Bestrophin homolog

Overview
NameBestrophin homolog
Smed IDSMED30019729
Length (bp)1794
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Bestrophin homolog (SMED30019729) t-SNE clustered cells

Violin plots show distribution of expression levels for Bestrophin homolog (SMED30019729) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Bestrophin homolog (SMED30019729) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Bestrophin homolog (SMED30019729) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019729

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30019729SMESG000080433.1 SMESG000010902.1 Contig1818GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30019729SMESG000080433.1 SMESG000010902.1 Contig1818GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30019729SMESG000080433.1 SMESG000010902.1 dd_Smed_v4_8882_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30019729SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30019729SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30019729SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019729SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019729SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30019729SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30019729SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30019729SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019729SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST1 (bestrophin 1 [Source:HGNC Symbol;Acc:HGNC:12703])

HSP 1 Score: 247.669 bits (631), Expect = 1.450e-73
Identity = 151/411 (36.74%), Postives = 227/411 (55.23%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMYPAYLK-HPNIIYSLPMVYQSQKADSVEIK-------TFFDSLNATQTE 1458
            MTI Y   V     +G   RLL  W+GS+YKL+Y + + ++  YY+I  IYR AL T  Q+  FE++  +CD+    IPISF+LGF+VT V+ RW+  Y  +P+ +R+  L  G + G D++  L +R+TL+RY NL  +L +R VS  +  RF                         +Q+ F   +T AE +  E ++  +           FWVP  W + L  KA++ G I DP  L S++++++ LR Q   L  +  I IPLVYTQV+ +AVYS+FL  L   QF++P     GHE+DL VP+FT  QF F++GWLKVA  ++NPFG+DD+DF+T+ ++D NL +S     A D+M+    +  P++ ++ P       A S + +       TF  SLN  + E
Sbjct:    1 MTITYTSQVAN-ARLGSFSRLLLCWRGSIYKLLYGEFLIFLLCYYIIRFIYRLAL-TEEQQLMFEKLTLYCDSYIQLIPISFVLGFYVTLVVTRWWNQYENLPWPDRLMSLVSGFVEGKDEQGRL-LRRTLIRYANLGNVLILRSVSTAVYKRFPSAQHL-------------------VQAGF---MTPAEHKQLEKLSLPHNM---------FWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYPGHELDLVVPVFTFLQFFFYVGWLKVAEQLINPFGEDDDDFETNWIVDRNLQVSL---LAVDEMHQDLPRMEPDMYWNKPEPQPPYTAASAQFRRASFMGSTFNISLNKEEME 374          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST3 (bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105])

HSP 1 Score: 234.187 bits (596), Expect = 1.542e-70
Identity = 135/374 (36.10%), Postives = 211/374 (56.42%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMYPAYLKHPNIIY 1371
            MT+ Y   V   T  G   RLL +W+GS+YKL+Y++ + +  +Y  I+L+YR  L T  QKR FE++  +CD     IP++F+LGF+VT V+ RW+  ++ +P+ +R+ FL    ++G D+   L +R+TLMRY+NL+ +L  R VS  +  RF                      D  +++ F   +T  E + F ++ + +          ++WVP  W   L  KA   G I D   L S++++++  R     L  +  + IPLVYTQV+ +AVY++F   L   QF+DP     GH++DLY+PIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+  +D NL +S     A D+M+ +  K    IY
Sbjct:    1 MTVTYSSKVANATFFG-FHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLL-TGVQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMFLISSSVHGSDEHGRL-LRRTLMRYVNLTSLLIFRSVSTAVYKRFP-------------------TMDHVVEAGF---MTTDERKLFNHLKSPHL---------KYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYAGHDLDLYIPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVS---LLAVDEMHMSLPKMKKDIY 337          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST2 (bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107])

HSP 1 Score: 236.884 bits (603), Expect = 2.747e-70
Identity = 140/363 (38.57%), Postives = 207/363 (57.02%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMY 1338
            MT+ Y   V      G   +LL  W+GS+YKL++++L+ ++G Y  ++  YRF L T  QKR FE++V +CD   + IP+SF+LGF+VT V+ RW+  YL +P  + +  +  G ++G D    L  R+TLMRY  LS +L +R VS  +  RF                      D  +++ F   +T  E + FEN+ + +Y+K        +WVP  W S L  +A   G I D   L  ++ +L+V RG+   L  +  I +PLVYTQV+ IA+YSYFL  L   QF+DP      H++DL VPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+ ++D N  +S     A D+MY
Sbjct:    1 MTVTYTARVAN-ARFGGFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVL-TEGQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGRDDRGRL-YRRTLMRYAGLSAVLILRSVSTAVFKRFPTI-------------------DHVVEAGF---MTREERKKFENLNS-SYNK--------YWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSM---LAVDEMY 326          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST2 (bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107])

HSP 1 Score: 236.884 bits (603), Expect = 2.747e-70
Identity = 140/363 (38.57%), Postives = 207/363 (57.02%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMY 1338
            MT+ Y   V      G   +LL  W+GS+YKL++++L+ ++G Y  ++  YRF L T  QKR FE++V +CD   + IP+SF+LGF+VT V+ RW+  YL +P  + +  +  G ++G D    L  R+TLMRY  LS +L +R VS  +  RF                      D  +++ F   +T  E + FEN+ + +Y+K        +WVP  W S L  +A   G I D   L  ++ +L+V RG+   L  +  I +PLVYTQV+ IA+YSYFL  L   QF+DP      H++DL VPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+ ++D N  +S     A D+MY
Sbjct:    1 MTVTYTARVAN-ARFGGFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVL-TEGQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGRDDRGRL-YRRTLMRYAGLSAVLILRSVSTAVFKRFPTI-------------------DHVVEAGF---MTREERKKFENLNS-SYNK--------YWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSM---LAVDEMY 326          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST2 (bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107])

HSP 1 Score: 236.884 bits (603), Expect = 2.747e-70
Identity = 140/363 (38.57%), Postives = 207/363 (57.02%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMY 1338
            MT+ Y   V      G   +LL  W+GS+YKL++++L+ ++G Y  ++  YRF L T  QKR FE++V +CD   + IP+SF+LGF+VT V+ RW+  YL +P  + +  +  G ++G D    L  R+TLMRY  LS +L +R VS  +  RF                      D  +++ F   +T  E + FEN+ + +Y+K        +WVP  W S L  +A   G I D   L  ++ +L+V RG+   L  +  I +PLVYTQV+ IA+YSYFL  L   QF+DP      H++DL VPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+ ++D N  +S     A D+MY
Sbjct:    1 MTVTYTARVAN-ARFGGFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVL-TEGQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGRDDRGRL-YRRTLMRYAGLSAVLILRSVSTAVFKRFPTI-------------------DHVVEAGF---MTREERKKFENLNS-SYNK--------YWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSM---LAVDEMY 326          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-22 (Bestrophin homolog 22 [Source:UniProtKB/Swiss-Prot;Acc:Q23369])

HSP 1 Score: 193.356 bits (490), Expect = 9.994e-55
Identity = 122/369 (33.06%), Postives = 197/369 (53.39%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDN-MKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMYPAYLK 1353
            MTI Y  DV++ T +   F LL RW+GS++K V+  L  +  ++ +I+ IYR+ L +P+Q+  FE+++++ DN +  NIP++FLLGFFV+ V+ARW  +   I +++  + L    I G D+E  + IR+ L+RYL LS  L +R +S Q+  RF   D                            ++T  E+   ++I    YS+        +W  IQWS  L+ +    G +     +N I+ ++   R  + +L  +  + +PLVY QVI +AV  YF+  L   QF+      +G  +DL++PI T+ QFL +MGW+KVA  ++NP G+DD+D + + ++D NL   Y     H    PA  K
Sbjct:    1 MTISYTLDVSQ-TNLQSFFSLLLRWRGSVWKAVFGQLAVWTAVFLLISCIYRYML-SPSQQDVFEQLIRYFDNKLDANIPLTFLLGFFVSFVVARWGSILNGIGWIDDASLLFATYIRGADEETRV-IRRNLVRYLVLSQALVLRDISMQVRKRFPTMDTLAAS----------------------GLMTHEEMDILDHIKDP-YSR--------YWTSIQWSLNLVYECQKKGKVDSYYLMNKIVDEIGKFRHGLASLLKYDWVPVPLVYPQVIFLAVRIYFMICLIGRQFIVTGPNPSG--IDLWLPITTMVQFLVYMGWMKVAEALLNPLGEDDDDLECNYIIDKNLITGYSMVEEHMAKTPAQKK 333          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-22 (Bestrophin homolog 22 [Source:UniProtKB/Swiss-Prot;Acc:Q23369])

HSP 1 Score: 193.356 bits (490), Expect = 1.511e-54
Identity = 122/369 (33.06%), Postives = 197/369 (53.39%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDN-MKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMYPAYLK 1353
            MTI Y  DV++ T +   F LL RW+GS++K V+  L  +  ++ +I+ IYR+ L +P+Q+  FE+++++ DN +  NIP++FLLGFFV+ V+ARW  +   I +++  + L    I G D+E  + IR+ L+RYL LS  L +R +S Q+  RF   D                            ++T  E+   ++I    YS+        +W  IQWS  L+ +    G +     +N I+ ++   R  + +L  +  + +PLVY QVI +AV  YF+  L   QF+      +G  +DL++PI T+ QFL +MGW+KVA  ++NP G+DD+D + + ++D NL   Y     H    PA  K
Sbjct:    1 MTISYTLDVSQ-TNLQSFFSLLLRWRGSVWKAVFGQLAVWTAVFLLISCIYRYML-SPSQQDVFEQLIRYFDNKLDANIPLTFLLGFFVSFVVARWGSILNGIGWIDDASLLFATYIRGADEETRV-IRRNLVRYLVLSQALVLRDISMQVRKRFPTMDTLAAS----------------------GLMTHEEMDILDHIKDP-YSR--------YWTSIQWSLNLVYECQKKGKVDSYYLMNKIVDEIGKFRHGLASLLKYDWVPVPLVYPQVIFLAVRIYFMICLIGRQFIVTGPNPSG--IDLWLPITTMVQFLVYMGWMKVAEALLNPLGEDDDDLECNYIIDKNLITGYSMVEEHMAKTPAQKK 333          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-23 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:A5JYR2])

HSP 1 Score: 190.66 bits (483), Expect = 2.142e-54
Identity = 124/369 (33.60%), Postives = 187/369 (50.68%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATA-HDDMYPAYLK 1353
            MTI Y D            +LL RWKGSL+K ++K L+ ++ +YY+IN  YRF + T  Q+  F + V   D     IP++FLLGF+V  ++ RW+     I + + + +    LI G D E  + IR+T+ RY  L+ +L  R +S ++  R+                      D  + S    ++T  E+  F++I        K      +WVP+ W   ++ + F  G ++    L  ++  L+  R     L I+  I IPLVYTQV  I+VY YFL  L   Q+  P        VD+YVPIFTI QFLF++GWLKV   +M PFG DDEDF+ + +L+ NL +S       H+ + P Y++
Sbjct:    1 MTISYSD---------TFLKLLFRWKGSLWKAIWKHLLIFLTMYYIINAYYRFGM-TKEQQNEFIKYVMLVDGWTKEIPLTFLLGFYVAMIVRRWWDCCQLISWPDHLLYNVSALIRGQDPETRI-IRKTIARYTILTSVLAWRSISLRVLARYP-------------------TDDHLVDS---GLMTKEEMVMFKSILVHVDPHQK------WWVPLNWIQTMMVRCFEKGTLTHTNELRVLLDALEKYRNGFFQLFIYDWIAIPLVYTQVSTISVYGYFLFALIGRQY--PSKNENEEIVDVYVPIFTILQFLFYVGWLKVGEDLMFPFGADDEDFEFNYILERNLEVSMLIVDELHNQVPPVYVE 328          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-3 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O17206])

