Tetraspanin

Overview
NameTetraspanin
Smed IDSMED30019741
Length (bp)917
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tetraspanin (SMED30019741) t-SNE clustered cells

Violin plots show distribution of expression levels for Tetraspanin (SMED30019741) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tetraspanin (SMED30019741) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tetraspanin (SMED30019741) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019741

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30019741SMESG000021636.1 SmedASXL_016778SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30019741SMESG000021636.1 dd_Smed_v4_13516_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30019741SMESG000021636.1 dd_Smed_v4_13516_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30019741SMESG000021636.1 dd_Smed_v4_32522_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019741SMESG000021636.1 SMED_09172_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30019741SMESG000021636.1 SMED_09172_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tetraspanin vs. Ensembl Human
Match: CD151 (CD151 molecule (Raph blood group) [Source:HGNC Symbol;Acc:HGNC:1630])

HSP 1 Score: 59.3066 bits (142), Expect = 1.354e-9
Identity = 30/111 (27.03%), Postives = 51/111 (45.95%), Query Frame = 1
Query:  427 GVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWLPNNGM-LFPVGCINAIISWVIKHL 756
            G+  Y Y  +   E   N +       +     A+T+ VD  QQ F CCG +   DW+ S W ++       VP SCC  + + C   ++   ++  GCI  + +++ +HL
Sbjct:  108 GILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKGGCITKLETFIQEHL 218          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD151 (CD151 molecule (Raph blood group) [Source:HGNC Symbol;Acc:HGNC:1630])

HSP 1 Score: 57.3806 bits (137), Expect = 4.937e-9
Identity = 31/113 (27.43%), Postives = 52/113 (46.02%), Query Frame = 1
Query:  427 GVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWLPNNGM-LFPV--GCINAIISWVIKHL 756
            G+  Y Y  +   E   N +       +     A+T+ VD  QQ F CCG +   DW+ S W ++       VP SCC  + + C   ++   ++ V  GCI  + +++ +HL
Sbjct:  108 GILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHL 220          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD151 (CD151 molecule (Raph blood group) [Source:HGNC Symbol;Acc:HGNC:1630])

HSP 1 Score: 56.9954 bits (136), Expect = 7.497e-9
Identity = 31/113 (27.43%), Postives = 52/113 (46.02%), Query Frame = 1
Query:  427 GVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWLPNNGM-LFPV--GCINAIISWVIKHL 756
            G+  Y Y  +   E   N +       +     A+T+ VD  QQ F CCG +   DW+ S W ++       VP SCC  + + C   ++   ++ V  GCI  + +++ +HL
Sbjct:  108 GILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHL 220          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD151 (CD151 molecule (Raph blood group) [Source:HGNC Symbol;Acc:HGNC:1630])

HSP 1 Score: 56.9954 bits (136), Expect = 7.497e-9
Identity = 31/113 (27.43%), Postives = 52/113 (46.02%), Query Frame = 1
Query:  427 GVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWLPNNGM-LFPV--GCINAIISWVIKHL 756
            G+  Y Y  +   E   N +       +     A+T+ VD  QQ F CCG +   DW+ S W ++       VP SCC  + + C   ++   ++ V  GCI  + +++ +HL
Sbjct:  108 GILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHL 220          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD151 (CD151 molecule (Raph blood group) [Source:HGNC Symbol;Acc:HGNC:1630])

HSP 1 Score: 56.9954 bits (136), Expect = 7.497e-9
Identity = 31/113 (27.43%), Postives = 52/113 (46.02%), Query Frame = 1
Query:  427 GVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWLPNNGM-LFPV--GCINAIISWVIKHL 756
            G+  Y Y  +   E   N +       +     A+T+ VD  QQ F CCG +   DW+ S W ++       VP SCC  + + C   ++   ++ V  GCI  + +++ +HL
Sbjct:  108 GILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHL 220          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-7 (Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q9XVI4])

HSP 1 Score: 48.1358 bits (113), Expect = 1.963e-6
Identity = 28/84 (33.33%), Postives = 38/84 (45.24%), Query Frame = 1
Query:  502 MIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWLPNNGMLFPVGCINAIISWVIKH 753
            M+ Y  S  + +  D   QLF CCG+    DW           T  T+P SCC      C    N  LF  GCI+++  WV+K+
Sbjct:  122 MVRYHESRGVESAWDKTHQLFECCGVTNSSDWL----------TFTTIPDSCCIEEIEGCA-RENAPLFEPGCIHSVEQWVLKN 194          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan3b (tetraspanin 3b [Source:ZFIN;Acc:ZDB-GENE-070424-42])

HSP 1 Score: 60.4622 bits (145), Expect = 3.413e-10
Identity = 37/97 (38.14%), Postives = 50/97 (51.55%), Query Frame = 1
Query:  439 YIYSNRKPVEYFANKEFRKLFMIYYG-NSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSC--WLPNNGMLFPVGC 720
            YIY  R  VE   N   +K++  Y G N+ A +  +D  Q+   CCG+    DW  +HW+  S   N +VP SCC P  S+C   L   G L+P GC
Sbjct:  105 YIY--RAKVEAVVNHSIQKVYNEYKGTNTDAPSRAIDYVQRQLHCCGIHNYSDWMNTHWFIESK--NNSVPVSCCKPTISNCTGTLMRPGDLYPEGC 197          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan3b (tetraspanin 3b [Source:ZFIN;Acc:ZDB-GENE-070424-42])

HSP 1 Score: 60.4622 bits (145), Expect = 3.413e-10
Identity = 37/97 (38.14%), Postives = 50/97 (51.55%), Query Frame = 1
Query:  439 YIYSNRKPVEYFANKEFRKLFMIYYG-NSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSC--WLPNNGMLFPVGC 720
            YIY  R  VE   N   +K++  Y G N+ A +  +D  Q+   CCG+    DW  +HW+  S   N +VP SCC P  S+C   L   G L+P GC
Sbjct:  105 YIY--RAKVEAVVNHSIQKVYNEYKGTNTDAPSRAIDYVQRQLHCCGIHNYSDWMNTHWFIESK--NNSVPVSCCKPTISNCTGTLMRPGDLYPEGC 197          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan3a (tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-7787])

HSP 1 Score: 58.151 bits (139), Expect = 1.991e-9
Identity = 37/102 (36.27%), Postives = 54/102 (52.94%), Query Frame = 1
Query:  439 YIYSNRKPVEYFANKEFRKLFMIYYG-NSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCW--LPNNGMLFPVGCINAII 735
            YIY  R  VE   N   +K++  Y G N+ A +  +D  Q+   CCG+    DW+ + W+K S   N +VP SCC P  S+C   L + G L+P GC   ++
Sbjct:  105 YIY--RAKVEDEVNHSIQKVYNEYNGTNTDAPSRAIDYVQRQLHCCGITNFADWRNTRWFKESK--NNSVPLSCCKPNVSNCTGSLLHPGDLYPEGCEELVV 202          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan3a (tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-7787])

