F++S TL        + PVVR V PG S+ AF+  + +     Q+  E  P          I IS  KGWGP Y R     CP   EI LS++
Sbjct:  239 EADGVWCYNRSQHPLFVNSPTLDGLG---ARNPVVRKVPPGYSLRAFDFQQSMLLQEHQARHENGP-----YDPNSIRISFAKGWGPCYSRQFITSCPCWLEILLSVR 338          
BLAST of SMED-SMAD6/7-2 vs. Planmine SMEST
Match: SMESG000021574.1 (SMESG000021574.1)

HSP 1 Score: 264.618 bits (675), Expect = 5.031e-90
Identity = 129/131 (98.47%), Postives = 130/131 (99.24%), Query Frame = 3
Query:  123 MLSKLKIEIRKHIDQKHNDKEDKTKQISWCRIELWNNNNVNLSAYIYEKLVPLPVPHDRLWLELDESGNVLIHNKESKPVFISSTTLQENAFSSGKWPVVRVAPGQSVTAFNKKLFAHLLQSETETRPGQL 515
            MLSKLKIEIRKHIDQKHNDKEDKTKQISWCRIELWNNNNVNLSAYIYEKLVPLPVPHDRLWLELDESGNVLIHNKESKPVFISSTTLQENAFSSGKWPVVRVAPGQSVTAFNKKLFAHLLQSETETRP +L
Sbjct:    1 MLSKLKIEIRKHIDQKHNDKEDKTKQISWCRIELWNNNNVNLSAYIYEKLVPLPVPHDRLWLELDESGNVLIHNKESKPVFISSTTLQENAFSSGKWPVVRVAPGQSVTAFNKKLFAHLLQSETETRPERL 131          
BLAST of SMED-SMAD6/7-2 vs. Planmine SMEST
Match: SMESG000002697.1 (SMESG000002697.1)

HSP 1 Score: 55.4546 bits (132), Expect = 1.202e-8
Identity = 40/124 (32.26%), Postives = 62/124 (50.00%), Query Frame = 3
Query:  294 DRLWLELD------ESGNVLIHNKESKPVFISSTT--LQENAFSSGK--WPVVRVAPGQSVTAFNKKLFAHLLQSETETRPGQLSLLHSAV--IHISPQKGWGPGYQRVQFIQCPVRYEIWLSL 629
            D LW EL        +  V ++N  ++P+FISS    +Q++ F+      PV ++ P  SV  F+      +  S+T      + +L+S +  + IS  KGWG GY R  F+ CP R EI + L
Sbjct:  218 DSLWQELGICIHQLNNRFVSLYNYTTQPIFISSICKEIQDHNFNKHDPYIPVYKILPNHSVNVFSLDQIDTIKLSQTS-----IPILNSGIFTVQISFGKGWGRGYSRSSFLYCPCRCEISIIL 336          
The following BLAST results are available for this feature:
BLAST of SMED-SMAD6/7-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED-SMAD6/7-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tag-682.544e-631.31Dwarfin sma [Source:UniProtKB/TrEMBL;Acc:G5EDS9][more]
back to top
BLAST of SMED-SMAD6/7-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED-SMAD6/7-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
smad6a5.778e-631.07SMAD family member 6a [Source:ZFIN;Acc:ZDB-GENE-01... [more]
smad6a5.778e-631.07SMAD family member 6a [Source:ZFIN;Acc:ZDB-GENE-01... [more]
back to top
BLAST of SMED-SMAD6/7-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED-SMAD6/7-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED-SMAD6/7-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED-SMAD6/7-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I3RSU24.887e-125100.00SMED-SMAD6/7-2 OS=Schmidtea mediterranea OX=79327 ... [more]
A0A0R3UL146.290e-1637.29MH2 domain-containing protein OS=Mesocestoides cor... [more]
A0A0R3W6J81.254e-1537.29MH2 domain-containing protein OS=Taenia asiatica O... [more]
A0A068WCH92.090e-1537.29Mothers against decapentaplegic 6 OS=Echinococcus ... [more]
A0A068YDZ82.133e-1537.29Mothers against decapentaplegic 6 OS=Echinococcus ... [more]
back to top
BLAST of SMED-SMAD6/7-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
smad6b1.093e-633.01SMAD family member 6 [Source:NCBI gene;Acc:1030296... [more]
back to top
BLAST of SMED-SMAD6/7-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
smad6b1.089e-634.26SMAD family member 6b [Source:ZFIN;Acc:ZDB-GENE-05... [more]
back to top
BLAST of SMED-SMAD6/7-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED-SMAD6/7-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED-SMAD6/7-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED-SMAD6/7-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000021574.15.031e-9098.47SMESG000021574.1[more]
SMESG000002697.11.202e-832.26SMESG000002697.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30019744
GenBankAFK29380.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019744 ID=SMED30019744|Name=SMED-SMAD6/7-2|organism=Schmidtea mediterranea sexual|type=transcript|length=877bp
CCAATCACTGAAACGAAAGTAACCAATAGTAATGCAACATTCATTAGCTC
ATATGGGAGAAATAAGCCAATAGATTTAAAACGATTCTACATTGCAGCTG
AGTTCAATATAATCAACTCTAAATGCTGTCGAAGCTAAAAATTGAAATCC
GTAAGCACATAGATCAGAAACATAATGATAAGGAAGATAAAACAAAACAG
ATATCTTGGTGTAGAATTGAATTGTGGAATAATAACAATGTCAATTTGAG
TGCATATATCTACGAAAAACTTGTACCGTTACCAGTTCCTCACGATCGGT
TGTGGTTAGAGCTTGACGAATCGGGAAATGTTCTGATTCACAACAAAGAA
TCGAAGCCGGTTTTTATTAGTTCGACGACACTTCAGGAAAATGCATTTTC
ATCAGGAAAATGGCCTGTAGTTAGAGTAGCCCCTGGGCAATCAGTGACAG
CTTTCAACAAAAAATTATTTGCTCACCTACTTCAGTCAGAAACAGAAACC
AGACCAGGTCAGTTATCTTTGTTGCATTCGGCAGTCATCCATATCAGCCC
ACAGAAAGGTTGGGGACCCGGCTATCAGAGAGTTCAATTTATTCAGTGTC
CAGTTCGATATGAAATTTGGTTGTCATTGCAAGGAGTATATTTGATACGA
GATTTCAAACATTTCATTGTCTTATCTGAATAAACAAAACTCATATAAGC
ATATATATATTCAGTAAACATTATAGGTAAGCTGTCATATTGTAAATTAG
AGGATCTGCTCCAAGACGCACTGGTTTTATTTTGCACCTGTTAATTTATA
TGAAATTTATCCCAATGTTACCCGCTATTTTTATGGTCTCGATTTATTGT
TTATCTGAATAAATATTTTGTTAATTT
back to top