HSP 1 Score: 194.897 bits (494), Expect = 3.909e-54
Identity = 118/371 (31.81%), Postives = 196/371 (52.83%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITG---HEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMYPAYLK 1353
            MT+ Y  DV   +   C+++LL RWKGS++K V+ +L+ ++ +Y V+++IYR  L T  Q+ +FE++  F D   N IPI+F+LGF+V+ V  RW+Q++  I +++         I G + E+   +R+  +RY  L+  +  R V+  +  RF            F H                 ++T+ E+  FE+I + +          ++W P+ W   ++  A   G IS       ++  +   R  + +L +F  + +PLVYTQV+ +AV SYFL  LF  Q++ PES         +DLYVPI ++ QF+FF+GW+KVA  ++NP G+DD+DF+ + +LD NL +         + YP   K
Sbjct:    1 MTVTYSLDVAS-SSFFCLYKLLFRWKGSIWKSVWAELVVWLCLYAVLSVIYR-CLLTMKQRATFEDLCIFFDTYSNFIPITFMLGFYVSAVFTRWWQIFDNIGWIDTPCLWITQYIKG-ETERAKCVRRNCIRYSILTQAMVYRDVAASVRKRFPT----------FNHLVT------------AGLMTEKEMAEFESIPSPH---------AKYWQPMHWLFSMITLARDEGMISSDIIYVDLMEKMRQFRVNILSLTLFDWVPVPLVYTQVVHLAVRSYFLIALFGRQYLHPESNRLNDFKQTIDLYVPIMSLLQFIFFIGWMKVAEVLLNPLGEDDDDFECNWILDRNLQVGLMVVDTAYNRYPTLEK 337          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-5 (Bestrophin homolog 5 [Source:UniProtKB/Swiss-Prot;Acc:P34319])

HSP 1 Score: 189.889 bits (481), Expect = 1.143e-53
Identity = 126/427 (29.51%), Postives = 211/427 (49.41%), Query Frame = 1
Query:  301 IFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMYPAYLKHPNIIYSLPMVYQSQKADSVEIKTFFDSLNATQTELAREYAAFQSEICNNQKPVISANKVFNFLRSLKMCIPSRRK 1581
            I R++ +W+GSL++ VYK+L+ ++  Y ++++IYRFAL T +QK  FE   ++CD     +P++F+LGFF   +I RW +LY  +  ++ +A      + G D ++  +IR+ ++RY  +S  L  R +   +  RF   +          H    FN    I+S ++K                            +WV   W+  LL  A     I      N+I  ++   R  + T+ ++  + IPL+Y Q++ +AV++YF   +F  QF          EVDLY+P  TI +F+F+MGWLKVAM ++NPFG+D +DF  + ++D NL +     T+ DD Y    +    +++   V      D+  +K  F S  A Q E   E +  + E    +  +I+A K  N    LK+ + S R+
Sbjct:   60 IVRMIFKWRGSLWQAVYKELIVWICAYSLVSVIYRFAL-TRSQKDIFERFGEYCDARMGYLPLNFVLGFFCNIIIRRWLKLYTSLGNIDNIALFVSAYVRGTD-DRARQIRRNIIRYCVISQCLVFRDIHVGVRRRFPTLEAVAQAGIMLPHELEKFN---SIKSRYQK----------------------------YWVSFNWALELLNVAKTEKSIDGDNARNAIAQEISKFRSALTTVSMYDWVPIPLMYPQLVNMAVHTYFFLCIFTRQFFISADAHNKTEVDLYIPFMTIIEFIFYMGWLKVAMELLNPFGEDADDFDCNLLIDRNLAIGL---TSVDDAYDQLPEVKPDVFTGGSVKPLDSDDTRSLKYHFGS--AAQME---EISYLKKE----ENKMIAAGKKPN---KLKLWVKSVRR 438          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0082183)

HSP 1 Score: 254.988 bits (650), Expect = 2.604e-75
Identity = 140/373 (37.53%), Postives = 211/373 (56.57%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGH-----EVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMYPAYLK 1353
            MTI Y  +V      GC  +LL RW+GS+YKLV+ DL+ ++ IYY IN++YRF L  PAQK +FE IV++CD+ +  IP+SF+LGF+V+ V+ RW+  Y  IP+ + +A      ++G D E+   +R+T+MRY+ L   + +  VS ++  RF                 +N   +  + +   K I +   +AF               P + W+PI W++ ++ +A   G I D   + +II +L+  RGQ   L  +  I +PLVYTQV+ +AVYSYFL      Q+ D   K+ G+     +VDLY P+FT  QF F+MGWLKVA  ++NPFG+DD+DF+ + M+D NL +SY         +P  LK
Sbjct:    1 MTITYTGEVATCRGFGCFLKLLLRWRGSIYKLVWLDLLAFLTIYYAINMVYRFGLN-PAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQD-ERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPG---------------LNNLVEAGLLNDNEKTIIETMNKAFPR-------------PSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTD--GKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELLK 341          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0337020)

HSP 1 Score: 254.603 bits (649), Expect = 4.172e-75
Identity = 140/373 (37.53%), Postives = 211/373 (56.57%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGH-----EVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMYPAYLK 1353
            MTI Y  +V      GC  +LL RW+GS+YKLV+ DL+ ++ IYY IN++YRF L  PAQK +FE IV++CD+ +  IP+SF+LGF+V+ V+ RW+  Y  IP+ + +A      ++G D E+   +R+T+MRY+ L   + +  VS ++  RF                 +N   +  + +   K I +   +AF               P + W+PI W++ ++ +A   G I D   + +II +L+  RGQ   L  +  I +PLVYTQV+ +AVYSYFL      Q+ D   K+ G+     +VDLY P+FT  QF F+MGWLKVA  ++NPFG+DD+DF+ + M+D NL +SY         +P  LK
Sbjct:    1 MTITYTGEVATCRGFGCFLKLLLRWRGSIYKLVWLDLLAFLTIYYAINMVYRFGLN-PAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQD-ERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPG---------------LNNLVEAGLLNDNEKTIIETMNKAFPR-------------PSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTD--GKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELLK 341          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0114590)

HSP 1 Score: 254.603 bits (649), Expect = 7.844e-75
Identity = 141/373 (37.80%), Postives = 210/373 (56.30%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGH-----EVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMYPAYLK 1353
            MTI Y  +V      GC  +LL RW+GS+YKLV+ DL+ ++ IYY IN++YRF L  PAQK +FE IV++CD+ +  IP+SF+LGF+V+ V+ RW+  Y  IP+ + +A      ++G D E+   +R+T+MRY+ L   + +  VS ++  RF   +             +N N          K I +   +AF               P + W+PI W++ ++ +A   G I D   + +II +L+  RGQ   L  +  I +PLVYTQV+ +AVYSYFL      Q+ D   K+ G+     +VDLY P+FT  QF F+MGWLKVA  ++NPFG+DD+DF+ + M+D NL +SY         +P  LK
Sbjct:    1 MTITYTGEVATCRGFGCFLKLLLRWRGSIYKLVWLDLLAFLTIYYAINMVYRFGLN-PAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQD-ERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPGLNNL------VEAGLLNDNE---------KTIIETMNKAFPR-------------PSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTD--GKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELLK 341          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0306023)

HSP 1 Score: 254.218 bits (648), Expect = 1.331e-74
Identity = 140/373 (37.53%), Postives = 211/373 (56.57%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGH-----EVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMYPAYLK 1353
            MTI Y  +V      GC  +LL RW+GS+YKLV+ DL+ ++ IYY IN++YRF L  PAQK +FE IV++CD+ +  IP+SF+LGF+V+ V+ RW+  Y  IP+ + +A      ++G D E+   +R+T+MRY+ L   + +  VS ++  RF                 +N   +  + +   K I +   +AF               P + W+PI W++ ++ +A   G I D   + +II +L+  RGQ   L  +  I +PLVYTQV+ +AVYSYFL      Q+ D   K+ G+     +VDLY P+FT  QF F+MGWLKVA  ++NPFG+DD+DF+ + M+D NL +SY         +P  LK
Sbjct:    1 MTITYTGEVATCRGFGCFLKLLLRWRGSIYKLVWLDLLAFLTIYYAINMVYRFGLN-PAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQD-ERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPG---------------LNNLVEAGLLNDNEKTIIETMNKAFPR-------------PSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTD--GKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELLK 341          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best3 (gene:FBgn0036492 transcript:FBtr0075618)