HSP 1 Score: 58.151 bits (139), Expect = 1.991e-9
Identity = 37/102 (36.27%), Postives = 54/102 (52.94%), Query Frame = 1
Query:  439 YIYSNRKPVEYFANKEFRKLFMIYYG-NSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCW--LPNNGMLFPVGCINAII 735
            YIY  R  VE   N   +K++  Y G N+ A +  +D  Q+   CCG+    DW+ + W+K S   N +VP SCC P  S+C   L + G L+P GC   ++
Sbjct:  105 YIY--RAKVEDEVNHSIQKVYNEYNGTNTDAPSRAIDYVQRQLHCCGITNFADWRNTRWFKESK--NNSVPLSCCKPNVSNCTGSLLHPGDLYPEGCEELVV 202          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan3a (tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-7787])

HSP 1 Score: 58.151 bits (139), Expect = 1.991e-9
Identity = 37/102 (36.27%), Postives = 54/102 (52.94%), Query Frame = 1
Query:  439 YIYSNRKPVEYFANKEFRKLFMIYYG-NSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCW--LPNNGMLFPVGCINAII 735
            YIY  R  VE   N   +K++  Y G N+ A +  +D  Q+   CCG+    DW+ + W+K S   N +VP SCC P  S+C   L + G L+P GC   ++
Sbjct:  105 YIY--RAKVEDEVNHSIQKVYNEYNGTNTDAPSRAIDYVQRQLHCCGITNFADWRNTRWFKESK--NNSVPLSCCKPNVSNCTGSLLHPGDLYPEGCEELVV 202          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: cd151 (CD151 molecule (Raph blood group) [Source:NCBI gene;Acc:100144686])

HSP 1 Score: 56.225 bits (134), Expect = 1.215e-8
Identity = 35/116 (30.17%), Postives = 51/116 (43.97%), Query Frame = 1
Query:  427 GVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPA---ITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWL---PNNGMLFPVGCINAIISWVIKHL 756
            G+  YIY  +   E    K+  K  M      P    +T  VD  QQ F+CCG +  +DW+ S W  +       VP SCC  +   C +   P+N      GCI  + +++  HL
Sbjct:  108 GILAYIYYQQLNAEL---KQSLKQTMTTKYKQPGEEKVTNAVDKLQQEFKCCGSNNSEDWRDSIWINSPEAEKRLVPDSCCKTVTQRCGIRDHPSNIYKTEGGCITKLETFIRAHL 220          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: cd151 (CD151 molecule (Raph blood group) [Source:NCBI gene;Acc:100144686])

HSP 1 Score: 54.299 bits (129), Expect = 5.148e-8
Identity = 36/120 (30.00%), Postives = 52/120 (43.33%), Query Frame = 1
Query:  427 GVTIYIYSNR-KPVEYFANKEFR---KLFMIYYGNSPA---ITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWL---PNNGMLFPVGCINAIISWVIKHL 756
            G+  YIY  +  P     N E +   K  M      P    +T  VD  QQ F+CCG +  +DW+ S W  +       VP SCC  +   C +   P+N      GCI  + +++  HL
Sbjct:  108 GILAYIYYQQCTPFCLQLNAELKQSLKQTMTTKYKQPGEEKVTNAVDKLQQEFKCCGSNNSEDWRDSIWINSPEAEKRLVPDSCCKTVTQRCGIRDHPSNIYKTEGGCITKLETFIRAHL 227          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: TSPAN11 (II-FBPL precursor [Source:Xenbase;Acc:XB-GENE-5830570])

HSP 1 Score: 50.447 bits (119), Expect = 9.675e-7
Identity = 25/79 (31.65%), Postives = 39/79 (49.37%), Query Frame = 1
Query:  529 ITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWL---PNNGMLFPVGCINAIISWVIKHL 756
            IT+ +D+ QQ F CCG    +DW+ S +  ++   +  VP SCC      C     P+N      GCI  +  ++ +HL
Sbjct:  133 ITSAIDHLQQDFHCCGSGSYNDWQHSEYISSTQSEDRVVPDSCCKTKTLHCGRRDHPSNIYRVEGGCITKLEEFIQEHL 211          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: fam110d (family with sequence similarity 110 member D [Source:Xenbase;Acc:XB-GENE-920630])

HSP 1 Score: 49.6766 bits (117), Expect = 1.959e-6
Identity = 28/104 (26.92%), Postives = 50/104 (48.08%), Query Frame = 1
Query:  427 GVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCW--LPNNGMLFPVGCINAI 732
             V  ++Y +R   E    K   + F  Y G+   +T  V+  Q+  RCCGL    DW+ + WY+     N T+P +CC+  +++C+     +   +  GC + +
Sbjct:  101 AVLAFLYMDRMDFEL---KPMLEAFENYDGSKSDVT--VNKIQKELRCCGLHNYTDWEATSWYR----QNFTIPKTCCNETYTTCYGNTTESKAFYQEGCFDKL 195          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd151 (CD151 antigen [Source:MGI Symbol;Acc:MGI:1096360])

HSP 1 Score: 58.5362 bits (140), Expect = 1.620e-9
Identity = 29/113 (25.66%), Postives = 54/113 (47.79%), Query Frame = 1
Query:  427 GVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWLPNNGM-LFPV--GCINAIISWVIKHL 756
            G+  Y+Y  +   E   N +   +   +      +++ VD  QQ F CCG +   DW+ S W ++    +  VP SCC  + + C   ++   ++ V  GCI  + +++ +HL
Sbjct:  108 GILAYVYYQQLNTELKENLKDTMVKRYHQSGHEGVSSAVDKLQQEFHCCGSNNSQDWQDSEWIRSGEADSRVVPDSCCKTMVAGCGKRDHASNIYKVEGGCITKLETFIQEHL 220          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd151 (CD151 antigen [Source:MGI Symbol;Acc:MGI:1096360])

HSP 1 Score: 58.5362 bits (140), Expect = 1.620e-9
Identity = 29/113 (25.66%), Postives = 54/113 (47.79%), Query Frame = 1
Query:  427 GVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWLPNNGM-LFPV--GCINAIISWVIKHL 756
            G+  Y+Y  +   E   N +   +   +      +++ VD  QQ F CCG +   DW+ S W ++    +  VP SCC  + + C   ++   ++ V  GCI  + +++ +HL
Sbjct:  108 GILAYVYYQQLNTELKENLKDTMVKRYHQSGHEGVSSAVDKLQQEFHCCGSNNSQDWQDSEWIRSGEADSRVVPDSCCKTMVAGCGKRDHASNIYKVEGGCITKLETFIQEHL 220          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd151 (CD151 antigen [Source:MGI Symbol;Acc:MGI:1096360])