protein sequence of SMED30019744-orf-1

>SMED30019744-orf-1 ID=SMED30019744-orf-1|Name=SMED30019744-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=187bp
MLSKLKIEIRKHIDQKHNDKEDKTKQISWCRIELWNNNNVNLSAYIYEKL
VPLPVPHDRLWLELDESGNVLIHNKESKPVFISSTTLQENAFSSGKWPVV
RVAPGQSVTAFNKKLFAHLLQSETETRPGQLSLLHSAVIHISPQKGWGPG
YQRVQFIQCPVRYEIWLSLQGVYLIRDFKHFIVLSE*
back to top
Aliases
The feature 'SMED-SMAD6/7-2' has the following synonyms
Synonym
SMAD6/7-2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000044cephalic ganglia
PLANA:0000097ventral nerve cord
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR013790Dwarfin
IPR001132SMAD_dom_Dwarfin-type
IPR017855SMAD-like_dom_sf
IPR008984SMAD_FHA_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001132SMAD domain, Dwarfin-typeSMARTSM00524dwBultra2coord: 27..168
e-value: 4.1E-4
score: -7.2
IPR001132SMAD domain, Dwarfin-typePFAMPF03166MH2coord: 61..167
e-value: 1.7E-16
score: 61.0
IPR001132SMAD domain, Dwarfin-typePROSITEPS51076MH2coord: 1..186
score: 12.197
IPR017855SMAD-like domain superfamilyGENE3DG3DSA:2.60.200.10coord: 60..177
e-value: 1.1E-17
score: 66.2
NoneNo IPR availablePANTHERPTHR13703:SF54MOTHERS AGAINST DECAPENTAPLEGIC HOMOLOGcoord: 66..168
IPR013790DwarfinPANTHERPTHR13703SMADcoord: 66..168
IPR008984SMAD/FHA domain superfamilySUPERFAMILYSSF49879SMAD/FHA domaincoord: 61..167