HSP 1 Score: 232.646 bits (592), Expect = 1.005e-68
Identity = 134/404 (33.17%), Postives = 219/404 (54.21%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFP--PEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMYPAYLKHPNII----------YSLPMVYQSQKADSVEIKT 1425
            MT+ Y  +V   +  GC ++LL RW+ S+YK+++ DL+ ++  +Y + +IYR+AL+    K  FE+IV +C +  N IP+SF+LGF+V  +I RW+  Y+ +P+ + +A     L+ G D+   L +R+T+MRY+ L+  + +  +S  I  RF                            T+ ++I   EV       A        KFP  P++W+PI W++ ++ +A   G I D  +L S+I +L+  R   + L  +  I +PLVYTQV+ +AVYSYF+  +F  Q++D + K   + V  Y P+F+  +F FFMGWLKVA  ++ PFGDDD+DF+ + ++D NL +SY      D+M+     HP ++            LP   +S +A+  E  T
Sbjct:    1 MTVSYTAEVATCSHFGCFWKLLMRWRASIYKIIWVDLLAFLSCFYFMAVIYRYALRD-VDKPVFEDIVMYCHSYSNLIPLSFVLGFYVGIIIERWWNQYITVPWPDPLAVYVSALVRGQDEHGRL-MRRTIMRYVCLALTMVLSMISPVIKRRF---------------------------PTYDQLI---EVGLLNANEANIMKAMDVKFPKHPKYWMPIVWAASIVTRARKEGRIWDDFSLKSMIDELNKFRAGCNMLIHYDTISVPLVYTQVVTLAVYSYFVASIFGHQWIDRDIKHYNNIVSYYFPLFSTLEFFFFMGWLKVAETLICPFGDDDDDFELNWLIDRNLQVSYLIV---DEMHN---DHPQLVRDQYWDEVFPAELPYAVESDRAEHPEAST 366          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 245.358 bits (625), Expect = 4.878e-72
Identity = 135/363 (37.19%), Postives = 210/363 (57.85%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMY 1338
            MT+ Y   V     +G  +RLL RWKGS+YKL+Y++L+ +  +Y +I++ YR  L T  Q+R FE++  +CD     IP+SF+LGF+VT V++RW+  +  +P+ +R++ L  G + G D+   L IR++LMRY NLS IL  R VS  +  RF                         +Q+    ++T  E+R  + + + +          +FWVP  W   L  +A   G I++   + +I+++L+ LR Q   L  +  I +PLVYTQV+ +AVYS+FL  L   QF+DP     GH +D Y+P+FT+ QF F++GWLKVA  ++NPFG+DD+DF+T+ ++D NL +S       D+MY
Sbjct:    1 MTVTYSRRVAD-ARLGTFYRLLLRWKGSIYKLLYRELLIFTVMYCIISITYRCVL-TEEQRRMFEKLSLYCDQYAQLIPVSFVLGFYVTLVVSRWWGQFESVPWPDRLSALVSGHVRGADEGARL-IRRSLMRYANLSGILIYRSVSTAVYKRFPTMSHL-------------------VQA---GLMTAEELRQLQELPSPHN---------KFWVPCMWFVSLAMRARSEGRINNDVAMTAILNELNTLRSQCMRLYGYDWISLPLVYTQVVTVAVYSFFLTCLIGRQFLDPAQGYPGHNLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLSV---DEMY 326          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 231.106 bits (588), Expect = 4.803e-69
Identity = 138/365 (37.81%), Postives = 206/365 (56.44%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLG--FFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMY 1338
            MT+ Y   V      G   +LL  WKGS+YK++YK+ + +  +Y  I++ YRF L    QKR FE++  +CDN  + IP+SF+LG  F+VT V+ RW+  Y  IP  +R+  +  G + G D E+   +R+TLMRY +LS +L +R VS  +  RF                      D  +++ F   +T  E + FE++ +  Y+K        +W+P  W + L   A   G I D  T   ++ +L+  RG+   L  +  I +PLVYTQV+ +AVYS+FL  L   QF+DP     GH++DLYVPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+ ++D N  +S     A D+MY
Sbjct:    1 MTVTYTARVANARFCG-FSKLLLAWKGSIYKVLYKEFLAFFAMYTAISITYRFFL-VDGQKRYFEKLSIYCDNYASLIPMSFVLGMRFYVTLVVNRWWSQYTSIPLPDRVMCVLSGGVQGSD-ERGRLLRRTLMRYSSLSALLILRSVSTAVFKRFPTI-------------------DHVVEAGF---MTREERKKFESLHSP-YNK--------YWIPCVWFTNLAAAARCEGRIKDDNTYKLLLEELNNFRGKCSMLFHYDMISVPLVYTQVVTLAVYSFFLVCLIGRQFLDPGQGYPGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQVS---MMAVDEMY 328          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 205.297 bits (521), Expect = 3.183e-60
Identity = 121/363 (33.33%), Postives = 200/363 (55.10%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMY 1338
            MT+ Y   V    + G   +LL RWKGS+YKL+Y++ + +  +Y  I+++YR  L    Q+  F  + + C+     IP+SF+LGF+VT    RW+  Y   P  + +  +  G ++G D E+   +R+TLMRY NLS +L +R +S ++  RF                      +  +++ F   +T  E+R   ++ + +++K        +W+P+ W + L  +A   G + D   L  ++ +L+  R +   L  +  I IPLVYTQV+ +AVYS+F   L   QFV P S  +   +DLY+PIFT+ +F F+ GWLKV   ++NPFG+DD+DF+T++++D N+ +S     A DDM+
Sbjct:    1 MTVSYTLKVAN-AKFGGFSKLLFRWKGSIYKLLYREFLVFCLLYTFISILYRCVLNN-NQQEIFARLARHCNKFAKLIPMSFVLGFYVTQAFQRWWGQYTSFPLPDNLMMVVSGNVHGTD-ERGRLLRRTLMRYANLSSVLILRSISTRVRKRFTTL-------------------EDIVEAGF---MTTDELRKLNHLYS-DFNK--------YWMPLAWFANLASQARKEGRVKDDIALRLLMDELNNYRSKCSMLFHYDWISIPLVYTQVVTVAVYSFFTFSLIGRQFVKPAS--SEEHLDLYIPIFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQVS---MLAVDDMH 324          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 201.83 bits (512), Expect = 2.729e-59
Identity = 116/351 (33.05%), Postives = 194/351 (55.27%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNL 1302
            MT+ Y   V    + G   +LL RWKGS+YKL+Y++ + +  +Y  I+++YR  L    Q+  F  + + C+     IP+SF+LGF+VT    RW+  Y   P  + +  +  G ++G D E+   +R+TLMRY NLS +L +R +S ++  RF                      +  +++ F   +T  E+R   ++ + +++K        +W+P+ W + L  +A   G + D   L  ++ +L+  R +   L  +  I IPLVYTQV+ +AVYS+F   L   QFV P S  +   +DLY+PIFT+ +F F+ GWLKV   ++NPFG+DD+DF+T++++D N+ +
Sbjct:    1 MTVSYTLKVAN-AKFGGFSKLLFRWKGSIYKLLYREFLVFCLLYTFISILYRCVLNNN-QQEIFARLARHCNKFAKLIPMSFVLGFYVTQAFQRWWGQYTSFPLPDNLMMVVSGNVHGTD-ERGRLLRRTLMRYANLSSVLILRSISTRVRKRFTTL-------------------EDIVEAGF---MTTDELRKLNHLYS-DFNK--------YWMPLAWFANLASQARKEGRVKDDIALRLLMDELNNYRSKCSMLFHYDWISIPLVYTQVVTVAVYSFFTFSLIGRQFVKPAS--SEEHLDLYIPIFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQV 315          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 140.198 bits (352), Expect = 1.568e-36
Identity = 69/177 (38.98%), Postives = 108/177 (61.02%), Query Frame = 1
Query:  808 IITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMY 1338
            ++T  E+R  + + + +          +FWVP  W   L  +A   G I++   + +I+++L+ LR Q   L  +  I +PLVYTQV+ +AVYS+FL  L   QF+DP     GH +D Y+P+FT+ QF F++GWLKVA  ++NPFG+DD+DF+T+ ++D NL +S       D+MY
Sbjct:    2 LMTAEELRQLQELPSPHN---------KFWVPCMWFVSLAMRARSEGRINNDVAMTAILNELNTLRSQCMRLYGYDWISLPLVYTQVVTVAVYSFFLTCLIGRQFLDPAQGYPGHNLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLSV---DEMY 166          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 242.276 bits (617), Expect = 9.930e-74
Identity = 136/365 (37.26%), Postives = 209/365 (57.26%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATA-HDDMYP 1341
            MT+ Y + V     +G   RLL RW+GS+YKL+Y++ + ++  Y++I++ YRF L    Q+  FE++  +CDN    IP+SF+LGF+VT V++RW+  Y  +P+ +R+  L    ++G D E+   +R+TLMRY NL+ +L +R VS  + +RF             +H          + + F   +T  E   F+ + + +          +FWVP  W + L   A   G I D   L  I+ +L+ LR Q   L  +  I +PLVYTQV+ +AVYS+FL  L   QF+DP+    GH++DLYVP+FT+ QF F+ GWLKVA  ++NPFG DD+DF+T+ ++D NL +S       H D+ P
Sbjct:    1 MTVTYSNRVAD-ARLGTFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNE-QQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGTD-ERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPT----------LQHV---------VNAGF---MTPTERSKFDGLVSSH---------NKFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAVDEMHQDVPP 331          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 241.121 bits (614), Expect = 2.810e-73
Identity = 136/365 (37.26%), Postives = 209/365 (57.26%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATA-HDDMYP 1341
            MT+ Y + V     +G   RLL RW+GS+YKL+Y++ + ++  Y++I++ YRF L    Q+  FE++  +CDN    IP+SF+LGF+VT V++RW+  Y  +P+ +R+  L    ++G D E+   +R+TLMRY NL+ +L +R VS  + +RF             +H          + + F   +T  E   F+ + + +          +FWVP  W + L   A   G I D   L  I+ +L+ LR Q   L  +  I +PLVYTQV+ +AVYS+FL  L   QF+DP+    GH++DLYVP+FT+ QF F+ GWLKVA  ++NPFG DD+DF+T+ ++D NL +S       H D+ P
Sbjct:    1 MTVTYSNRVAD-ARLGTFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNE-QQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGTD-ERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPT----------LQHV---------VNAGF---MTPTERSKFDGLVSSH---------NKFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAVDEMHQDVPP 331          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 241.891 bits (616), Expect = 3.228e-73
Identity = 136/365 (37.26%), Postives = 209/365 (57.26%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATA-HDDMYP 1341
            MT+ Y + V     +G   RLL RW+GS+YKL+Y++ + ++  Y++I++ YRF L    Q+  FE++  +CDN    IP+SF+LGF+VT V++RW+  Y  +P+ +R+  L    ++G D E+   +R+TLMRY NL+ +L +R VS  + +RF             +H          + + F   +T  E   F+ + + +          +FWVP  W + L   A   G I D   L  I+ +L+ LR Q   L  +  I +PLVYTQV+ +AVYS+FL  L   QF+DP+    GH++DLYVP+FT+ QF F+ GWLKVA  ++NPFG DD+DF+T+ ++D NL +S       H D+ P
Sbjct:    1 MTVTYSNRVAD-ARLGTFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNE-QQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGTD-ERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPT----------LQHV---------VNAGF---MTPTERSKFDGLVSSHN---------KFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAVDEMHQDVPP 331          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 242.276 bits (617), Expect = 5.181e-73
Identity = 152/446 (34.08%), Postives = 237/446 (53.14%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATA-HDDMYPAYLKHPNIIYSLPMVYQSQKADSVEIK------TFFDSLNATQTELAREYAAFQSEICNNQKPVISANKVFNFLRSLKMCI 1566
            MT+ Y + V     +G   RLL RW+GS+YKL+Y++ + ++  Y++I++ YRF L    Q+  FE++  +CDN    IP+SF+LGF+VT V++RW+  Y  +P+ +R+  L    ++G D E+   +R+TLMRY NL+ +L +R VS  + +RF             +H          + + F   +T  E   F+ + + +          +FWVP  W + L   A   G I D   L  I+ +L+ LR Q   L  +  I +PLVYTQV+ +AVYS+FL  L   QF+DP+    GH++DLYVP+FT+ QF F+ GWLKVA  ++NPFG DD+DF+T+ ++D NL +S       H D+ P      +I ++         A +VE +      + FD     QT      A+    + +  KP+ S N     L + K C+
Sbjct:    1 MTVTYSNRVAD-ARLGTFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNE-QQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGTD-ERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPT----------LQHV---------VNAGF---MTPTERSKFDGLVSSH---------NKFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAVDEMHQDVPPL---EKDIYWNDSDPQPPYTASTVETRRPSYQGSAFDISFHHQTMEQLYKASTILHLFSKSKPLYSLNNANFHLSTYKTCV 409          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 243.817 bits (621), Expect = 6.470e-72
Identity = 136/365 (37.26%), Postives = 209/365 (57.26%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATA-HDDMYP 1341
            MT+ Y + V     +G   RLL RW+GS+YKL+Y++ + ++  Y++I++ YRF L    Q+  FE++  +CDN    IP+SF+LGF+VT V++RW+  Y  +P+ +R+  L    ++G D E+   +R+TLMRY NL+ +L +R VS  + +RF             +H          + + F   +T  E   F+ + + +          +FWVP  W + L   A   G I D   L  I+ +L+ LR Q   L  +  I +PLVYTQV+ +AVYS+FL  L   QF+DP+    GH++DLYVP+FT+ QF F+ GWLKVA  ++NPFG DD+DF+T+ ++D NL +S       H D+ P
Sbjct:    1 MTVTYSNRVAD-ARLGTFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNE-QQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGTD-ERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPT----------LQHV---------VNAGF---MTPTERSKFDGLVSSHN---------KFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAVDEMHQDVPP 331          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 233.802 bits (595), Expect = 2.752e-69
Identity = 140/363 (38.57%), Postives = 205/363 (56.47%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMY 1338
            MT+ Y   V      G   +LL  W+GS+YKL++++L+ ++G+Y  ++  YRF L    QKR FE++V +CD   + IP+SF+LGF+VT V+ RW+  YL +P  + +  +  G ++G D    L  R+TLMRY  LS +L +R VS  +  RF                      D  +++ F   +T  E + FEN+ + +Y+K        +WVP  W S L  +A   G I D   L  ++ +L+V R +   L  +  I IPLVYTQV+ IAVYSYFL  L   QF+DP      H +DL VPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+ ++D N  +S     A D+MY
Sbjct:    1 MTVTYTARVAN-ARFGGFSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFLLAE-EQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAGTVHGRDDRGRL-YRRTLMRYAGLSAVLILRSVSTAVFKRFPTI-------------------DHVVEAGF---MTREERKKFENLNS-SYNK--------YWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSM---LAVDEMY 326          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 233.802 bits (595), Expect = 2.752e-69
Identity = 140/363 (38.57%), Postives = 205/363 (56.47%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMY 1338
            MT+ Y   V      G   +LL  W+GS+YKL++++L+ ++G+Y  ++  YRF L    QKR FE++V +CD   + IP+SF+LGF+VT V+ RW+  YL +P  + +  +  G ++G D    L  R+TLMRY  LS +L +R VS  +  RF                      D  +++ F   +T  E + FEN+ + +Y+K        +WVP  W S L  +A   G I D   L  ++ +L+V R +   L  +  I IPLVYTQV+ IAVYSYFL  L   QF+DP      H +DL VPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+ ++D N  +S     A D+MY
Sbjct:    1 MTVTYTARVAN-ARFGGFSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFLLAE-EQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAGTVHGRDDRGRL-YRRTLMRYAGLSAVLILRSVSTAVFKRFPTI-------------------DHVVEAGF---MTREERKKFENLNS-SYNK--------YWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSM---LAVDEMY 326          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 233.802 bits (595), Expect = 2.752e-69
Identity = 140/363 (38.57%), Postives = 205/363 (56.47%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMY 1338
            MT+ Y   V      G   +LL  W+GS+YKL++++L+ ++G+Y  ++  YRF L    QKR FE++V +CD   + IP+SF+LGF+VT V+ RW+  YL +P  + +  +  G ++G D    L  R+TLMRY  LS +L +R VS  +  RF                      D  +++ F   +T  E + FEN+ + +Y+K        +WVP  W S L  +A   G I D   L  ++ +L+V R +   L  +  I IPLVYTQV+ IAVYSYFL  L   QF+DP      H +DL VPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+ ++D N  +S     A D+MY
Sbjct:    1 MTVTYTARVAN-ARFGGFSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFLLAE-EQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAGTVHGRDDRGRL-YRRTLMRYAGLSAVLILRSVSTAVFKRFPTI-------------------DHVVEAGF---MTREERKKFENLNS-SYNK--------YWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSM---LAVDEMY 326          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best3 (bestrophin 3 [Source:MGI Symbol;Acc:MGI:3580298])