HSP 1 Score: 58.5362 bits (140), Expect = 1.620e-9
Identity = 29/113 (25.66%), Postives = 54/113 (47.79%), Query Frame = 1
Query:  427 GVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWLPNNGM-LFPV--GCINAIISWVIKHL 756
            G+  Y+Y  +   E   N +   +   +      +++ VD  QQ F CCG +   DW+ S W ++    +  VP SCC  + + C   ++   ++ V  GCI  + +++ +HL
Sbjct:  108 GILAYVYYQQLNTELKENLKDTMVKRYHQSGHEGVSSAVDKLQQEFHCCGSNNSQDWQDSEWIRSGEADSRVVPDSCCKTMVAGCGKRDHASNIYKVEGGCITKLETFIQEHL 220          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Tspan3 (tetraspanin 3 [Source:MGI Symbol;Acc:MGI:1928098])

HSP 1 Score: 55.0694 bits (131), Expect = 1.999e-8
Identity = 32/95 (33.68%), Postives = 47/95 (49.47%), Query Frame = 1
Query:  445 YSNRKPVEYFANKEFRKLFMIYYG-NSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSC--WLPNNGMLFPVGC 720
            Y  R  VE   ++  +K++  Y G NS A +  +D  Q+   CCG+    DW+ + W+K +   N +VP SCC     SC   L N   L+  GC
Sbjct:  105 YVYRAKVENEVDRSIQKVYKTYNGTNSDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETK--NQSVPLSCCRETAKSCNGSLANPSDLYAEGC 197          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Tspan3 (tetraspanin 3 [Source:MGI Symbol;Acc:MGI:1928098])

HSP 1 Score: 54.6842 bits (130), Expect = 2.733e-8
Identity = 32/100 (32.00%), Postives = 49/100 (49.00%), Query Frame = 1
Query:  445 YSNRKPVEYFANKEFRKLFMIYYG-NSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSC--WLPNNGMLFPVGCINAII 735
            Y  R  VE   ++  +K++  Y G NS A +  +D  Q+   CCG+    DW+ + W+K +   N +VP SCC     SC   L N   L+  GC   ++
Sbjct:  108 YVYRAKVENEVDRSIQKVYKTYNGTNSDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETK--NQSVPLSCCRETAKSCNGSLANPSDLYAEGCEALVV 205          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|Q9QZA6|CD151_RAT (CD151 antigen OS=Rattus norvegicus OX=10116 GN=Cd151 PE=1 SV=2)

HSP 1 Score: 59.3066 bits (142), Expect = 6.143e-9
Identity = 31/113 (27.43%), Postives = 52/113 (46.02%), Query Frame = 1
Query:  427 GVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWLPNNGM-LFPV--GCINAIISWVIKHL 756
            G+  Y+Y  +   E   N +   +   +      +T  VD  QQ F CCG +   DW+ S W ++    +  VP SCC  + + C    +   ++ V  GCI  + S++ +HL
Sbjct:  108 GILAYVYYQQLNTELKENLKDTMIKRYHQSGHEGVTNAVDKLQQEFHCCGSNNSRDWRDSEWIRSGEADSRVVPDSCCKTVVTGCGKREHASNIYKVEGGCITKLESFIQEHL 220          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|O35566|CD151_MOUSE (CD151 antigen OS=Mus musculus OX=10090 GN=Cd151 PE=1 SV=2)

HSP 1 Score: 58.5362 bits (140), Expect = 1.133e-8
Identity = 29/113 (25.66%), Postives = 54/113 (47.79%), Query Frame = 1
Query:  427 GVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWLPNNGM-LFPV--GCINAIISWVIKHL 756
            G+  Y+Y  +   E   N +   +   +      +++ VD  QQ F CCG +   DW+ S W ++    +  VP SCC  + + C   ++   ++ V  GCI  + +++ +HL
Sbjct:  108 GILAYVYYQQLNTELKENLKDTMVKRYHQSGHEGVSSAVDKLQQEFHCCGSNNSQDWQDSEWIRSGEADSRVVPDSCCKTMVAGCGKRDHASNIYKVEGGCITKLETFIQEHL 220          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|P48509|CD151_HUMAN (CD151 antigen OS=Homo sapiens OX=9606 GN=CD151 PE=1 SV=3)

