Repulsive guidance molecule BMP co-receptor b

Overview
NameRepulsive guidance molecule BMP co-receptor b
Smed IDSMED30019725
Length (bp)1634
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Repulsive guidance molecule BMP co-receptor b (SMED30019725) t-SNE clustered cells

Violin plots show distribution of expression levels for Repulsive guidance molecule BMP co-receptor b (SMED30019725) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Repulsive guidance molecule BMP co-receptor b (SMED30019725) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Repulsive guidance molecule BMP co-receptor b (SMED30019725) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019725

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30019725SMESG000033522.1 SmedASXL_006519SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30019725SMESG000033522.1 dd_Smed_v6_14090_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Human
Match: RGMB (repulsive guidance molecule BMP co-receptor b [Source:HGNC Symbol;Acc:HGNC:26896])

HSP 1 Score: 73.1738 bits (178), Expect = 3.438e-13
Identity = 79/286 (27.62%), Postives = 128/286 (44.76%), Query Frame = 2
Query:  251 EDCRTYRIYLGCLEILRSSNSHCQANLQFW-LMLSTTEKLIKEKCST-GDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCLESSQGGERS-RNG------YYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISDFGIPKLIYVAXXXXXXXXXXXNGREEIPQSLISIKLVFRTSVQEKVELWLGHXXXXXXXXXXXXSDGEFTLSAITSLPLQVSTSQPRSRQQNLVRELCSSGCPASESIDD 1081
            E C+  R Y GC +  R+S + C+ NL +   +L  ++ + +  CS  G T+   P  E+                    PC   S  G R  R G      Y  C +F  P+L  F    QTC++EG+WPLI+N +L++Q+T     P     S+ T   +I+++ K   +C       + +Y A +D   +  +            S+++V R S    VE+   +I T + + +     G +   AI  +P  ++ S   S  Q+L  +LC +GCP SE IDD
Sbjct:   80 EFCKALRAYAGCTQ--RTSKA-CRGNLVYHSAVLGISDLMSQRNCSKDGPTSSTNP--EVTHD-----------------PCNYHSHAGAREHRRGDQNPPSYLFCGLFGDPHLRTFKDNFQTCKVEGAWPLIDNNYLSVQVTNVPVVP----GSSATATNKITIIFKAHHECTD-----QKVYQAVTDDLPAAFVDGTTSGGDSDAKSLRIVERES-GHYVEMHARYIGTTVFVRQV----GRYLTLAI-RMPEDLAMSYEES--QDL--QLCVNGCPLSERIDD 324          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Human
Match: RGMB (repulsive guidance molecule BMP co-receptor b [Source:HGNC Symbol;Acc:HGNC:26896])

HSP 1 Score: 72.4034 bits (176), Expect = 7.764e-13
Identity = 79/286 (27.62%), Postives = 128/286 (44.76%), Query Frame = 2
Query:  251 EDCRTYRIYLGCLEILRSSNSHCQANLQFW-LMLSTTEKLIKEKCST-GDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCLESSQGGERS-RNG------YYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISDFGIPKLIYVAXXXXXXXXXXXNGREEIPQSLISIKLVFRTSVQEKVELWLGHXXXXXXXXXXXXSDGEFTLSAITSLPLQVSTSQPRSRQQNLVRELCSSGCPASESIDD 1081
            E C+  R Y GC +  R+S + C+ NL +   +L  ++ + +  CS  G T+   P  E+                    PC   S  G R  R G      Y  C +F  P+L  F    QTC++EG+WPLI+N +L++Q+T     P     S+ T   +I+++ K   +C       + +Y A +D   +  +            S+++V R S    VE+   +I T + + +     G +   AI  +P  ++ S   S  Q+L  +LC +GCP SE IDD
Sbjct:  121 EFCKALRAYAGCTQ--RTSKA-CRGNLVYHSAVLGISDLMSQRNCSKDGPTSSTNP--EVTHD-----------------PCNYHSHAGAREHRRGDQNPPSYLFCGLFGDPHLRTFKDNFQTCKVEGAWPLIDNNYLSVQVTNVPVVP----GSSATATNKITIIFKAHHECTD-----QKVYQAVTDDLPAAFVDGTTSGGDSDAKSLRIVERES-GHYVEMHARYIGTTVFVRQV----GRYLTLAI-RMPEDLAMSYEES--QDL--QLCVNGCPLSERIDD 365          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Human
Match: RGMA (repulsive guidance molecule BMP co-receptor a [Source:HGNC Symbol;Acc:HGNC:30308])