HSP 1 Score: 236.113 bits (601), Expect = 1.452e-68
Identity = 136/374 (36.36%), Postives = 212/374 (56.68%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMYPAYLKHPNIIY 1371
            MT+ Y   V   T  G   RLL +W+GS+YKL+Y++ + +  +Y  I+L+YR  L T AQKR FE++  +CD     IP++F+LGF+VT V+ RW+  ++ +P+ +R+  L    ++G D+   L +R+TLMRY+NL+ +L  R VS  +  RF                      D  +++ F   +T  E + F+++ + +          ++WVP  W   L  KA   G I D   L S++++++  R     L  +  + IPLVYTQV+ +AVY++F   L   QF+DP     GH++DLYVPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+  +D NL +S     A D+M+ +  K    IY
Sbjct:    1 MTVTYSSKVANATFFG-FHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLL-TGAQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMLLISSSVHGSDQHGRL-LRRTLMRYVNLTSLLIFRSVSTAVYKRFPTM-------------------DHVVEAGF---MTADERKLFDHLKSPHL---------KYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYVGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSL---LAVDEMHMSLPKMKKDIY 337          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best1 (bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332])

HSP 1 Score: 228.794 bits (582), Expect = 2.899e-68
Identity = 132/365 (36.16%), Postives = 202/365 (55.34%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATA-HDDMYP 1341
            MTI Y + V     +G    LL  W+GS+YKL+Y + + ++ +YY I  +YR  L +  Q+  FE++  +CD+    IPISF+LGF+VT V++RW+  Y  +P+ +R+       + G D+E  L +R+TL+RY  L  +L +R +S  +  RF              H  +               +T  E +  + +   + +         FWVP  W + L  KA++ G I D   L S+++++  LR Q   L  +  I IPLVYTQV+ +AVYS+FL  L   QF++P     GHE+DL VP+FTI QFLF+MGWLKVA  ++NPFG+DD+DF+T+ ++D NL +S       H ++ P
Sbjct:    1 MTITYTNKVAN-ARLGSFSSLLLCWRGSIYKLLYGEFLVFIFLYYSIRGLYRMVLSS-DQQLLFEKLALYCDSYIQLIPISFVLGFYVTLVVSRWWSQYENLPWPDRLMIQVSSFVEGKDEEGRL-LRRTLIRYAILGQVLILRSISTSVYKRFPTL-----------HHLV-----------LAGFMTHGEHKQLQKLGLPHNT---------FWVPWVWFANLSMKAYLGGRIRDTVLLQSLMNEVCTLRTQCGQLYAYDWISIPLVYTQVVTVAVYSFFLACLIGRQFLNPNKDYPGHEMDLVVPVFTILQFLFYMGWLKVAEQLINPFGEDDDDFETNWIIDRNLQVSLLSVDGMHQNLPP 331          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q6UY87|BEST1_MACFA (Bestrophin-1 OS=Macaca fascicularis OX=9541 GN=BEST1 PE=2 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 5.094e-73
Identity = 151/411 (36.74%), Postives = 228/411 (55.47%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMYPAYLK-HPNIIYSLPMVYQSQKADSVEIK-------TFFDSLNATQTE 1458
            MTI Y   V     +G   RLL  W+GS+YKL+Y +   ++  YY+I  IYR AL T  Q+  FE++  +CD+    IPISF+LGF+VT V+ RW+  Y  +P+ +R+  L  G + G D++  L +R+TL+RY NL  +L +R VS  +  RF                    +    +Q+ F   +T AE +  E ++  +           FWVP  W + L  KA++ G I DP  L S++++++ LR Q   L  +  I IPLVYTQV+ +AVYS+FL  L   QF++P     GHE+DL VP+FT  QF F++GWLKVA  ++NPFG+DD+DF+T+ ++D NL +S     A D+M+    +  P++ ++ P  +    A S + +       TF  SLN  + E
Sbjct:    1 MTITYTSQVAN-ARLGSFSRLLLCWRGSIYKLLYGEFFIFLLCYYIIRFIYRLAL-TEEQQLMFEKLTLYCDSYIQLIPISFVLGFYVTLVVTRWWNQYENLPWPDRLMSLVSGFVEGKDEQGRL-LRRTLIRYANLGNVLILRSVSTAVYKRFP-------------------SAQHLVQAGF---MTPAEHKQLEKLSLPHNM---------FWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYPGHELDLVVPVFTFLQFFFYVGWLKVAEQLINPFGEDDDDFETNWIVDRNLQVSL---LAVDEMHQDLPRMEPDMYWNEPEPHPPYTAASAQFRRASFMGSTFNISLNKEEME 374          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|O76090|BEST1_HUMAN (Bestrophin-1 OS=Homo sapiens OX=9606 GN=BEST1 PE=1 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 6.964e-73
Identity = 151/411 (36.74%), Postives = 227/411 (55.23%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMYPAYLK-HPNIIYSLPMVYQSQKADSVEIK-------TFFDSLNATQTE 1458
            MTI Y   V     +G   RLL  W+GS+YKL+Y + + ++  YY+I  IYR AL T  Q+  FE++  +CD+    IPISF+LGF+VT V+ RW+  Y  +P+ +R+  L  G + G D++  L +R+TL+RY NL  +L +R VS  +  RF                         +Q+ F   +T AE +  E ++  +           FWVP  W + L  KA++ G I DP  L S++++++ LR Q   L  +  I IPLVYTQV+ +AVYS+FL  L   QF++P     GHE+DL VP+FT  QF F++GWLKVA  ++NPFG+DD+DF+T+ ++D NL +S     A D+M+    +  P++ ++ P       A S + +       TF  SLN  + E
Sbjct:    1 MTITYTSQVAN-ARLGSFSRLLLCWRGSIYKLLYGEFLIFLLCYYIIRFIYRLAL-TEEQQLMFEKLTLYCDSYIQLIPISFVLGFYVTLVVTRWWNQYENLPWPDRLMSLVSGFVEGKDEQGRL-LRRTLIRYANLGNVLILRSVSTAVYKRFPSAQHL-------------------VQAGF---MTPAEHKQLEKLSLPHNM---------FWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYPGHELDLVVPVFTFLQFFFYVGWLKVAEQLINPFGEDDDDFETNWIVDRNLQVSL---LAVDEMHQDLPRMEPDMYWNKPEPQPPYTAASAQFRRASFMGSTFNISLNKEEME 374          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q8NFU1|BEST2_HUMAN (Bestrophin-2 OS=Homo sapiens OX=9606 GN=BEST2 PE=1 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 1.319e-69
Identity = 140/363 (38.57%), Postives = 207/363 (57.02%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMY 1338
            MT+ Y   V      G   +LL  W+GS+YKL++++L+ ++G Y  ++  YRF L T  QKR FE++V +CD   + IP+SF+LGF+VT V+ RW+  YL +P  + +  +  G ++G D    L  R+TLMRY  LS +L +R VS  +  RF                      D  +++ F   +T  E + FEN+ + +Y+K        +WVP  W S L  +A   G I D   L  ++ +L+V RG+   L  +  I +PLVYTQV+ IA+YSYFL  L   QF+DP      H++DL VPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+ ++D N  +S     A D+MY
Sbjct:    1 MTVTYTARVAN-ARFGGFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVL-TEGQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGRDDRGRL-YRRTLMRYAGLSAVLILRSVSTAVFKRFPTI-------------------DHVVEAGF---MTREERKKFENLNS-SYNK--------YWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSM---LAVDEMY 326          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q8BGM5|BEST2_MOUSE (Bestrophin-2 OS=Mus musculus OX=10090 GN=Best2 PE=2 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 2.891e-68
Identity = 140/363 (38.57%), Postives = 205/363 (56.47%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMY 1338
            MT+ Y   V      G   +LL  W+GS+YKL++++L+ ++G+Y  ++  YRF L    QKR FE++V +CD   + IP+SF+LGF+VT V+ RW+  YL +P  + +  +  G ++G D    L  R+TLMRY  LS +L +R VS  +  RF                      D  +++ F   +T  E + FEN+ + +Y+K        +WVP  W S L  +A   G I D   L  ++ +L+V R +   L  +  I IPLVYTQV+ IAVYSYFL  L   QF+DP      H +DL VPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+ ++D N  +S     A D+MY
Sbjct:    1 MTVTYTARVAN-ARFGGFSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFLLAE-EQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAGTVHGRDDRGRL-YRRTLMRYAGLSAVLILRSVSTAVFKRFPTI-------------------DHVVEAGF---MTREERKKFENLNS-SYNK--------YWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVS---MLAVDEMY 326          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q6H1V1|BEST3_MOUSE (Bestrophin-3 OS=Mus musculus OX=10090 GN=Best3 PE=2 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 1.016e-67
Identity = 136/374 (36.36%), Postives = 212/374 (56.68%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMYPAYLKHPNIIY 1371
            MT+ Y   V   T  G   RLL +W+GS+YKL+Y++ + +  +Y  I+L+YR  L T AQKR FE++  +CD     IP++F+LGF+VT V+ RW+  ++ +P+ +R+  L    ++G D+   L +R+TLMRY+NL+ +L  R VS  +  RF                      D  +++ F   +T  E + F+++ + +          ++WVP  W   L  KA   G I D   L S++++++  R     L  +  + IPLVYTQV+ +AVY++F   L   QF+DP     GH++DLYVPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+  +D NL +S     A D+M+ +  K    IY
Sbjct:    1 MTVTYSSKVANATFFG-FHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLL-TGAQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMLLISSSVHGSDQHGRL-LRRTLMRYVNLTSLLIFRSVSTAVYKRFPTM-------------------DHVVEAGF---MTADERKLFDHLKSPHL---------KYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYVGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSL---LAVDEMHMSLPKMKKDIY 337          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A267FNT5 (Bestrophin homolog OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025133g2 PE=3 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 2.328e-116
Identity = 191/430 (44.42%), Postives = 271/430 (63.02%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDK--EKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXX-XXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPE---------------------SKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHD-DMYPAYLKHPNIIYSLPMVYQSQKADSVEIKTFFDSLNATQTELA 1464
            MT+ Y + ++  ++ G   ++L  WKGSLYKLVY DL+ Y+ IYYV N+ YR  L  P  +++FE +V+FC  M  NIP+SF+LGFFV GVI RW+++Y+ IP+LNR+AF   GLI G     E   +IR +LMRY+NL+WIL M  +S++I  RF + +E    E    R    N NR  K+Q  FRK++T+ E+ AF    A+   K + K+ P++W+P+ W++ L +KA +HG+  DPR++  I+ +++ +R  MHTL I++ +MIPLVYTQV+IIAVYSYFL QLF+ QFV+P+                     S  TG  +D+Y PIFT+ QFLF MGWLKVAMCVMNPFGDDDEDF TS++LDYNL ++ RC        YP  L  P++ +        +K+   E     + L+A + E +
Sbjct:    1 MTVAYSETISS-SQGGVFIKILLLWKGSLYKLVYTDLIAYLLIYYVFNISYR-VLMPPETRQNFELVVRFCSGMDKNIPLSFILGFFVAGVIGRWWEMYMNIPWLNRIAFCCYGLITGTKDTFEVAKQIRCSLMRYMNLAWILLMHSISERIVHRFSNTEEAAADENGGVRALLENINRCDKVQLHFRKLVTENEIDAFARAEAEYKIKYQKKYVPDYWLPLHWAALLSKKAMIHGY-CDPRSMVMIMREVERVRCMMHTLNIYNDVMIPLVYTQVVIIAVYSYFLLQLFSQQFVNPKLTAEMMSARTNATVMPVTVTSSSSTGDVIDMYFPIFTVLQFLFLMGWLKVAMCVMNPFGDDDEDFHTSDILDYNLEITSRCVEGQSAPHYPEGLTEPSMEW-------LKKSAGSEGDNMLEYLDAAEMEFS 420          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A1I8HMQ9 (Bestrophin homolog OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 5.542e-116
Identity = 191/430 (44.42%), Postives = 271/430 (63.02%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDK--EKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXX-XXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPE---------------------SKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHD-DMYPAYLKHPNIIYSLPMVYQSQKADSVEIKTFFDSLNATQTELA 1464
            MT+ Y + ++  ++ G   ++L  WKGSLYKLVY DL+ Y+ IYYV N+ YR  L  P  +++FE +V+FC  M  NIP+SF+LGFFV GVI RW+++Y+ IP+LNR+AF   GLI G     E   +IR +LMRY+NL+WIL M  +S++I  RF + +E    E    R    N NR  K+Q  FRK++T+ E+ AF    A+   K + K+ P++W+P+ W++ L +KA +HG+  DPR++  I+ +++ +R  MHTL I++ +MIPLVYTQV+IIAVYSYFL QLF+ QFV+P+                     S  TG  +D+Y PIFT+ QFLF MGWLKVAMCVMNPFGDDDEDF TS++LDYNL ++ RC        YP  L  P++ +        +K+   E     + L+A + E +
Sbjct:   15 MTVAYSETISS-SQGGVFIKILLLWKGSLYKLVYTDLIAYLLIYYVFNISYR-VLMPPETRQNFELVVRFCSGMDKNIPLSFILGFFVAGVIGRWWEMYMNIPWLNRIAFCCYGLITGTKDTFEVAKQIRCSLMRYMNLAWILLMHSISERIVHRFSNTEEAAADENGGVRALLENINRCDKVQLHFRKLVTENEIDAFARAEAEYKIKYQKKYVPDYWLPLHWAALLSKKAMIHGY-CDPRSMVMIMREVERVRCMMHTLNIYNDVMIPLVYTQVVIIAVYSYFLLQLFSQQFVNPKLTAEMMSARTNATVMPVTVTSSSSTGDVIDMYFPIFTVLQFLFLMGWLKVAMCVMNPFGDDDEDFHTSDILDYNLEITSRCVEGQSAPHYPEGLTEPSMEW-------LKKSAGSEGDNMLEYLDAAEMEFS 434          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A267F2G9 (Bestrophin homolog OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000907g1 PE=3 SV=1)