HSP 1 Score: 56.9954 bits (136), Expect = 3.600e-8
Identity = 31/113 (27.43%), Postives = 52/113 (46.02%), Query Frame = 1
Query:  427 GVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWLPNNGM-LFPV--GCINAIISWVIKHL 756
            G+  Y Y  +   E   N +       +     A+T+ VD  QQ F CCG +   DW+ S W ++       VP SCC  + + C   ++   ++ V  GCI  + +++ +HL
Sbjct:  108 GILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHL 220          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|Q3SZR9|TSN3_BOVIN (Tetraspanin-3 OS=Bos taurus OX=9913 GN=TSPAN3 PE=2 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 4.029e-8
Identity = 32/95 (33.68%), Postives = 48/95 (50.53%), Query Frame = 1
Query:  445 YSNRKPVEYFANKEFRKLFMIYYGNSP-AITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSC--WLPNNGMLFPVGC 720
            Y  R  VE   ++  +K++  Y G +P A +  +D  Q+   CCG+    DW+ + W+K +   N +VP SCC    SSC   L N   L+  GC
Sbjct:  105 YVYRAKVENEVDRSIQKVYKTYNGTNPDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETK--NQSVPLSCCRETASSCNGSLANPSDLYAEGC 197          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|Q9QY33|TSN3_MOUSE (Tetraspanin-3 OS=Mus musculus OX=10090 GN=Tspan3 PE=1 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.398e-7
Identity = 32/95 (33.68%), Postives = 47/95 (49.47%), Query Frame = 1
Query:  445 YSNRKPVEYFANKEFRKLFMIYYG-NSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSC--WLPNNGMLFPVGC 720
            Y  R  VE   ++  +K++  Y G NS A +  +D  Q+   CCG+    DW+ + W+K +   N +VP SCC     SC   L N   L+  GC
Sbjct:  105 YVYRAKVENEVDRSIQKVYKTYNGTNSDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETK--NQSVPLSCCRETAKSCNGSLANPSDLYAEGC 197          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A4W3HG89 (Uncharacterized protein OS=Callorhinchus milii OX=7868 PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 3.744e-11
Identity = 38/115 (33.04%), Postives = 55/115 (47.83%), Query Frame = 1
Query:  427 GVTIYIYSNRKPVEYFANKEFRKLFMIYYG--NSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWL---PNNGMLFPVGCINAIISWVIKHL 756
            G+  YIY  +   E   N   R+  ++ Y   N  +IT  VD  QQ FRCCG +   DW+ S W K+ +     VP SCC  +   C +   P+N      GCI  +  +++ HL
Sbjct:   16 GILAYIYYQQLSEELKTN--LRETMIVKYRTPNQESITKAVDKLQQEFRCCGSNSSQDWRESQWVKSGDSGGRQVPDSCCKTMSIGCGVSLHPSNIYKVEGGCITKLEQFILNHL 128          
BLAST of Tetraspanin vs. TrEMBL
Match: V9KYQ9 (Tetraspanin OS=Callorhinchus milii OX=7868 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 2.904e-10
Identity = 38/115 (33.04%), Postives = 55/115 (47.83%), Query Frame = 1
Query:  427 GVTIYIYSNRKPVEYFANKEFRKLFMIYYG--NSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWL---PNNGMLFPVGCINAIISWVIKHL 756
            G+  YIY  +   E   N   R+  ++ Y   N  +IT  VD  QQ FRCCG +   DW+ S W K+ +     VP SCC  +   C +   P+N      GCI  +  +++ HL
Sbjct:  106 GILAYIYYQQLSEELKTN--LRETMIVKYRTPNQESITKAVDKLQQEFRCCGSNSSQDWRESQWVKSGDSGGRQVPDSCCKTMSIGCGVSLHPSNIYKVEGGCITKLEQFILNHL 218          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A0C9RXK7 (Tetraspanin (Fragment) OS=Amblyomma americanum OX=6943 PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.793e-9
Identity = 37/111 (33.33%), Postives = 56/111 (50.45%), Query Frame = 1
Query:  427 GVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCW-LPNNGMLFPVGCINAIISWVIKHL 756
            G+  Y+Y  +  V +         F+  YGN  + T  +D+ Q+ F+CCG +G +DWK S W      TN  VP SCC  +   C  L +   ++  GCINA+   + +HL
Sbjct:   46 GIIAYVYEEQ--VWHELADGLNTTFIESYGNDASRTEAIDDLQRSFKCCGANGFEDWKHSVWLHKKPRTNNKVPDSCCKTIGKGCGKLAHPSNIYYDGCINALHDQIREHL 154          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A224Z0M7 (Tetraspanin OS=Rhipicephalus zambeziensis OX=60191 PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.837e-9
Identity = 37/111 (33.33%), Postives = 58/111 (52.25%), Query Frame = 1
Query:  427 GVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCW-LPNNGMLFPVGCINAIISWVIKHL 756
            G+  Y+Y  +  V +         F+  YG   + T  +++ Q+ F+CCG +G DDWK S W +  + TN TVP SCC  +   C  L +   ++  GCINA+   + +HL
Sbjct:  169 GIIAYVYEEQ--VWHELADGLNTTFVESYGTDASRTEAINDLQRAFKCCGANGFDDWKHSVWLRKHSRTNNTVPDSCCKTIGLGCGKLAHPSNIYYDGCINALDEQIREHL 277          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A224Z5H7 (Tetraspanin OS=Rhipicephalus zambeziensis OX=60191 PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.846e-9
Identity = 37/111 (33.33%), Postives = 58/111 (52.25%), Query Frame = 1
Query:  427 GVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCW-LPNNGMLFPVGCINAIISWVIKHL 756
            G+  Y+Y  +  V +         F+  YG   + T  +++ Q+ F+CCG +G DDWK S W +  + TN TVP SCC  +   C  L +   ++  GCINA+   + +HL
Sbjct:  171 GIIAYVYEEQ--VWHELADGLNTTFVESYGTDASRTEAINDLQRAFKCCGANGFDDWKHSVWLRKHSRTNNTVPDSCCKTIGLGCGKLAHPSNIYYDGCINALDEQIREHL 279          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan3a (tetraspanin 3 [Source:NCBI gene;Acc:103046031])

HSP 1 Score: 57.3806 bits (137), Expect = 2.851e-9
Identity = 37/97 (38.14%), Postives = 50/97 (51.55%), Query Frame = 1
Query:  439 YIYSNRKPVEYFANKEFRKLFMIYYG-NSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCW--LPNNGMLFPVGC 720
            YIY  R  VE   N   +K++  Y G NS A +  +D  Q+   CCG+    DW+ + W+  S   N +VP SCC P  S+C   L   G L+P GC
Sbjct:  107 YIY--RAKVEEEVNHSIQKVYNEYNGTNSDAPSRAIDYVQRQLHCCGITNYLDWRNTSWFNESR--NNSVPLSCCKPNVSNCTGSLSRPGDLYPEGC 199          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan3a (tetraspanin 3 [Source:NCBI gene;Acc:103046031])

HSP 1 Score: 56.9954 bits (136), Expect = 3.711e-9
Identity = 37/97 (38.14%), Postives = 50/97 (51.55%), Query Frame = 1
Query:  439 YIYSNRKPVEYFANKEFRKLFMIYYG-NSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCW--LPNNGMLFPVGC 720
            YIY  R  VE   N   +K++  Y G NS A +  +D  Q+   CCG+    DW+ + W+  S   N +VP SCC P  S+C   L   G L+P GC
Sbjct:  106 YIY--RAKVEEEVNHSIQKVYNEYNGTNSDAPSRAIDYVQRQLHCCGITNYLDWRNTSWFNESR--NNSVPLSCCKPNVSNCTGSLSRPGDLYPEGC 198          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: cd151 (CD151 antigen-like [Source:NCBI gene;Acc:103041246])

HSP 1 Score: 56.225 bits (134), Expect = 6.916e-9
Identity = 40/123 (32.52%), Postives = 54/123 (43.90%), Query Frame = 1
Query:  418 IEFGVTIYIYSNRK-PVEYFANKEFR---KLFMIYYGNSPA---ITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWL---PNNGMLFPVGCINAIISWVIKHL 756
            I  GV  Y+Y     P  Y  N+E R   K  M+     P    +T  VD  QQ  +CCG +   DW+   W  T  D    VP SCC      C L   P+N      GCI+ +  ++++HL
Sbjct:  104 ITAGVLAYVYYQECFPFCYQLNEELRADLKETMVQKYQQPGEDHVTRAVDKLQQDLKCCGSNSSADWQQGTWIHTFAD-GRLVPDSCCKTPTDHCGLRDHPSNIYKVEGGCISKLEEFILQHL 225          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan3a (tetraspanin 3 [Source:NCBI gene;Acc:103046031])

HSP 1 Score: 53.9138 bits (128), Expect = 3.803e-8
Identity = 33/89 (37.08%), Postives = 46/89 (51.69%), Query Frame = 1
Query:  463 VEYFANKEFRKLFMIYYG-NSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCW--LPNNGMLFPVGC 720
            VE   N   +K++  Y G NS A +  +D  Q+   CCG+    DW+ + W+  S   N +VP SCC P  S+C   L   G L+P GC
Sbjct:   87 VEEEVNHSIQKVYNEYNGTNSDAPSRAIDYVQRQLHCCGITNYLDWRNTSWFNESR--NNSVPLSCCKPNVSNCTGSLSRPGDLYPEGC 173          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan11 (tetraspanin-11-like [Source:NCBI gene;Acc:103024246])