HSP 1 Score: 60.8474 bits (146), Expect = 3.050e-9
Identity = 46/170 (27.06%), Postives = 78/170 (45.88%), Query Frame = 2
Query:  245 TEEDCRTYRIYLGCLEILRSSNSHCQANLQFWLMLSTTEKLIKEKCSTGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCL---ESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCI 745
            T E C   R Y  C    R +   C+ +L +   +   E L+ +   + D  P   PR  + + P  G    D +  S SP +   E S     +   Y  C +F  P+L  F+   QTC+++G+WPLI+N +L +Q+T     P     S  T  ++++++ K   +C+
Sbjct:   56 TPEFCAALRSYALCT---RRTARTCRGDLAYHSAVHGIEDLMSQHNCSKDG-PTSQPR--LRTLPPAG----DSQERSDSPEICHYEKSFHKHSATPNYTHCGLFGDPHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLP----GSAATATSKLTIIFKNFQECV 211          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Human
Match: RGMA (repulsive guidance molecule BMP co-receptor a [Source:HGNC Symbol;Acc:HGNC:30308])

HSP 1 Score: 60.8474 bits (146), Expect = 3.050e-9
Identity = 46/170 (27.06%), Postives = 78/170 (45.88%), Query Frame = 2
Query:  245 TEEDCRTYRIYLGCLEILRSSNSHCQANLQFWLMLSTTEKLIKEKCSTGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCL---ESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCI 745
            T E C   R Y  C    R +   C+ +L +   +   E L+ +   + D  P   PR  + + P  G    D +  S SP +   E S     +   Y  C +F  P+L  F+   QTC+++G+WPLI+N +L +Q+T     P     S  T  ++++++ K   +C+
Sbjct:   56 TPEFCAALRSYALCT---RRTARTCRGDLAYHSAVHGIEDLMSQHNCSKDG-PTSQPR--LRTLPPAG----DSQERSDSPEICHYEKSFHKHSATPNYTHCGLFGDPHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLP----GSAATATSKLTIIFKNFQECV 211          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Human
Match: RGMA (repulsive guidance molecule BMP co-receptor a [Source:HGNC Symbol;Acc:HGNC:30308])

HSP 1 Score: 60.8474 bits (146), Expect = 3.050e-9
Identity = 46/170 (27.06%), Postives = 78/170 (45.88%), Query Frame = 2
Query:  245 TEEDCRTYRIYLGCLEILRSSNSHCQANLQFWLMLSTTEKLIKEKCSTGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCL---ESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCI 745
            T E C   R Y  C    R +   C+ +L +   +   E L+ +   + D  P   PR  + + P  G    D +  S SP +   E S     +   Y  C +F  P+L  F+   QTC+++G+WPLI+N +L +Q+T     P     S  T  ++++++ K   +C+
Sbjct:   56 TPEFCAALRSYALCT---RRTARTCRGDLAYHSAVHGIEDLMSQHNCSKDG-PTSQPR--LRTLPPAG----DSQERSDSPEICHYEKSFHKHSATPNYTHCGLFGDPHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLP----GSAATATSKLTIIFKNFQECV 211          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Celegans
Match: drag-1 (RGM domain family member drag-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EDE5])

HSP 1 Score: 51.9878 bits (123), Expect = 6.410e-7
Identity = 36/146 (24.66%), Postives = 60/146 (41.10%), Query Frame = 2
Query:  242 TTEEDCRTYRIYLGCLEILRSSNSHCQANLQFW---LMLSTTEKLIK----EKCSTGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCLESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQ 658
             TE  C+  + YL C+     +  +C  NL+F    L++    K  +    E C+       +      F+ P   R L                           CS+F  P+L++F+G  QTC  EG+ PL++NR+  +Q+T +
Sbjct:   44 ATERYCQVLQTYLKCMN---DTQRYCHGNLRFHSSELIMRRHWKEFECEKWESCNDNSHVKRKHVNTCYFNPPPSNRKLK-------------------------YCSLFGDPHLIMFNGSVQTCSEEGARPLVDNRYFLVQVTNR 161          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Zebrafish
Match: rgmb (repulsive guidance molecule BMP co-receptor b [Source:ZFIN;Acc:ZDB-GENE-040527-2])