HSP 1 Score: 352.058 bits (902), Expect = 1.163e-112
Identity = 180/401 (44.89%), Postives = 260/401 (64.84%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDK--EKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRF--------KXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDP---------ESKIT------------GHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMYPAYLKHP 1359
            MT+ Y + ++  ++ G   ++L  WKGSLYKL+Y DL+ Y+ +YY  N+IYR A   P  ++SFE +VKFC+ M  +IP+SF+LGFFV GVI RW+Q+YL IP+LNR++F + G++ G     E   ++R ++MRY+NL WIL M  +S+QI  RF        +       EE   R    N N+  +++  FRK++T+AE+ AF     +  +K + K+ PE+W+P+QW++ L +KA +HGF  DPR++  ++ +++ +RG M TL I++ +MIPLVYTQV+IIAVYS+FL QLF+ QFV+P         E  +T            G  +D+Y P+FT+FQF+F MGWLKVAMCVMNPFGDDDEDF TSE+L+YNL +S RCA      +P     P
Sbjct:    1 MTVSYSETISS-SQGGVFIKILLLWKGSLYKLLYTDLIVYLIMYYAFNIIYR-ACMGPEARQSFELVVKFCEEMDKSIPLSFILGFFVAGVIGRWWQMYLNIPWLNRISFFAYGILTGTKDSFETARRLRLSIMRYMNLGWILLMHSISEQIMHRFSGQEEEEPQSKSNLVQEERGVRGLLENINKCPEVKLHFRKLVTEAEIEAFVRAEGEYKNKYQKKYVPEYWLPLQWAALLCKKAMMHGF-CDPRSMVMMMEEIEEVRGTMQTLVIYNDVMIPLVYTQVVIIAVYSFFLLQLFSQQFVNPKLTADLLSAERNVTVTPISIGNKDNHGEVIDMYFPVFTVFQFMFLMGWLKVAMCVMNPFGDDDEDFHTSEILNYNLEISSRCAEGQAITFPRACPSP 398          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A267GQY7 (Bestrophin homolog OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016709g1 PE=3 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 7.550e-112
Identity = 189/459 (41.18%), Postives = 273/459 (59.48%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDK--EKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFI------------------------------NFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPE---------------------SKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHD-DMYPAYLKHPNIIYSLPMVYQSQKADSVEIKTFFDSLNATQTELA 1464
            MT+ Y + ++  ++ G   ++L  WKGSLYKLVY DL+ Y+ IYYV N+ YR  L  P  +++FE +V+FC  M  NIP+SF+LGFFV GVI RW+++Y+ IP+LNR+AF   GLI G     E   +IR +LMRY+NL+WIL M  +S++I  RF + +E   +    +  ++                              N NR  K+Q  FRK++T+ E+ AF    A+   K + K+ P++W+P+ W++ L +KA +HG+  DPR++  I+ +++ +R  MHTL I++ +MIPLVYTQV+IIAVYSYFL QLF+ QFV+P+                     S  TG  +D+Y PIFT+ QFLF MGWLKVAMCVMNPFGDDDEDF TS++LDYNL ++ RC        YP  L  P++ +        +K+   E     + L+A + E +
Sbjct:    1 MTVAYSETISS-SQGGVFIKILLLWKGSLYKLVYTDLIAYLLIYYVFNISYR-VLMPPETRQNFELVVRFCSGMDKNIPLSFILGFFVAGVIGRWWEMYMNIPWLNRIAFCCYGLITGTKDTFEVAKQIRCSLMRYMNLAWILLMHSISERIVHRFSNTEEAAQQGGQSKLRYLFGRLIGMNQLSAELRATKADENGGVRALLENINRCDKVQLHFRKLVTENEIDAFARAEAEYKIKYQKKYVPDYWLPLHWAALLSKKAMIHGY-CDPRSMVMIMREVERVRCMMHTLNIYNDVMIPLVYTQVVIIAVYSYFLLQLFSQQFVNPKLTAEMMSARTNATVMPVTVTSSSSTGDVIDMYFPIFTVLQFLFLMGWLKVAMCVMNPFGDDDEDFHTSDILDYNLEITSRCVEGQSAPHYPEGLTEPSMEW-------LKKSAGSEGDNMLEYLDAAEMEFS 449          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A267FLK3 (Bestrophin homolog OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016709g2 PE=3 SV=1)