HSP 1 Score: 53.9138 bits (128), Expect = 4.278e-8
Identity = 36/121 (29.75%), Postives = 50/121 (41.32%), Query Frame = 1
Query:  409 MIFIEFGVTIYIYSNRKPVEYFANKEFRKLFMIYYGN--SPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWL---PNNGMLFPVGCINAIISWVIKHL 756
            +I +  GV  Y+Y  R   E    +   K     Y       IT  VD  QQ F+CCG +   DWK S + ++       VP SCC  +   C     P+N      GCI  +  ++  HL
Sbjct:  103 LIELVAGVLAYVYYQRLSEEL--KQHLSKTMTENYDQLGKEGITRAVDRLQQDFKCCGSNNSSDWKHSVYVQSPEAQGRVVPDSCCKTITPECGRRDHPSNIYKVEGGCITKLEHFLADHL 221          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: CD151 (CD151 molecule (Raph blood group) [Source:HGNC Symbol;Acc:HGNC:1630])

HSP 1 Score: 55.8398 bits (133), Expect = 6.503e-10
Identity = 32/113 (28.32%), Postives = 48/113 (42.48%), Query Frame = 1
Query:  427 GVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWL---PNNGMLFPVGCINAIISWVIKHL 756
            GV  YIY  +  +E   +     +          +T+ VD  QQ F+CCG     DW  S + +++   +  VP SCC     SC     P+N      GCI  +  ++  HL
Sbjct:   16 GVLAYIYHQQLSLELHQHLNSTMVENYQQDQQERVTSAVDKLQQEFKCCGSKNYQDWASSRYIRSAASNDRLVPDSCCKTRTPSCGKRTHPSNIYNVEGGCITKLEKFLSDHL 128          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: CD151 (CD151 molecule (Raph blood group) [Source:HGNC Symbol;Acc:HGNC:1630])

HSP 1 Score: 51.6026 bits (122), Expect = 4.669e-8
Identity = 33/115 (28.70%), Postives = 50/115 (43.48%), Query Frame = 1
Query:  427 GVTIYIYSNRKPVEYFANKEFRKLFMIYYG--NSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWL---PNNGMLFPVGCINAIISWVIKHL 756
            G+  Y+Y  R+ +         K  +  YG  +   +T  +D  QQ F+CCG    +DW+ S W K +      VP SCC    + C     P+N      GCI  +   + +HL
Sbjct:  109 GILAYLY--RQQLSEELKSHMNKTIVESYGQPDQQRVTDAMDKLQQEFKCCGSHDWNDWQRSDWVKVAAAEGRLVPDSCCKSPTTRCGRRDHPSNINRVEGGCITKLEVILQEHL 221          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: tspan15 (tetraspanin 15 [Source:ZFIN;Acc:ZDB-GENE-050417-295])

HSP 1 Score: 51.6026 bits (122), Expect = 5.332e-8
Identity = 36/131 (27.48%), Postives = 59/131 (45.04%), Query Frame = 1
Query:  412 IFIEFGVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNAT--VPHSCCDPLWSSCWLPN---------------NGMLFPVGCINAIISWVIKH 753
            + IE    I     R   + F N   RK    YY +       +D+ Q+ F+CCG     DW+V+ ++  S+   A+  VP++CCD L  S  + N                G ++  GC++A++ W+I H
Sbjct:  104 LIIELIGGIVALVFRNSTQGFINDNIRKGIENYY-DDLDFKNIMDSVQRKFQCCGGQDYTDWRVNVYHSCSSPGPASCGVPYTCCDVLEGSQPVKNTQCGFGALKLERLQLRGQIYTRGCVDALLIWLIDH 233          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO47698 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLI5])

HSP 1 Score: 56.6102 bits (135), Expect = 1.117e-9
Identity = 38/117 (32.48%), Postives = 55/117 (47.01%), Query Frame = 1
Query:  418 IEFGVTIYIY-SNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWL---PNNGMLFPVGCINAIISWVIKHL 756
            I  GV   IY S    + Y      R   M  YG + A+T  +D+ Q+ F+CCG  G D W  + W ++    N +VP SCC      C +   PNN   F  GCI+ +  + + +L
Sbjct:   76 IATGVVAVIYRSEVSKISYELEVGIRGK-MNRYGFTDAVTKAIDDLQKEFKCCGDRGMDSWNNTSWKQSEISGNNSVPDSCCKSPSPGCGIRLHPNNIQEF--GCISKLEKFFLDNL 189          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO35917 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK24])

HSP 1 Score: 55.4546 bits (132), Expect = 5.073e-9
Identity = 36/122 (29.51%), Postives = 54/122 (44.26%), Query Frame = 1
Query:  409 MIFI-EFGVTIYIYSNRKPVEYFANKEFRKLFMIYYG--NSPAITTEVDNFQQLFRCCGL-DGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSC--WLPNNGMLFPVGCINAIISWVIKHL 756
            +IF+ E    I  Y+ R  V     K   +   + YG  N    T  VD  Q +F+CCG   G  DW  + W K+  +TN TVP SCC    + C     ++   +  GC   +  ++  H+
Sbjct:   92 VIFVLEIASGILAYTKRDKVISSVEKALNQSISLDYGQSNKEKATKAVDRAQSIFKCCGATQGPKDWANTAWAKS--NTNQTVPESCCKKKAAGCNGAPADSDTYYQKGCSQGLQDFIKSHM 211          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO35283 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLY4])

HSP 1 Score: 49.6766 bits (117), Expect = 4.545e-7
Identity = 34/114 (29.82%), Postives = 49/114 (42.98%), Query Frame = 1
Query:  421 EFGVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSP--AITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWLPNNGMLFPVGCINAIISWVIKHL 756
            E    +  Y+ R  V+     +  K     YG+S    +T   D  Q+  +CCG++G  DWK S  Y    +  +TVP SCC      C    NG +   GC N ++  V   L
Sbjct:   99 EIAAAVLAYNYRGKVKDEIESDLTKALKGDYGSSGQDGVTKAFDALQEKQKCCGVNGYLDWKASKKY----NGTSTVPDSCCVVKADGCGKAVNG-INKGGCFNKMVEVVKDKL 207          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO38288 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDC9])

HSP 1 Score: 47.3654 bits (111), Expect = 2.523e-6
Identity = 29/125 (23.20%), Postives = 58/125 (46.40%), Query Frame = 1
Query:  409 MIFIEFGVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNAT--VPHSCC--DPLWSSCWL----------PNNGMLFPVGCINAIISW 741
            + F++  + ++++  +  VE    ++ +     Y  N+  +   +D  QQ F+CCG  G +DW  + ++  S+  +    VP+SCC  D +   C              + ++F  GC+NA+  W
Sbjct:   95 IFFLQLALGVFVFVFQDKVEAVIVEKLQTAVTKYRDNAD-LQNLIDGVQQEFKCCGAKGINDWDKNIYFNCSSPGSEACGVPYSCCIKDTINRQCGYGIRKSGTPTSDQSKIIFIGGCVNAVKDW 218          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO46715 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPD1])