HSP 1 Score: 68.9366 bits (167), Expect = 4.868e-12
Identity = 50/166 (30.12%), Postives = 79/166 (47.59%), Query Frame = 2
Query:  251 EDCRTYRIYLGCLEILRSSNSHCQANLQFW-LMLSTTEKLIKEKCST-GDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCLESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKC 742
            E C+  R Y  C +  R++ S C+ NL F   ML  T+ + +  CS  G T+   P   I   N     +    +  +  P        E  R  Y  C +F  P+L  F  + QTC++EG+WPLI+N +L++Q+T    N      S+ T   +I+++ KP  +C
Sbjct:   71 EFCKALRAYSACTQ--RTAKS-CRGNLVFHSAMLGITDLMSQRNCSKDGPTSSTHPVIPIEPCNYHSRHHHHVSRFGTGVP--------EHPRLMYLFCGLFGDPHLRTFKDQFQTCKVEGAWPLIDNNYLSVQVT----NVPVVYGSSATATNKITIIFKPYQEC 221          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Zebrafish
Match: rgma (repulsive guidance molecule BMP co-receptor a [Source:ZFIN;Acc:ZDB-GENE-040527-1])

HSP 1 Score: 64.3142 bits (155), Expect = 1.700e-10
Identity = 72/296 (24.32%), Postives = 117/296 (39.53%), Query Frame = 2
Query:  248 EEDCRTYRIYLGCLEILRSSNSHCQANLQFWLMLSTTEKLI-KEKCSTGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCL---ESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISDF-------GIPKLIYVAXXXXXXXXXXXNGR--EEIPQSLISI--KLVFRTSVQEKVELWLGHXXXXXXXXXXXXSDGEFTLSAITSLPLQVSTSQPRSRQQNLVRELCSSGCPASESIDDRTL 1090
            EE C   R Y  C+   R +   C+ +L +       E L+ +  CS     P   PR      P       D  + S  P +   E S     +   Y  C  F  P+L  F+ + QTC++EG+WPLI+N++L++Q+T    N      S+ T  ++++++     +C+           +P      + +          R  E++P   + I  + +  T V  KV    GH                  L+    +P +V  S      Q+L   LC  GCPA++ ID RT 
Sbjct:   52 EEFCTALRAYNSCV---RRTARTCRGDLAYHSAQHGIEDLMSQHNCS--KEGPTTQPRARTVPPPVLSPPQTDIHIPSDEPEVCHYERSLPHNAAPPNYTHCGFFGDPHLRTFNDDFQTCKVEGAWPLIHNKYLSVQVT----NTPVVVGSSATATSKLTIIFNSFQECVDQKTYRAETEDLPAAFIDGSKNGGEGHGANTLRVVEKVPGQHVEIQARYIGTTIVVRKV----GHY-----------------LTFAVRMPEEVVNSVEDQDNQDLY--LCLHGCPANQRIDFRTF 315          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Zebrafish
Match: rgma (repulsive guidance molecule BMP co-receptor a [Source:ZFIN;Acc:ZDB-GENE-040527-1])

HSP 1 Score: 63.929 bits (154), Expect = 1.912e-10
Identity = 72/296 (24.32%), Postives = 117/296 (39.53%), Query Frame = 2
Query:  248 EEDCRTYRIYLGCLEILRSSNSHCQANLQFWLMLSTTEKLI-KEKCSTGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCL---ESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISDF-------GIPKLIYVAXXXXXXXXXXXNGR--EEIPQSLISI--KLVFRTSVQEKVELWLGHXXXXXXXXXXXXSDGEFTLSAITSLPLQVSTSQPRSRQQNLVRELCSSGCPASESIDDRTL 1090
            EE C   R Y  C+   R +   C+ +L +       E L+ +  CS     P   PR      P       D  + S  P +   E S     +   Y  C  F  P+L  F+ + QTC++EG+WPLI+N++L++Q+T    N      S+ T  ++++++     +C+           +P      + +          R  E++P   + I  + +  T V  KV    GH                  L+    +P +V  S      Q+L   LC  GCPA++ ID RT 
Sbjct:   50 EEFCTALRAYNSCV---RRTARTCRGDLAYHSAQHGIEDLMSQHNCS--KEGPTTQPRARTVPPPVLSPPQTDIHIPSDEPEVCHYERSLPHNAAPPNYTHCGFFGDPHLRTFNDDFQTCKVEGAWPLIHNKYLSVQVT----NTPVVVGSSATATSKLTIIFNSFQECVDQKTYRAETEDLPAAFIDGSKNGGEGHGANTLRVVEKVPGQHVEIQARYIGTTIVVRKV----GHY-----------------LTFAVRMPEEVVNSVEDQDNQDLY--LCLHGCPANQRIDFRTF 313          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Zebrafish
Match: rgma (repulsive guidance molecule BMP co-receptor a [Source:ZFIN;Acc:ZDB-GENE-040527-1])