HSP 1 Score: 353.214 bits (905), Expect = 8.589e-112
Identity = 189/459 (41.18%), Postives = 272/459 (59.26%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDK--EKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFI------------------------------NFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPE---------------------SKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHD-DMYPAYLKHPNIIYSLPMVYQSQKADSVEIKTFFDSLNATQTELA 1464
            MT+ Y + ++  ++ G   ++L  WKGSLYKLVY DL+ Y+ IYYV N+ YR  L  P  +++FE +V+FC  M  NIP+SF+LGFFV GVI RW+++Y+ IP+LNR+AF   GLI G     E   +IR +LMRY+NL+WIL M  +S++I  RF + +E   +    +  ++                              N NR  K+Q  FRK++T+ E+ AF    A+   K + K+ P++W+P+ W++ L +KA +HG+  DPR++  I+ +++ +R  MHTL I++ +MIPLVYTQV+IIAVYSYFL QLF+ QFV+P+                     S  TG  +D+Y PIFT+ QFLF MGWLKVAMCVMNPFGDDDEDF TS++LDYNL ++ RC        YP  L  P++ +        +K+   E     + L+A + E  
Sbjct:    1 MTVAYSETISS-SQGGVFIKILLLWKGSLYKLVYTDLIAYLLIYYVFNISYR-VLMPPETRQNFELVVRFCSGMDKNIPLSFILGFFVAGVIGRWWEMYMNIPWLNRIAFCCYGLITGTKDTFEVAKQIRCSLMRYMNLAWILLMHSISERIVHRFSNTEEAAQQGGQSKLRYLFGRLIGMNQLSAELRATKADENGGVRALLENINRCDKVQLHFRKLVTENEIDAFARAEAEYKIKYQKKYVPDYWLPLHWAALLSKKAMIHGY-CDPRSMVMIMREVERVRCMMHTLNIYNDVMIPLVYTQVVIIAVYSYFLLQLFSQQFVNPKLTAEMMSARTNATVMPVTVTSSSSTGDVIDMYFPIFTVLQFLFLMGWLKVAMCVMNPFGDDDEDFHTSDILDYNLEITSRCVEGQSAPHYPEGLTEPSMEW-------LKKSAGSEGDNMLEYLDAAEMEFG 449          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:103045999])

HSP 1 Score: 239.965 bits (611), Expect = 8.245e-70
Identity = 132/363 (36.36%), Postives = 211/363 (58.13%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMY 1338
            MT+ Y   V     +G    LL RWKGS+YKL+Y++L+ +  +Y  I+++YRF L    Q+R FE++  +CD     IP+SF+LGF+VT V++RW+  +  +P+ +R+A L    + G D+   L IR++L+RY NLS +L  R +S  +  RF                      +  +Q+    ++T  E R  +++ + +          +FWVP  W   L  +A   G I++   L++I+++L+ LR Q   L  +  I +PLVYTQV+ +AVYS+FL  L   QF+DP    +GH++D Y+P+FT+ QF F++GWLKVA  ++NPFG+DD+DF+T+ ++D NL +S       D+MY
Sbjct:    1 MTVTYSRRVAD-ARLGTFSHLLLRWKGSIYKLLYRELLIFTVLYCTISVLYRFLLDN-EQRRLFEKLAIYCDQYAQLIPVSFVLGFYVTLVVSRWWGQFESVPWPDRLAALVGAYVRGADEGARL-IRRSLVRYANLSGVLIYRSISTAVYKRFPTI-------------------EHLVQA---GLMTVEERRQLDDLPSPHN---------KFWVPCMWFVNLALRARTEGRINNDVALSAILNELNTLRSQCMKLYSYDWISLPLVYTQVVTVAVYSFFLACLIGRQFLDPTQGYSGHDLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLSV---DEMY 326          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 226.098 bits (575), Expect = 2.813e-65
Identity = 132/363 (36.36%), Postives = 207/363 (57.02%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMY 1338
            MT+ Y   V      G   +LL  W+GS+YK++YK+++ +  +Y  I++ YRF L    QKR FE++  +C++  + IP+SF+LGF+VT ++ RW+  Y  IP  + +  +  G + GGD E+   +R+TLMRY +L+ +L +R VS  +  RF                      D  +++ F   +T  E + FE++ +  Y+K        +W+P  W + L   A   G I D  T   ++ +L+  RG+   L  +  I +PLVYTQV+ +AVYS+FL  L   QF+DP     GH++DLYVPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+ ++D N  +S     A D+M+
Sbjct:    1 MTVTYTARVANARFCG-FSKLLLAWRGSIYKVLYKEVLAFFILYTAISITYRFFLLD-EQKRYFEKLSIYCNHYASLIPMSFVLGFYVTLIVNRWWSQYTSIPLPDSIMCVLSGGLQGGD-ERGRLLRRTLMRYASLASLLILRSVSTAVFKRFPTM-------------------DHVVEAGF---MTREERKKFESLHSP-YNK--------YWIPCVWFTNLAAVARSEGRIKDDNTYKLLLEELNKFRGKCSLLFHYDMISVPLVYTQVVTLAVYSFFLVCLIGRQFLDPSQAYPGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQVSM---MAVDEMF 326          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 204.912 bits (520), Expect = 4.146e-60
Identity = 128/366 (34.97%), Postives = 202/366 (55.19%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQ-VIIIAVYSYFLCQLFASQFVDPE--SKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMY 1338
            MT+ Y  +V      G   +LL RWKGS+YKL+YK+ + +  +Y + +LIYR  L T  Q+  FE   + C+     IP+SF+L F+VT    RW+  Y   P  + +  +  G ++G D E+   +R+TLMRY NLS +L +R +S ++  RF                         +Q      +T+ E+R  +++ + +++K        +W+P+ W + L  KA   G + D   L  ++ +L+  RG+   L  +  I IPLVYTQ V+ +AVYS+F   L   QFV PE   ++  H VDLYVP+FT+ +F F+ GWLKV   ++NPFG+DD+DF+T++++D N+ +S     A DDM+
Sbjct:    1 MTVSYTLEVANARFAGFT-KLLFRWKGSIYKLLYKEFLLFCFLYSLFSLIYRCVL-TDGQQELFERAARHCNKFAKLIPMSFVL-FYVTQAFQRWWGQYTSFPLPDNLMMVVSGNVHGSD-ERGRLLRRTLMRYANLSSVLILRSISTRVHKRFP-----------------------TLQHIVDAFMTEEEMRTLDHLYS-DFNK--------YWMPLTWFANLASKAREEGRVKDDIALRLLMDELNNYRGKCSMLFHYDWISIPLVYTQQVVTLAVYSFFAFCLIGRQFVKPERADELKVH-VDLYVPVFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQVS---MLAVDDMH 326          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:103045999])

HSP 1 Score: 204.142 bits (518), Expect = 5.939e-57
Identity = 120/363 (33.06%), Postives = 195/363 (53.72%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMY 1338
            MT+ Y   V     +G    LL RWKGS+YKL+Y++L+ +  +Y  I+++YRF L    Q+R FE++  +CD     IP+SF+LGF+VT V++RW+  +  +P+ +R+A L    + G D+   L IR++L+RY NLS +L  R +S  +  RF                      +  +Q+    ++T  E R  +++ + +          +FWVP  W   L  +A   G I++   L++I++                          V+ +AVYS+FL  L   QF+DP    +GH++D Y+P+FT+ QF F++GWLKVA  ++NPFG+DD+DF+T+ ++D NL +S       D+MY
Sbjct:    1 MTVTYSRRVAD-ARLGTFSHLLLRWKGSIYKLLYRELLIFTVLYCTISVLYRFLLDN-EQRRLFEKLAIYCDQYAQLIPVSFVLGFYVTLVVSRWWGQFESVPWPDRLAALVGAYVRGADEGARL-IRRSLVRYANLSGVLIYRSISTAVYKRFPTI-------------------EHLVQA---GLMTVEERRQLDDLPSPHN---------KFWVPCMWFVNLALRARTEGRINNDVALSAILN--------------------------VVTVAVYSFFLACLIGRQFLDPTQGYSGHDLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLSV---DEMY 300          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: BEST3 (bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105])

HSP 1 Score: 135.961 bits (341), Expect = 3.482e-34
Identity = 65/165 (39.39%), Postives = 101/165 (61.21%), Query Frame = 1
Query:  811 ITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLS 1305
            +T  E + FEN+ + +          ++W+P  W + L  KA   G I D   L +I+++++  R    TL  +  + IPLVYTQV+ +AVY++F   +   QF+DP     GH++DLYVP+FT+ QF F+ GWLKVA  ++NPFG+DD+DF+ +  +D NL +S
Sbjct:   85 MTPEEKKIFENLKSPHL---------KYWIPTVWFTNLASKARKDGRIQDSVDLQTILTEMNRFRTWCSTLFGYDWVGIPLVYTQVVTLAVYTFFSASIIGRQFLDPAQGYPGHDLDLYVPVFTLLQFFFYSGWLKVAEQLINPFGEDDDDFEANWCIDRNLQVS 240          

HSP 2 Score: 74.3294 bits (181), Expect = 1.016e-13
Identity = 35/86 (40.70%), Postives = 56/86 (65.12%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGF 507
            MT+ Y   V   T  G   RLL RW+GS+YKL+Y++ + +  +Y +++L+YR+ L  P Q+R FE++  +CD     IP++F+LGF
Sbjct:    1 MTVTYSSKVANATFFG-FHRLLLRWRGSIYKLLYREFLFFALLYSILSLVYRWVLTDP-QRRLFEKLSIYCDRYAEQIPVTFVLGF 84          
BLAST of Bestrophin homolog vs. Ensembl Sea Lamprey
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 231.106 bits (588), Expect = 1.082e-70
Identity = 133/363 (36.64%), Postives = 209/363 (57.58%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMY 1338
            MT+ Y + V     +G   +LL RWKGS+YKL+YK+   ++ +++ ++ +YR+ L+   QKR FE++  +C+     IP+SF+LGF+VT V++RW+  Y  +P+ +R+  L    ++G D E+   +R+TLMRY NLS +L +R VS  +  RF                      D  +++ F   +T AE R F+ + + +          +FWVP  W + L  +A   G I D  +L  I++DL+  R     L  +  + IPLVYTQV+ +AVYS+FL  L   QF+ P+    GH++DLY+P+FT+ QF F+ GWLKVA  ++NPFG+DD+DF+ +  +D NL +S       D+MY
Sbjct:    1 MTVTYSNKVAN-ARLGGFSQLLLRWKGSIYKLLYKEFCIFLVLFFTLSSVYRYMLQE-NQKRYFEKLAMYCNKYAELIPVSFVLGFYVTLVVSRWWSQYESLPWPDRLMHLVACNVHGAD-ERGRLLRRTLMRYANLSALLILRSVSTAVYKRFPTM-------------------DHVVEAGF---MTPAERRKFDGLRSPH---------NKFWVPCVWFANLAAQAKAEGRILDNVSLQLILNDLNNFRSCCSMLYSYDWVSIPLVYTQVVTVAVYSFFLACLIGRQFLGPQG-YPGHDMDLYIPVFTLLQFFFYAGWLKVAEQLINPFGEDDDDFEANWCVDRNLQVS---LMGVDEMY 325          
BLAST of Bestrophin homolog vs. Ensembl Sea Lamprey
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 229.18 bits (583), Expect = 2.583e-68
Identity = 134/363 (36.91%), Postives = 205/363 (56.47%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMY 1338
            MT+ Y + V      G   +LL +W+GS+YKL+Y++   Y  +Y  ++L  RFAL +  QKR FE++  +C+N  N IP+    GF+V  V++RW+  Y  IP  +R+     G ++G D E+   +R+TLMRY NLS +L +R VS  +  RF                      D  +++ F   +T  E + F+ +   +Y+K        +WVP  W S L  +A   G + D   L  ++ +++V RG    L  +  I +PLVYTQV+ +AVYS+FL  L   QF+DP     GH++DLY+P+FT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+ ++D NL +S     A D+MY
Sbjct:    1 MTVTYTNRVANARLCG-FSKLLLQWRGSIYKLLYREFSIYFMMYAALSLTSRFAL-SEDQKRLFEKLSLYCNNYANLIPVRSCSGFYVALVVSRWWSQYTSIPTPDRLMCAVAGTVHGVD-ERGRLLRRTLMRYANLSALLILRSVSTAVYKRFPTM-------------------DHVVEAGF---MTRDERKRFDGLRC-SYNK--------YWVPCVWLSSLAAQARAEGRVRDDVALKLLLDEMNVYRGNCGMLFHYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPAQGYPGHDMDLYIPVFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNLQVSM---LAVDEMY 326          
BLAST of Bestrophin homolog vs. Ensembl Medaka
Match: BEST3 (bestrophin 3 [Source:NCBI gene;Acc:101172121])