HSP 1 Score: 46.595 bits (109), Expect = 4.507e-6
Identity = 25/102 (24.51%), Postives = 50/102 (49.02%), Query Frame = 1
Query:  493 KLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNAT--VPHSCC--DPLWSSCW---------LPNNGMLFPVGCINAIISWVIKHLY 759
            KLF+++Y +   +   +D  Q   +CCG     DW  + ++  S        VPHSCC  D + + C          L  + +++  GC++++  W++++L+
Sbjct:  116 KLFVVHYQDDLDLQNAIDGIQSNLKCCGGYSYHDWNHNKYFNCSAQAVEACGVPHSCCVEDQINTQCGFGVRREKSVLEASSVIYVRGCVDSLSDWMVENLH 217          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: ENSORLT00000001610.2 (CD151 molecule (Raph blood group) [Source:NCBI gene;Acc:101161865])

HSP 1 Score: 59.3066 bits (142), Expect = 6.064e-10
Identity = 38/113 (33.63%), Postives = 50/113 (44.25%), Query Frame = 1
Query:  427 GVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWL---PNNGMLFPVGCINAIISWVIKHL 756
            GV  YIY  +   E   N +   +     G+   IT  VD  QQ F+CCG +   DWK + W     DT   VP SCC  L   C +   P+N      GCI  +  ++  HL
Sbjct:  108 GVLAYIYYQQLNEELKLNLKETLIRKYEVGSYEHITRAVDKLQQEFKCCGSNSSSDWKENSWV---MDTGRKVPDSCCKTLTEKCGVRDHPSNIYKVEGGCITKLEKFIQDHL 217          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan3b (tetraspanin-3 [Source:NCBI gene;Acc:101165292])

HSP 1 Score: 57.7658 bits (138), Expect = 2.420e-9
Identity = 37/97 (38.14%), Postives = 50/97 (51.55%), Query Frame = 1
Query:  439 YIYSNRKPVEYFANKEFRKLFMIYYG-NSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSC--WLPNNGMLFPVGC 720
            YIY  R  VE   N   +K++  Y G NS A +  +D  Q+   CCG+    DW+ +HW+  S   N +VP SCC P  S+C   L   G L+  GC
Sbjct:  105 YIY--RAKVEDQVNHSIQKVYNEYSGINSDAPSRAIDYVQKQLHCCGIHNYSDWRNTHWFIESK--NNSVPVSCCQPNISNCTGTLTRPGDLYQEGC 197          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan11 (tetraspanin 11 [Source:NCBI gene;Acc:101168088])

HSP 1 Score: 52.7582 bits (125), Expect = 9.549e-8
Identity = 35/121 (28.93%), Postives = 50/121 (41.32%), Query Frame = 1
Query:  409 MIFIEFGVTIYIYSNRKPVEYFANKEFRKLFMIYYGN--SPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWL---PNNGMLFPVGCINAIISWVIKHL 756
            +I +  GV  Y+Y  R   E    +   +     Y      AIT  VD  QQ F+CCG +   DW  S +  +       VP SCC  +  +C     P+N      GCI  +  ++  HL
Sbjct:  103 LIELVAGVLAYVYYQRLSEEL--KQHLNQTMSENYAQPGKEAITAAVDRLQQDFKCCGSNNSQDWAHSVYISSIAAEQRVVPDSCCKTITHACGKRDHPSNIYKVEGGCITKLEQFLADHL 221          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan11 (tetraspanin 11 [Source:NCBI gene;Acc:101168088])

HSP 1 Score: 52.7582 bits (125), Expect = 1.091e-7
Identity = 35/121 (28.93%), Postives = 50/121 (41.32%), Query Frame = 1
Query:  409 MIFIEFGVTIYIYSNRKPVEYFANKEFRKLFMIYYGN--SPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWL---PNNGMLFPVGCINAIISWVIKHL 756
            +I +  GV  Y+Y  R   E    +   +     Y      AIT  VD  QQ F+CCG +   DW  S +  +       VP SCC  +  +C     P+N      GCI  +  ++  HL
Sbjct:  103 LIELVAGVLAYVYYQRLSEEL--KQHLNQTMSENYAQPGKEAITAAVDRLQQDFKCCGSNNSQDWAHSVYISSIAAEQRVVPDSCCKTITHACGKRDHPSNIYKVEGGCITKLEQFLADHL 221          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan11 (tetraspanin 11 [Source:NCBI gene;Acc:101168088])

HSP 1 Score: 52.373 bits (124), Expect = 1.374e-7
Identity = 35/121 (28.93%), Postives = 50/121 (41.32%), Query Frame = 1
Query:  409 MIFIEFGVTIYIYSNRKPVEYFANKEFRKLFMIYYGN--SPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWL---PNNGMLFPVGCINAIISWVIKHL 756
            +I +  GV  Y+Y  R   E    +   +     Y      AIT  VD  QQ F+CCG +   DW  S +  +       VP SCC  +  +C     P+N      GCI  +  ++  HL
Sbjct:  103 LIELVAGVLAYVYYQRLSEEL--KQHLNQTMSENYAQPGKEAITAAVDRLQQDFKCCGSNNSQDWAHSVYISSIAAEQRVVPDSCCKTITHACGKRDHPSNIYKVEGGCITKLEQFLADHL 221          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000021636.1 (SMESG000021636.1)

HSP 1 Score: 309.686 bits (792), Expect = 3.910e-106
Identity = 202/220 (91.82%), Postives = 203/220 (92.27%), Query Frame = 1
Query:  229 MANGQMEYGIDIVDGFSNKXXXXXXXXXXXXXXXXXXXXYCSTKKDXXXXXXXXXXXXXXMIFIEFGVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWLPNNGMLFPVGCINAIISWVIKHLYXXXXXXXXXXXXXXXXXXXXXXXYYRKTKMKQRDEAFFEIIAQ 888
            MANGQMEYGIDIVDGFSNKATLITAFIFGIIILSIAILGYCSTKKDSRYLLRIYLLLILSMIFIEFGVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWLPNNGMLFPVGCINAIIS  +  L             QVIVIICISCVYYRKTKMKQRDEAFFEIIAQ
Sbjct:   36 MANGQMEYGIDIVDGFSNKATLITAFIFGIIILSIAILGYCSTKKDSRYLLRIYLLLILSMIFIEFGVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWLPNNGMLFPVGCINAIISSGVIGL-------------QVIVIICISCVYYRKTKMKQRDEAFFEIIAQ 242          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000021636.1 (SMESG000021636.1)