HSP 1 Score: 63.929 bits (154), Expect = 2.067e-10
Identity = 72/296 (24.32%), Postives = 117/296 (39.53%), Query Frame = 2
Query:  248 EEDCRTYRIYLGCLEILRSSNSHCQANLQFWLMLSTTEKLI-KEKCSTGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCL---ESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISDF-------GIPKLIYVAXXXXXXXXXXXNGR--EEIPQSLISI--KLVFRTSVQEKVELWLGHXXXXXXXXXXXXSDGEFTLSAITSLPLQVSTSQPRSRQQNLVRELCSSGCPASESIDDRTL 1090
            EE C   R Y  C+   R +   C+ +L +       E L+ +  CS     P   PR      P       D  + S  P +   E S     +   Y  C  F  P+L  F+ + QTC++EG+WPLI+N++L++Q+T    N      S+ T  ++++++     +C+           +P      + +          R  E++P   + I  + +  T V  KV    GH                  L+    +P +V  S      Q+L   LC  GCPA++ ID RT 
Sbjct:   68 EEFCTALRAYNSCV---RRTARTCRGDLAYHSAQHGIEDLMSQHNCS--KEGPTTQPRARTVPPPVLSPPQTDIHIPSDEPEVCHYERSLPHNAAPPNYTHCGFFGDPHLRTFNDDFQTCKVEGAWPLIHNKYLSVQVT----NTPVVVGSSATATSKLTIIFNSFQECVDQKTYRAETEDLPAAFIDGSKNGGEGHGANTLRVVEKVPGQHVEIQARYIGTTIVVRKV----GHY-----------------LTFAVRMPEEVVNSVEDQDNQDLY--LCLHGCPANQRIDFRTF 331          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Zebrafish
Match: rgmd (RGM domain family, member D [Source:ZFIN;Acc:ZDB-GENE-030131-561])

HSP 1 Score: 62.003 bits (149), Expect = 9.154e-10
Identity = 31/84 (36.90%), Postives = 49/84 (58.33%), Query Frame = 2
Query:  491 LESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKC 742
            L S    ++ + G+  C +F  P+L  F  E QTCR+EG+WPLI+NR+L++Q+T    N    + S+ T   +I+V+ K    C
Sbjct:  136 LASGPAAQQKKYGH--CGLFGDPHLRTFRDEFQTCRVEGAWPLIHNRYLSVQVT----NVPVVEGSSATATNKITVIFKSYHDC 213          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Xenopus
Match: aacs (acetoacetyl-CoA synthetase [Source:Xenbase;Acc:XB-GENE-490085])