HSP 1 Score: 238.81 bits (608), Expect = 5.593e-70
Identity = 132/363 (36.36%), Postives = 210/363 (57.85%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMY 1338
            MT+ Y   V   T +    RLL RW+GS+YKL+Y++ + +  +Y +++LIYR AL    QKR FE++  +CD     IP++F+LGF+VT V+ RW+  +L +P+ +R+ F     + G D+   L +R+TL+RY+NL+ +L  R VS  +  RF                      D  +++ F   +T  E + FENI + +          ++W+P+ W S L  +A   G I D   L +I+++++  R    TL  +  + IPLVYTQV+ +AVY++F   +   QF+DP     GH++DLYVP+FT+ QF F+ GWLKVA  ++NPFG+DD+DF+ + ++D NL +S     A D+M+
Sbjct:    1 MTVTYSSKVANATFLS-FHRLLLRWRGSIYKLLYREFLLFALLYTILSLIYRLALSE-QQKRLFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFLNLPWPDRLMFHISSCVQGKDEYGRL-LRRTLVRYINLTSLLIFRSVSTAVCKRFPTI-------------------DHVVEAGF---MTPEERKVFENIRSPHL---------KYWIPVVWFSNLASRARQEGRIQDAIDLQNILNEMNTFRTWCATLFGYDWVGIPLVYTQVVTLAVYTFFFACIIGRQFLDPAQGHPGHDLDLYVPVFTLLQFFFYSGWLKVAEQLINPFGEDDDDFEANWIIDRNLQVSL---LAVDEMH 326          
BLAST of Bestrophin homolog vs. Ensembl Medaka
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:101167866])

HSP 1 Score: 234.572 bits (597), Expect = 6.951e-68
Identity = 135/363 (37.19%), Postives = 206/363 (56.75%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMY 1338
            MT+ Y   V     +G  F LL RWKGS+YKL+Y++L+ +  +YY ++L+Y + L    Q+R FE +  +CD     IP+SF+L F+VT V++RW+  +  IP+ +R+A L  G + G D+   L  R+ LMRY+NLS +L  R VS  +  RF                          +   + ++T  E+R FE + + +          +FWVP  W   L  +A   G I++   L +I+++L+ LR +   L  +  I +PLVYTQV  +AVYS+FL  L   QF+DP     GH+VD Y+P+FT+ QF F++GWLKVA  ++NPFG+DD+DF+T+ ++D NL +S       D+MY
Sbjct:    1 MTVTYSRRVAD-AGLGTFFHLLLRWKGSIYKLLYRELIIFTLLYYFLSLVY-YMLDN-DQRRLFERLSIYCDRYAELIPVSFVL-FYVTLVVSRWWGQFENIPWPDRLAALVGGHVRGTDEASRL-TRRALMRYVNLSGVLIYRSVSTAVYKRFP-----------------------TTEHLVQALMTSEELRHFEELPSPHN---------KFWVPCMWFVNLALRARTEGRINNDVALTAILTELNSLRAKCMKLYGYDWISLPLVYTQVATVAVYSFFLACLIGRQFLDPAQGYPGHDVDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWVVDRNLQVSLLSV---DEMY 323          
BLAST of Bestrophin homolog vs. Ensembl Medaka
Match: best2 (bestrophin 2 [Source:NCBI gene;Acc:110015962])

HSP 1 Score: 229.18 bits (583), Expect = 1.056e-66
Identity = 135/364 (37.09%), Postives = 206/364 (56.59%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNR-MAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMY 1338
            MT+ Y   V      G   +LL  WKGS+YK++YK+ + +  +Y  I++ YRF L    QKR FE++  +C++  + IP+SF+LGF+VT ++ RW+  Y  IP  +R M  LS GL   G+ E+   +R+++MRY +LS +L +R VS  +  RF                      D  +++ F   +T  E + FE + +  Y+K        +W+P  W + L   A   G I D   L  ++ +L+  RG+   L  +  + +PLVYTQV+ +AVYS+FL  L   QF+DP     GH++DLYVPIFT+ QF F+ GWLKVA  ++NPFG+DD+DF+T+ ++D N  +S     A D+MY
Sbjct:    1 MTVTYTARVANARFCG-FSKLLLAWKGSIYKVLYKEFLAFFVLYAAISITYRFFLYE-DQKRYFEKLAIYCNHYASLIPMSFVLGFYVTLIVNRWWNQYTSIPLPDRIMCVLSGGLQ--GNDERGRLLRRSMMRYASLSALLILRSVSTAVFKRFPTM-------------------DHVVEAGF---MTREERKKFEGLHSP-YNK--------YWIPCVWFTNLAAVARCEGRIRDDHALKLLLEELNAFRGKCSLLFHYDMVSVPLVYTQVVTLAVYSFFLVCLIGRQFLDPSQGYQGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQVSM---MAVDEMY 326          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000070057.1 (SMESG000070057.1)

HSP 1 Score: 717.613 bits (1851), Expect = 0.000e+0
Identity = 370/440 (84.09%), Postives = 389/440 (88.41%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMYPAYLKHPNIIYSLPMVYQSQK-ADSVEIKTFFDSLNATQTELAREYAAFQSEICNNQKPV----ISANKVFNFLRSL 1554
            MTILYLDDVTRRTEIGCIFRLLK+WKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKHNDENNNEEHHFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTS++LD NL++++R  TA   MYP +L  P       M Y++QK  D   +  F   +++   E  +          NN+K V    I+ NK  NFL+ +
Sbjct:    1 MTILYLDDVTRRTEIGCIFRLLKKWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKHNDENNNEEHHFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPP------AMWYKTQKNCDEDLLDDFMKDIDSDLEETVQ---------LNNEKDVTNLEITPNKCLNFLKCI 425          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000070057.1 (SMESG000070057.1)

HSP 1 Score: 683.33 bits (1762), Expect = 0.000e+0
Identity = 354/440 (80.45%), Postives = 377/440 (85.68%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMYPAYLKHPNIIYSLPMVYQSQK-ADSVEIKTFFDSLNATQTELAREYAAFQSEICNNQKPV----ISANKVFNFLRSL 1554
            MT+ Y +D++         +LL RWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKHNDENNNEEHHFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTS++LD NL++++R  TA   MYP +L  P       M Y++QK  D   +  F   +++   E  +          NN+K V    I+ NK  NFL+ +
Sbjct:    1 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKHNDENNNEEHHFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPP------AMWYKTQKNCDEDLLDDFMKDIDSDLEETVQ---------LNNEKDVTNLEITPNKCLNFLKCI 425          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000055094.1 (SMESG000055094.1)

HSP 1 Score: 475.707 bits (1223), Expect = 2.270e-163
Identity = 230/401 (57.36%), Postives = 298/401 (74.31%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRF---KXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMYPAYLKHPNIIYSLPMVYQSQKADSVEIKTFFDSLN 1443
            MT+ Y   + +   I    RLL  WKGSLYKLV+ DL+ Y+G+YY+INLIYR AL    QK++F ++V+F D MK NIP  FLLGFFV+GVI RW ++YL IP+L+R AFL +G ING +    L++R+T++RYLNL+WIL MRQ+SDQI +RF   K N+  N+ E   R  FINFN+D KIQ+T+ KIITDAE+RAFE IA K+ S  K  + PE+WVPIQW+SR++QK+F+H ++SDPRT+N +I +LD +R  M  LQ+F GIMIPLVYTQV+IIAVYS+FLC+LFASQF+DP  K+ GHE+D YVPIFTIFQFLF MGWLKVAMCVMNPFGDDDEDFQTSE+LD NL+ +YR  +   +M+P  L  P + Y   +     K +   ++TF D ++
Sbjct:    1 MTVDYSKQLEKGRGIDIFVRLLWLWKGSLYKLVWVDLLSYMGVYYLINLIYRLALNK-TQKKTFVKMVQFADEMKGNIPFFFLLGFFVSGVIGRWIKMYLLIPWLHRQAFLFQGCINGNEPAMSLRLRRTILRYLNLAWILQMRQISDQISLRFRNNKINNSTNSVETTIRDIFINFNKDPKIQNTYGKIITDAEIRAFEAIAIKSDSNGKPNYVPEYWVPIQWASRVIQKSFIHKYVSDPRTVNKMIEELDRVRNNMQNLQVFCGIMIPLVYTQVVIIAVYSFFLCELFASQFIDPREKVKGHELDFYVPIFTIFQFLFLMGWLKVAMCVMNPFGDDDEDFQTSEILDNNLDTTYRSVSGELEMFPERLDPPKMNYECLL-----KTEPDNLETFLDEID 395          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000055094.1 (SMESG000055094.1)

HSP 1 Score: 471.855 bits (1213), Expect = 4.308e-162
Identity = 224/381 (58.79%), Postives = 291/381 (76.38%), Query Frame = 1
Query:  310 LLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRF---KXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMYPAYLKHPNIIYSLPMVYQSQKADSVEIKTFFDSLN 1443
            +L +WKGSLYKLV+ DL+ Y+G+YY+INLIYR AL    QK++F ++V+F D MK NIP  FLLGFFV+GVI RW ++YL IP+L+R AFL +G ING +    L++R+T++RYLNL+WIL MRQ+SDQI +RF   K N+  N+ E   R  FINFN+D KIQ+T+ KIITDAE+RAFE IA K+ S  K  + PE+WVPIQW+SR++QK+F+H ++SDPRT+N +I +LD +R  M  LQ+F GIMIPLVYTQV+IIAVYS+FLC+LFASQF+DP  K+ GHE+D YVPIFTIFQFLF MGWLKVAMCVMNPFGDDDEDFQTSE+LD NL+ +YR  +   +M+P  L  P + Y   +     K +   ++TF D ++
Sbjct:    4 ILAKWKGSLYKLVWVDLLSYMGVYYLINLIYRLALNK-TQKKTFVKMVQFADEMKGNIPFFFLLGFFVSGVIGRWIKMYLLIPWLHRQAFLFQGCINGNEPAMSLRLRRTILRYLNLAWILQMRQISDQISLRFRNNKINNSTNSVETTIRDIFINFNKDPKIQNTYGKIITDAEIRAFEAIAIKSDSNGKPNYVPEYWVPIQWASRVIQKSFIHKYVSDPRTVNKMIEELDRVRNNMQNLQVFCGIMIPLVYTQVVIIAVYSFFLCELFASQFIDPREKVKGHELDFYVPIFTIFQFLFLMGWLKVAMCVMNPFGDDDEDFQTSEILDNNLDTTYRSVSGELEMFPERLDPPKMNYECLL-----KTEPDNLETFLDEID 378          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000065100.1 (SMESG000065100.1)