HSP 1 Score: 307.76 bits (787), Expect = 4.895e-106
Identity = 202/220 (91.82%), Postives = 203/220 (92.27%), Query Frame = 1
Query:  229 MANGQMEYGIDIVDGFSNKXXXXXXXXXXXXXXXXXXXXYCSTKKDXXXXXXXXXXXXXXMIFIEFGVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWLPNNGMLFPVGCINAIISWVIKHLYXXXXXXXXXXXXXXXXXXXXXXXYYRKTKMKQRDEAFFEIIAQ 888
            MANGQMEYGIDIVDGFSNKATLITAFIFGIIILSIAILGYCSTKKDSRYLLRIYLLLILSMIFIEFGVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWLPNNGMLFPVGCINAIIS  +  L             QVIVIICISCVYYRKTKMKQRDEAFFEIIAQ
Sbjct:    1 MANGQMEYGIDIVDGFSNKATLITAFIFGIIILSIAILGYCSTKKDSRYLLRIYLLLILSMIFIEFGVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWLPNNGMLFPVGCINAIISSGVIGL-------------QVIVIICISCVYYRKTKMKQRDEAFFEIIAQ 207          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000021636.1 (SMESG000021636.1)

HSP 1 Score: 296.975 bits (759), Expect = 8.778e-102
Identity = 197/215 (91.63%), Postives = 198/215 (92.09%), Query Frame = 1
Query:  244 MEYGIDIVDGFSNKXXXXXXXXXXXXXXXXXXXXYCSTKKDXXXXXXXXXXXXXXMIFIEFGVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWLPNNGMLFPVGCINAIISWVIKHLYXXXXXXXXXXXXXXXXXXXXXXXYYRKTKMKQRDEAFFEIIAQ 888
            MEYGIDIVDGFSNKATLITAFIFGIIILSIAILGYCSTKKDSRYLLRIYLLLILSMIFIEFGVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWLPNNGMLFPVGCINAIIS  +  L             QVIVIICISCVYYRKTKMKQRDEAFFEIIAQ
Sbjct:    1 MEYGIDIVDGFSNKATLITAFIFGIIILSIAILGYCSTKKDSRYLLRIYLLLILSMIFIEFGVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWLPNNGMLFPVGCINAIISSGVIGL-------------QVIVIICISCVYYRKTKMKQRDEAFFEIIAQ 202          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000021642.1 (SMESG000021642.1)

HSP 1 Score: 100.138 bits (248), Expect = 1.236e-24
Identity = 67/165 (40.61%), Postives = 90/165 (54.55%), Query Frame = 1
Query:  229 MANGQMEYGIDIVDGFSNKXXXXXXXXXXXXXXXXXXXXYCSTKKDXXXXXXXXXXXXXXMIFIEFGVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWLPNNGMLFPVGCI 723
            +ANG M+Y  DI++  +N+  LI   + GI+I  I   G C   K+SR LL IY++L+ ++I  E G  I+    R+P+E     +F   F   YGN   IT  +DN QQ+  CCG   + DW  S+WY    D   T P SCC      CWL NNG +FP GCI
Sbjct:   36 LANGTMKYVDDIINASTNRNILIGLLVIGIVIFIIGFSGCCGAVKESRMLLAIYIILVCAIIIAEVGFGIFAIVKRQPLEDAIKNDFTNTFQNRYGNDTTITVAIDNLQQIIPCCGATKQLDWTQSNWYLNKLDKVQTAPKSCCKLPTDYCWLTNNGTMFPDGCI 200          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000021637.1 (SMESG000021637.1)