HSP 1 Score: 66.6254 bits (161), Expect = 3.956e-11
Identity = 71/285 (24.91%), Postives = 126/285 (44.21%), Query Frame = 2
Query:  251 EDCRTYRIYLGCLEILRSSNSHCQANLQFW-LMLSTTEKLIKEKCSTGDTTPIEPPREII----FSNPAEGRNLDDEKMSSLSPCLESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISDFGIPKLIYVAXXX---XXXXXXXXNGREEIPQSLISIKLVFRTSVQEKVELWLGHXXXXXXXXXXXXSDGEFTLSAITSLPLQVSTSQPRSRQQNLVRELCSSGCPASESIDD 1081
            E C+  R Y  C +  R+S + C+ NL +   +L  ++ + +  CS    T    P   +    + N A  R L               + G++++  Y  C +F  P+L  F    QTC++EG+WPLI+N +L++Q+T     P     S+ T   +I+++ K    C       + +Y A +D   +       +G +   +SL  I+ V    V+     ++G       +       G +   AI  +P +++ +   S  Q+L  +LC +GCP SE ID+
Sbjct:   75 EFCKALRAYAACTQ--RTSKA-CRGNLVYHSAVLGISDLMSQRNCSKDGPTSSTNPEFTMDACNYHNRATERIL---------------RSGDQTQPNYLFCGLFGDPHLRTFQDHFQTCKVEGAWPLIDNNYLSVQVTNVPVVP----GSSATATNKITIIFKSFQDCTD-----QKVYQAVTDDLPAAFVDGTTSGGDSDSKSLRIIERVGGKHVEMHAR-YIGTTVIVRQL-------GNYLTLAI-RMPEELAMAYEES--QDL--QLCVNGCPTSERIDE 319          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Xenopus
Match: aacs (acetoacetyl-CoA synthetase [Source:Xenbase;Acc:XB-GENE-490085])

HSP 1 Score: 65.4698 bits (158), Expect = 9.135e-11
Identity = 71/285 (24.91%), Postives = 126/285 (44.21%), Query Frame = 2
Query:  251 EDCRTYRIYLGCLEILRSSNSHCQANLQFW-LMLSTTEKLIKEKCSTGDTTPIEPPREII----FSNPAEGRNLDDEKMSSLSPCLESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISDFGIPKLIYVAXXX---XXXXXXXXNGREEIPQSLISIKLVFRTSVQEKVELWLGHXXXXXXXXXXXXSDGEFTLSAITSLPLQVSTSQPRSRQQNLVRELCSSGCPASESIDD 1081
            E C+  R Y  C +  R+S + C+ NL +   +L  ++ + +  CS    T    P   +    + N A  R L               + G++++  Y  C +F  P+L  F    QTC++EG+WPLI+N +L++Q+T     P     S+ T   +I+++ K    C       + +Y A +D   +       +G +   +SL  I+ V    V+     ++G       +       G +   AI  +P +++ +   S  Q+L  +LC +GCP SE ID+
Sbjct:  104 EFCKALRAYAACTQ--RTSKA-CRGNLVYHSAVLGISDLMSQRNCSKDGPTSSTNPEFTMDACNYHNRATERIL---------------RSGDQTQPNYLFCGLFGDPHLRTFQDHFQTCKVEGAWPLIDNNYLSVQVTNVPVVP----GSSATATNKITIIFKSFQDCTD-----QKVYQAVTDDLPAAFVDGTTSGGDSDSKSLRIIERVGGKHVEMHAR-YIGTTVIVRQL-------GNYLTLAI-RMPEELAMAYEES--QDL--QLCVNGCPTSERIDE 348          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Xenopus
Match: bcas2 (breast carcinoma amplified sequence 2 [Source:Xenbase;Acc:XB-GENE-959514])

HSP 1 Score: 63.5438 bits (153), Expect = 4.365e-10
Identity = 70/289 (24.22%), Postives = 123/289 (42.56%), Query Frame = 2
Query:  227 YAQLSTTEEDCRTYRIYLGCLEILRSSNSHCQANLQFWLMLSTTEKLIKEKCSTGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPC-LESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISDFGIPKLIYVAXXXXXXXXXXXNGREEIPQSLISIKLVFRTSVQEKVELWLGHXXXXXXXXXXXXSDGEFTLSAITSLPLQVSTSQPRSRQQNLVRELCSSGCPASESIDDRTL 1090
            +A    T E C   R Y  C    R +   C+ +L +   +   + L+     + D  P   PR  I   P + +    E+  S   C  E S     +   Y  C +F  P+L  FS   QTC+++G+WPLI+N +L +Q+T     P     ST T  ++++++ K   +C+      + +Y A  D   +  +   +    +S  +   +      + +E+   +I T I++ +     G +   A+  +P +V  +      Q L   LC  GCP ++ ID RT 
Sbjct:   67 HAGPEDTVEICTALRTYAHCS---RRTARTCRGDLAYHSTVHGIDDLMSHHNCSKDG-PTSQPRIRILP-PGDSQ----ERSDSPEICHYEKSFHRPSALPNYTHCGLFGDPHLRTFSDTFQTCKIQGAWPLIDNNYLNVQVTNTPVLP----GSTATATSKLTIIFKNFQECVD-----QKVYQAEMDELPAAFVDGSKNGGDKSGANSLRIIEKVAGQHIEIQAKYIGTTIVVRQV----GRYLTFAV-RMPEEVVNAVEDKDNQGLY--LCLHGCPQNQQIDFRTF 330          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Xenopus
Match: bcas2 (breast carcinoma amplified sequence 2 [Source:Xenbase;Acc:XB-GENE-959514])