HSP 1 Score: 468.389 bits (1204), Expect = 4.886e-161
Identity = 224/409 (54.77%), Postives = 303/409 (74.08%), Query Frame = 1
Query:  250 MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRF---KXXXXXXXXXXXFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLNLSYRCATAHDDMYPAYLKHPNIIYSLPMVYQSQKADSVEIKTFFDSLNATQTELAR 1467
            MTI Y  +++    + CI+ L  RWKGSLYKL++ DL+ YVG+YY+IN++YRFAL    Q+R FEEIVKFCD+ KNNIP+SFLLGFFV G+I RW+++YL IP+LN++AF+ + +I G    K  ++R  +MRY+NL+WIL MR +S QI +RF   K+   N   E++ +    N N D++I+ TF+KIIT +E+RAFENIA K  ++ K ++ PEFWVPIQW+SR++ K F+HGFISDPRT+ S+  +++ LR QM  LQI+S I+IPLVYTQV++IAVYSYFL  LFA+QFVDP  +I GHEVD Y+P+FTIFQFLF MGWLKVAMCVMNPFGDDDEDFQTSEMLDYNL++S+R + A ++MYP+ LK        P + + +  D+V+     D ++  +  L +
Sbjct:    1 MTISYAAEISDGQGLYCIYTLFMRWKGSLYKLLWVDLLIYVGLYYLINIMYRFAL-NEQQRRIFEEIVKFCDSKKNNIPLSFLLGFFVAGIIGRWWKMYLCIPWLNKIAFICQSIIIGNGPVKSRRVRLIIMRYMNLAWILLMRNISAQIKVRFQQHKNMKVNYRSENYIKEILENINADERIRQTFKKIITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLK--------PAIMKYRLQDAVDEDNLPDFIDDVENNLYK 400          
The following BLAST results are available for this feature:
BLAST of Bestrophin homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BEST11.450e-7336.74bestrophin 1 [Source:HGNC Symbol;Acc:HGNC:12703][more]
BEST31.542e-7036.10bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105][more]
BEST22.747e-7038.57bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107][more]
BEST22.747e-7038.57bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107][more]
BEST22.747e-7038.57bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best-229.994e-5533.06Bestrophin homolog 22 [Source:UniProtKB/Swiss-Pro... [more]
best-221.511e-5433.06Bestrophin homolog 22 [Source:UniProtKB/Swiss-Pro... [more]
best-232.142e-5433.60Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:A... [more]
best-33.909e-5431.81Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
best-51.143e-5329.51Bestrophin homolog 5 [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Best12.604e-7537.53gene:FBgn0040238 transcript:FBtr0082183[more]
Best14.172e-7537.53gene:FBgn0040238 transcript:FBtr0337020[more]
Best17.844e-7537.80gene:FBgn0040238 transcript:FBtr0114590[more]
Best11.331e-7437.53gene:FBgn0040238 transcript:FBtr0306023[more]
Best31.005e-6833.17gene:FBgn0036492 transcript:FBtr0075618[more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best14.878e-7237.19bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
best24.803e-6937.81bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
best43.183e-6033.33bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
best42.729e-5933.05bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
best11.568e-3638.98bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best19.930e-7437.26bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
best12.810e-7337.26bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
best13.228e-7337.26bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
best15.181e-7334.08bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
best16.470e-7237.26bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Best22.752e-6938.57bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
Best22.752e-6938.57bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
Best22.752e-6938.57bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
Best31.452e-6836.36bestrophin 3 [Source:MGI Symbol;Acc:MGI:3580298][more]
Best12.899e-6836.16bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332][more]
back to top
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6UY87|BEST1_MACFA5.094e-7336.74Bestrophin-1 OS=Macaca fascicularis OX=9541 GN=BES... [more]
sp|O76090|BEST1_HUMAN6.964e-7336.74Bestrophin-1 OS=Homo sapiens OX=9606 GN=BEST1 PE=1... [more]
sp|Q8NFU1|BEST2_HUMAN1.319e-6938.57Bestrophin-2 OS=Homo sapiens OX=9606 GN=BEST2 PE=1... [more]
sp|Q8BGM5|BEST2_MOUSE2.891e-6838.57Bestrophin-2 OS=Mus musculus OX=10090 GN=Best2 PE=... [more]
sp|Q6H1V1|BEST3_MOUSE1.016e-6736.36Bestrophin-3 OS=Mus musculus OX=10090 GN=Best3 PE=... [more]
back to top
BLAST of Bestrophin homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FNT52.328e-11644.42Bestrophin homolog OS=Macrostomum lignano OX=28230... [more]
A0A1I8HMQ95.542e-11644.42Bestrophin homolog OS=Macrostomum lignano OX=28230... [more]
A0A267F2G91.163e-11244.89Bestrophin homolog OS=Macrostomum lignano OX=28230... [more]
A0A267GQY77.550e-11241.18Bestrophin homolog OS=Macrostomum lignano OX=28230... [more]
A0A267FLK38.589e-11241.18Bestrophin homolog OS=Macrostomum lignano OX=28230... [more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best18.245e-7036.36bestrophin-2 [Source:NCBI gene;Acc:103045999][more]
best22.813e-6536.36bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
best44.146e-6034.97bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
best15.939e-5733.06bestrophin-2 [Source:NCBI gene;Acc:103045999][more]
BEST33.482e-3439.39bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
best11.082e-7036.64bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
best22.583e-6836.91bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bestrophin homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bestrophin homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
BEST35.593e-7036.36bestrophin 3 [Source:NCBI gene;Acc:101172121][more]
best16.951e-6837.19bestrophin-2 [Source:NCBI gene;Acc:101167866][more]
best21.056e-6637.09bestrophin 2 [Source:NCBI gene;Acc:110015962][more]
back to top
BLAST of Bestrophin homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070057.10.000e+084.09SMESG000070057.1[more]
SMESG000070057.10.000e+080.45SMESG000070057.1[more]
SMESG000055094.12.270e-16357.36SMESG000055094.1[more]
SMESG000055094.14.308e-16258.79SMESG000055094.1[more]
SMESG000065100.14.886e-16154.77SMESG000065100.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019729 ID=SMED30019729|Name=Bestrophin homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1794bp
GATCTCAAACATGGGCAAACAAACAAACACACACATACATGCATACATAC
ACTCAAAGTATGGAACACACAAACACACACACACACAACGACTCGTCTTG
CATTCATTAGCGGATTTCTCTATAGCTGTTGCTGGGTAACCTTATCTTCC
ATTGTTACGGAATAAGTCTACTAGAAAAAAAATAATAGTTTTTTCCCTTG
ATTTTGCTGTCAGTGAATTTTTTGGACTTTCAAATCGAATTTGCAAATTA
TGACAATTCTCTATTTGGATGATGTAACGAGACGCACAGAGATCGGCTGT
ATTTTTCGGTTGCTGAAAAGATGGAAAGGCAGCCTGTACAAATTGGTGTA
TAAAGATCTGATGGGATACGTCGGGATTTATTACGTAATCAACTTGATAT
ATCGGTTTGCTCTAAAAACCCCAGCACAAAAAAGGAGTTTTGAAGAAATA
GTCAAATTCTGTGATAATATGAAAAATAATATTCCAATATCCTTTTTGCT
AGGTTTCTTTGTCACTGGTGTCATTGCCCGCTGGTTTCAATTGTACCTTT
ACATTCCTTACCTCAATCGGATGGCCTTTTTGTCAGAAGGTTTAATTAAT
GGTGGCGACAAGGAAAAATGCTTGAAGATTCGTCAAACTCTTATGCGATA
CCTGAATTTGTCCTGGATTCTCTGCATGAGGCAAGTCAGCGATCAAATCG
ACATCAGATTCAAGCACAATGACGAGAATAACAATGAAGAGCATCACTTT
AGGCATACCTTCATAAACTTCAACAGAGACAAAAAAATTCAATCAACATT
TAGAAAAATTATTACAGATGCTGAAGTAAGGGCATTTGAAAATATTGCTG
CGAAGAATTATTCCAAAACCAAAAGTAAATTCCCCCCCGAGTTTTGGGTA
CCCATTCAATGGTCATCAAGACTTCTGCAAAAAGCCTTTGTACATGGATT
TATAAGCGATCCAAGAACCCTTAATTCTATCATTAGTGATCTTGACGTTC
TTCGTGGGCAAATGCATACCCTACAAATATTCAGTGGAATCATGATCCCA
CTTGTGTATACTCAAGTAATAATCATTGCTGTTTATAGCTATTTCCTTTG
CCAGCTCTTTGCGTCTCAATTCGTTGACCCCGAAAGCAAAATAACTGGCC
ATGAAGTTGACCTGTACGTTCCAATCTTTACAATCTTTCAATTCCTATTT
TTTATGGGATGGCTAAAGGTCGCCATGTGCGTTATGAATCCTTTTGGAGA
TGACGATGAAGATTTTCAAACATCAGAAATGTTGGATTACAATTTAAATT
TGTCATACAGATGTGCAACTGCTCATGATGACATGTATCCAGCATATTTG
AAGCATCCAAATATAATTTATTCATTACCAATGGTTTATCAAAGTCAAAA
AGCAGATTCCGTTGAAATTAAAACATTTTTCGATTCATTAAATGCCACAC
AAACAGAACTTGCGAGAGAATATGCAGCTTTTCAGTCTGAAATTTGTAAT
AACCAAAAGCCAGTAATCAGCGCAAATAAAGTTTTCAATTTTTTGAGATC
GTTAAAGATGTGTATACCAAGTAGAAGAAAATTAGAAAAAGACCAGTTAT
CCATCTACTCTCTTCGAAGGTGCAGTTTTAACGATACAAGATCTGTATTA
CATCCTAGAACCGATAGCCAATATCACGTTATTCCTGTTGATGATTTTAC
AAGCAGATTATAAATTAACGATACAAATTATTTATATGTGACTTACAATT
TTTAGTAGAATTAAAACTGCCATCACTAGAATATAAATATTTAT
back to top

protein sequence of SMED30019729-orf-1

>SMED30019729-orf-1 ID=SMED30019729-orf-1|Name=SMED30019729-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=488bp
MTILYLDDVTRRTEIGCIFRLLKRWKGSLYKLVYKDLMGYVGIYYVINLI
YRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYL
YIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQI
DIRFKHNDENNNEEHHFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIA
AKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDV
LRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITG
HEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLN
LSYRCATAHDDMYPAYLKHPNIIYSLPMVYQSQKADSVEIKTFFDSLNAT
QTELAREYAAFQSEICNNQKPVISANKVFNFLRSLKMCIPSRRKLEKDQL
SIYSLRRCSFNDTRSVLHPRTDSQYHVIPVDDFTSRL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR000615Bestrophin
IPR021134Bestrophin/UPF0187
Vocabulary: molecular function
TermDefinition
GO:0005254chloride channel activity
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0016323basolateral plasma membrane
GO:0034707chloride channel complex
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0006821chloride transport
GO:0007601visual perception
GO:0050896response to stimulus
GO:1902476chloride transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR021134Bestrophin/UPF0187PFAMPF01062Bestrophincoord: 12..335
e-value: 7.6E-65
score: 219.2
IPR000615BestrophinPANTHERPTHR10736BESTROPHINcoord: 1..335
NoneNo IPR availablePANTHERPTHR10736:SF55BESTROPHIN 1, ISOFORM C-RELATEDcoord: 1..335
NoneNo IPR availableTMHMMTMhelixcoord: 261..283
NoneNo IPR availableTMHMMTMhelixcoord: 76..98
NoneNo IPR availableTMHMMTMhelixcoord: 37..55
NoneNo IPR availableTMHMMTMhelixcoord: 303..322