HSP 1 Score: 71.2478 bits (173), Expect = 2.621e-14
Identity = 46/132 (34.85%), Postives = 72/132 (54.55%), Query Frame = 1
Query:  349 CSTKKDXXXXXXXXXXXXXXMIFIEFGVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPAITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSSCWLPNNGMLFPVGCINAIISWV 744
            C   K+SR+LLRIY++ ++ +I  E  +  +++    P       EF K+ M+ YG     T  V+  QQ F CCG+    DWK S+WYK+ N     VP+SCC P  + CWL N   +  +GC+  ++ ++
Sbjct:   68 CGAVKESRFLLRIYVVSLVVIILSELAIGTFLFIKWNPAAEKLKAEFIKMVMVDYGVKMDKTEIVNEIQQGFGCCGVYNDTDWKESYWYKSINKAQ-VVPNSCC-PSNNKCWLDNKEKVMKIGCLKKLMQYL 197          
The following BLAST results are available for this feature:
BLAST of Tetraspanin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CD1511.354e-927.03CD151 molecule (Raph blood group) [Source:HGNC Sym... [more]
CD1514.937e-927.43CD151 molecule (Raph blood group) [Source:HGNC Sym... [more]
CD1517.497e-927.43CD151 molecule (Raph blood group) [Source:HGNC Sym... [more]
CD1517.497e-927.43CD151 molecule (Raph blood group) [Source:HGNC Sym... [more]
CD1517.497e-927.43CD151 molecule (Raph blood group) [Source:HGNC Sym... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tsp-71.963e-633.33Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q9XVI4][more]
back to top
BLAST of Tetraspanin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tspan3b3.413e-1038.14tetraspanin 3b [Source:ZFIN;Acc:ZDB-GENE-070424-42... [more]
tspan3b3.413e-1038.14tetraspanin 3b [Source:ZFIN;Acc:ZDB-GENE-070424-42... [more]
tspan3a1.991e-936.27tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-77... [more]
tspan3a1.991e-936.27tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-77... [more]
tspan3a1.991e-936.27tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-77... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cd1511.215e-830.17CD151 molecule (Raph blood group) [Source:NCBI gen... [more]
cd1515.148e-830.00CD151 molecule (Raph blood group) [Source:NCBI gen... [more]
TSPAN119.675e-731.65II-FBPL precursor [Source:Xenbase;Acc:XB-GENE-5830... [more]
fam110d1.959e-626.92family with sequence similarity 110 member D [Sour... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cd1511.620e-925.66CD151 antigen [Source:MGI Symbol;Acc:MGI:1096360][more]
Cd1511.620e-925.66CD151 antigen [Source:MGI Symbol;Acc:MGI:1096360][more]
Cd1511.620e-925.66CD151 antigen [Source:MGI Symbol;Acc:MGI:1096360][more]
Tspan31.999e-833.68tetraspanin 3 [Source:MGI Symbol;Acc:MGI:1928098][more]
Tspan32.733e-832.00tetraspanin 3 [Source:MGI Symbol;Acc:MGI:1928098][more]
back to top
BLAST of Tetraspanin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9QZA6|CD151_RAT6.143e-927.43CD151 antigen OS=Rattus norvegicus OX=10116 GN=Cd1... [more]
sp|O35566|CD151_MOUSE1.133e-825.66CD151 antigen OS=Mus musculus OX=10090 GN=Cd151 PE... [more]
sp|P48509|CD151_HUMAN3.600e-827.43CD151 antigen OS=Homo sapiens OX=9606 GN=CD151 PE=... [more]
sp|Q3SZR9|TSN3_BOVIN4.029e-833.68Tetraspanin-3 OS=Bos taurus OX=9913 GN=TSPAN3 PE=2... [more]
sp|Q9QY33|TSN3_MOUSE1.398e-733.68Tetraspanin-3 OS=Mus musculus OX=10090 GN=Tspan3 P... [more]
back to top
BLAST of Tetraspanin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4W3HG893.744e-1133.04Uncharacterized protein OS=Callorhinchus milii OX=... [more]
V9KYQ92.904e-1033.04Tetraspanin OS=Callorhinchus milii OX=7868 PE=2 SV... [more]
A0A0C9RXK71.793e-933.33Tetraspanin (Fragment) OS=Amblyomma americanum OX=... [more]
A0A224Z0M71.837e-933.33Tetraspanin OS=Rhipicephalus zambeziensis OX=60191... [more]
A0A224Z5H71.846e-933.33Tetraspanin OS=Rhipicephalus zambeziensis OX=60191... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tspan3a2.851e-938.14tetraspanin 3 [Source:NCBI gene;Acc:103046031][more]
tspan3a3.711e-938.14tetraspanin 3 [Source:NCBI gene;Acc:103046031][more]
cd1516.916e-932.52CD151 antigen-like [Source:NCBI gene;Acc:103041246... [more]
tspan3a3.803e-837.08tetraspanin 3 [Source:NCBI gene;Acc:103046031][more]
tspan114.278e-829.75tetraspanin-11-like [Source:NCBI gene;Acc:10302424... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CD1516.503e-1028.32CD151 molecule (Raph blood group) [Source:HGNC Sym... [more]
CD1514.669e-828.70CD151 molecule (Raph blood group) [Source:HGNC Sym... [more]
tspan155.332e-827.48tetraspanin 15 [Source:ZFIN;Acc:ZDB-GENE-050417-29... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO476981.117e-932.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359175.073e-929.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352834.545e-729.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382882.523e-623.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467154.507e-624.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000001610.26.064e-1033.63CD151 molecule (Raph blood group) [Source:NCBI gen... [more]
tspan3b2.420e-938.14tetraspanin-3 [Source:NCBI gene;Acc:101165292][more]
tspan119.549e-828.93tetraspanin 11 [Source:NCBI gene;Acc:101168088][more]
tspan111.091e-728.93tetraspanin 11 [Source:NCBI gene;Acc:101168088][more]
tspan111.374e-728.93tetraspanin 11 [Source:NCBI gene;Acc:101168088][more]
back to top
BLAST of Tetraspanin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021636.13.910e-10691.82SMESG000021636.1[more]
SMESG000021636.14.895e-10691.82SMESG000021636.1[more]
SMESG000021636.18.778e-10291.63SMESG000021636.1[more]
SMESG000021642.11.236e-2440.61SMESG000021642.1[more]
SMESG000021637.12.621e-1434.85SMESG000021637.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019741 ID=SMED30019741|Name=Tetraspanin|organism=Schmidtea mediterranea sexual|type=transcript|length=917bp
GTAAAATTAAATTTTAAAATTTATAATTTATACTGTCACATTTCAAGCTG
TAATATGGTACTTCCAAAATGAAATTAGCTGATTCATAATTTTTTTTCTA
AGCAAATTTTATAGGAGATATTTCCATTAAAATGTGCTGTAATTGGTGTT
CAAAACTGTCGAAATGTATTTTATTATTACTAAATTTTATTTTTGCACTT
GGTTTTGGTTATTTTATCGTCTATTTACATGGCGAACGGTCAAATGGAGT
ATGGAATTGACATAGTCGACGGTTTTAGTAACAAGGCCACTTTGATAACA
GCCTTTATATTTGGAATCATAATTTTATCCATTGCTATTCTTGGATATTG
TAGTACTAAGAAAGACAGCAGATATTTGTTACGAATTTATCTTTTGCTTA
TTTTATCCATGATTTTCATCGAATTCGGTGTAACAATATATATTTATAGT
AATCGAAAGCCAGTTGAGTACTTCGCCAACAAAGAATTTAGAAAGCTTTT
CATGATTTATTACGGAAACAGCCCAGCAATAACCACTGAAGTCGACAACT
TTCAACAATTATTCCGTTGCTGTGGACTTGACGGCAAAGATGATTGGAAA
GTATCGCATTGGTACAAGACATCAAACGATACGAATGCGACTGTGCCACA
CTCATGTTGTGATCCTCTTTGGAGCTCCTGTTGGCTACCAAATAATGGAA
TGCTGTTTCCAGTTGGATGCATTAATGCTATAATTAGTTGGGTCATAAAA
CATTTATATATAATAATTGGCATAGGCTCGGGAGTTATTGGACTGCAAGT
TATTGTGATTATTTGCATATCCTGCGTTTACTACCGCAAGACAAAGATGA
AACAACGTGACGAAGCATTTTTTGAAATTATCGCTCAATAAAAAAATTTT
ATTTTTTTGAAAAAAAA
back to top

protein sequence of SMED30019741-orf-1

>SMED30019741-orf-1 ID=SMED30019741-orf-1|Name=SMED30019741-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=221bp
MANGQMEYGIDIVDGFSNKATLITAFIFGIIILSIAILGYCSTKKDSRYL
LRIYLLLILSMIFIEFGVTIYIYSNRKPVEYFANKEFRKLFMIYYGNSPA
ITTEVDNFQQLFRCCGLDGKDDWKVSHWYKTSNDTNATVPHSCCDPLWSS
CWLPNNGMLFPVGCINAIISWVIKHLYIIIGIGSGVIGLQVIVIICISCV
YYRKTKMKQRDEAFFEIIAQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR000301Tetraspanin
IPR018499Tetraspanin/Peripherin
IPR008952Tetraspanin_EC2_sf
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000301TetraspaninPRINTSPR00259TMFOURcoord: 178..204
score: 19.7
coord: 45..73
score: 21.35
coord: 18..44
score: 17.73
IPR000301TetraspaninPIRSFPIRSF002419Tetraspanincoord: 6..217
e-value: 1.4E-27
score: 94.1
IPR008952Tetraspanin, EC2 domain superfamilyGENE3DG3DSA:1.10.1450.10coord: 73..170
e-value: 7.4E-9
score: 37.3
IPR008952Tetraspanin, EC2 domain superfamilySUPERFAMILYSSF48652Tetraspanincoord: 73..172
IPR018499Tetraspanin/PeripherinPFAMPF00335Tetraspanincoord: 19..202
e-value: 1.7E-27
score: 96.7
NoneNo IPR availablePANTHERPTHR19282:SF442CD151 ANTIGENcoord: 26..207
NoneNo IPR availablePANTHERPTHR19282TETRASPANINcoord: 26..207
NoneNo IPR availableTMHMMTMhelixcoord: 49..71
NoneNo IPR availableTMHMMTMhelixcoord: 178..200
NoneNo IPR availableTMHMMTMhelixcoord: 20..42