HSP 1 Score: 63.1586 bits (152), Expect = 4.987e-10
Identity = 70/289 (24.22%), Postives = 123/289 (42.56%), Query Frame = 2
Query:  227 YAQLSTTEEDCRTYRIYLGCLEILRSSNSHCQANLQFWLMLSTTEKLIKEKCSTGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPC-LESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISDFGIPKLIYVAXXXXXXXXXXXNGREEIPQSLISIKLVFRTSVQEKVELWLGHXXXXXXXXXXXXSDGEFTLSAITSLPLQVSTSQPRSRQQNLVRELCSSGCPASESIDDRTL 1090
            +A    T E C   R Y  C    R +   C+ +L +   +   + L+     + D  P   PR  I   P + +    E+  S   C  E S     +   Y  C +F  P+L  FS   QTC+++G+WPLI+N +L +Q+T     P     ST T  ++++++ K   +C+      + +Y A  D   +  +   +    +S  +   +      + +E+   +I T I++ +     G +   A+  +P +V  +      Q L   LC  GCP ++ ID RT 
Sbjct:   78 HAGPEDTVEICTALRTYAHCS---RRTARTCRGDLAYHSTVHGIDDLMSHHNCSKDG-PTSQPRIRILP-PGDSQ----ERSDSPEICHYEKSFHRPSALPNYTHCGLFGDPHLRTFSDTFQTCKIQGAWPLIDNNYLNVQVTNTPVLP----GSTATATSKLTIIFKNFQECVD-----QKVYQAEMDELPAAFVDGSKNGGDKSGANSLRIIEKVAGQHIEIQAKYIGTTIVVRQV----GRYLTFAV-RMPEEVVNAVEDKDNQGLY--LCLHGCPQNQQIDFRTF 341          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Xenopus
Match: HJV (hemojuvelin BMP co-receptor [Source:NCBI gene;Acc:100493945])

HSP 1 Score: 59.6918 bits (143), Expect = 6.586e-9
Identity = 31/81 (38.27%), Postives = 48/81 (59.26%), Query Frame = 2
Query:  515 RSRNG----YYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCI 745
            R ++G    Y  C +F  P++  FSG+ QTCR+ GSWPL++N +L +Q T   S+P     S  T  T+I+++ K   +CI
Sbjct:  132 REKHGKIPKYLHCGVFGDPHVRTFSGDFQTCRVNGSWPLLDNEYLFVQAT---SSPLSTM-SNATVTTKITIIFKNMKQCI 208          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Mouse
Match: Rgmb (repulsive guidance molecule family member B [Source:MGI Symbol;Acc:MGI:1916049])

HSP 1 Score: 74.3294 bits (181), Expect = 9.654e-14
Identity = 75/288 (26.04%), Postives = 125/288 (43.40%), Query Frame = 2
Query:  251 EDCRTYRIYLGCLEILRSSNSHCQANLQFW-LMLSTTEKLIKEKCST-GDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCLESSQGGERSRNG-------YYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISDFGIPKLIYVAXXXXXXXXXXXNGREEIPQSLISIKLVFRTSVQ--EKVELWLGHXXXXXXXXXXXXSDGEFTLSAITSLPLQVSTSQPRSRQQNLVRELCSSGCPASESIDD 1081
            E C+  R Y GC +  R+S + C+ NL +   +L  ++ + +  CS  G T+   P  E+                    PC   S GG R   G       Y  C +F  P+L  F    QTC++EG+WPLI+N +L++Q+T     P     S+ T   +++++ K   +C       + +Y A +D   +  +          + S+ +V + S +  E    ++G       +       G +   AI  +P  ++ S   S  Q+L  +LC +GCP SE IDD
Sbjct:   83 EFCKALRAYAGCTQ--RTSKA-CRGNLVYHSAVLGISDLMSQRNCSKDGPTSSTNP--EVTHD-----------------PCNYHSHGGVREHGGGDQRPPNYLFCGLFGDPHLRTFKDHFQTCKVEGAWPLIDNNYLSVQVTNVPVVP----GSSATATNKVTIIFKAQHECTD-----QKVYQAVTDDLPAAFVDGTTSGGDGDVKSLHIVEKESGRYVEMHARYIGTTVFVRQL-------GRYLTLAI-RMPEDLAMSYEES--QDL--QLCVNGCPMSECIDD 327          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Mouse
Match: Rgmb (repulsive guidance molecule family member B [Source:MGI Symbol;Acc:MGI:1916049])

HSP 1 Score: 68.1662 bits (165), Expect = 2.220e-12
Identity = 44/143 (30.77%), Postives = 67/143 (46.85%), Query Frame = 2
Query:  251 EDCRTYRIYLGCLEILRSSNSHCQANLQFW-LMLSTTEKLIKEKCST-GDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCLESSQGGERSRNG-------YYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQIT 652
            E C+  R Y GC +  R+S + C+ NL +   +L  ++ + +  CS  G T+   P  E+                    PC   S GG R   G       Y  C +F  P+L  F    QTC++EG+WPLI+N +L++Q+T
Sbjct:   83 EFCKALRAYAGCTQ--RTSKA-CRGNLVYHSAVLGISDLMSQRNCSKDGPTSSTNP--EVTHD-----------------PCNYHSHGGVREHGGGDQRPPNYLFCGLFGDPHLRTFKDHFQTCKVEGAWPLIDNNYLSVQVT 203          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Mouse
Match: Hjv (hemojuvelin BMP co-receptor [Source:MGI Symbol;Acc:MGI:1916835])

HSP 1 Score: 61.2326 bits (147), Expect = 1.391e-9
Identity = 51/168 (30.36%), Postives = 77/168 (45.83%), Query Frame = 2
Query:  257 CRTYRIYLGCLEILRSSNSHCQANLQFWLMLSTTEKL-IKEKCSTGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSP--C-LESSQGGERSRN-GYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCI 745
            CR  R Y  C    R +   C+ +L F   +   E L I+  CS     P  PP       PA G  L     + L+P  C  E+       R  G+  C+ F  P++  F  +  TCR++G+WPL++N FL +Q T   S+P     +  T I +I+++ K   +CI
Sbjct:   73 CRALRSYALCT---RRTARTCRGDLAFHSAVHGIEDLMIQHNCSR--QGPTAPP-------PARGPALPGAGPAPLTPDPCDYEARFSRLHGRAPGFLHCASFGDPHVRSFHNQFHTCRVQGAWPLLDNDFLFVQAT---SSPVS-SGANATTIRKITIIFKNMQECI 224          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Mouse
Match: Rgma (repulsive guidance molecule family member A [Source:MGI Symbol;Acc:MGI:2679262])

HSP 1 Score: 61.2326 bits (147), Expect = 1.822e-9
Identity = 45/168 (26.79%), Postives = 77/168 (45.83%), Query Frame = 2
Query:  251 EDCRTYRIYLGCLEILRSSNSHCQANLQFWLMLSTTEKLIKEKCSTGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCL---ESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCI 745
            E C   R Y  C    R +   C+ +L +   +   E L+ +   + D  P   PR  + + P  G    D +  S SP +   E S     +   Y  C +F  P+L  F+   QTC+++G+WPLI+N +L +Q+T     P     S  T  ++++++ K   +C+
Sbjct:   59 EFCAALRTYALCT---RRTARTCRGDLAYHSAVHGIEDLMSQHNCSKDG-PTSQPR--VRTLPPAG----DSQERSDSPEICHYEKSFHKHSAAPNYTHCGLFGDPHLRTFTDHFQTCKVQGAWPLIDNNYLNVQVTNTPVLP----GSAATATSKLTIIFKNFQECV 212          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Mouse
Match: Rgma (repulsive guidance molecule family member A [Source:MGI Symbol;Acc:MGI:2679262])

HSP 1 Score: 60.8474 bits (146), Expect = 2.466e-9
Identity = 45/168 (26.79%), Postives = 77/168 (45.83%), Query Frame = 2
Query:  251 EDCRTYRIYLGCLEILRSSNSHCQANLQFWLMLSTTEKLIKEKCSTGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCL---ESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCI 745
            E C   R Y  C    R +   C+ +L +   +   E L+ +   + D  P   PR  + + P  G    D +  S SP +   E S     +   Y  C +F  P+L  F+   QTC+++G+WPLI+N +L +Q+T     P     S  T  ++++++ K   +C+
Sbjct:   75 EFCAALRTYALCT---RRTARTCRGDLAYHSAVHGIEDLMSQHNCSKDG-PTSQPR--VRTLPPAG----DSQERSDSPEICHYEKSFHKHSAAPNYTHCGLFGDPHLRTFTDHFQTCKVQGAWPLIDNNYLNVQVTNTPVLP----GSAATATSKLTIIFKNFQECV 228          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. UniProt/SwissProt
Match: sp|Q7TQ33|RGMB_MOUSE (RGM domain family member B OS=Mus musculus OX=10090 GN=Rgmb PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 6.753e-13
Identity = 75/288 (26.04%), Postives = 125/288 (43.40%), Query Frame = 2
Query:  251 EDCRTYRIYLGCLEILRSSNSHCQANLQFW-LMLSTTEKLIKEKCST-GDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCLESSQGGERSRNG-------YYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISDFGIPKLIYVAXXXXXXXXXXXNGREEIPQSLISIKLVFRTSVQ--EKVELWLGHXXXXXXXXXXXXSDGEFTLSAITSLPLQVSTSQPRSRQQNLVRELCSSGCPASESIDD 1081
            E C+  R Y GC +  R+S + C+ NL +   +L  ++ + +  CS  G T+   P  E+                    PC   S GG R   G       Y  C +F  P+L  F    QTC++EG+WPLI+N +L++Q+T     P     S+ T   +++++ K   +C       + +Y A +D   +  +          + S+ +V + S +  E    ++G       +       G +   AI  +P  ++ S   S  Q+L  +LC +GCP SE IDD
Sbjct:   83 EFCKALRAYAGCTQ--RTSKA-CRGNLVYHSAVLGISDLMSQRNCSKDGPTSSTNP--EVTHD-----------------PCNYHSHGGVREHGGGDQRPPNYLFCGLFGDPHLRTFKDHFQTCKVEGAWPLIDNNYLSVQVTNVPVVP----GSSATATNKVTIIFKAQHECTD-----QKVYQAVTDDLPAAFVDGTTSGGDGDVKSLHIVEKESGRYVEMHARYIGTTVFVRQL-------GRYLTLAI-RMPEDLAMSYEES--QDL--QLCVNGCPMSECIDD 327          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. UniProt/SwissProt
Match: sp|Q6NW40|RGMB_HUMAN (RGM domain family member B OS=Homo sapiens OX=9606 GN=RGMB PE=1 SV=3)

HSP 1 Score: 73.1738 bits (178), Expect = 1.651e-12
Identity = 79/286 (27.62%), Postives = 128/286 (44.76%), Query Frame = 2
Query:  251 EDCRTYRIYLGCLEILRSSNSHCQANLQFW-LMLSTTEKLIKEKCST-GDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCLESSQGGERS-RNG------YYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISDFGIPKLIYVAXXXXXXXXXXXNGREEIPQSLISIKLVFRTSVQEKVELWLGHXXXXXXXXXXXXSDGEFTLSAITSLPLQVSTSQPRSRQQNLVRELCSSGCPASESIDD 1081
            E C+  R Y GC +  R+S + C+ NL +   +L  ++ + +  CS  G T+   P  E+                    PC   S  G R  R G      Y  C +F  P+L  F    QTC++EG+WPLI+N +L++Q+T     P     S+ T   +I+++ K   +C       + +Y A +D   +  +            S+++V R S    VE+   +I T + + +     G +   AI  +P  ++ S   S  Q+L  +LC +GCP SE IDD
Sbjct:   80 EFCKALRAYAGCTQ--RTSKA-CRGNLVYHSAVLGISDLMSQRNCSKDGPTSSTNP--EVTHD-----------------PCNYHSHAGAREHRRGDQNPPSYLFCGLFGDPHLRTFKDNFQTCKVEGAWPLIDNNYLSVQVTNVPVVP----GSSATATNKITIIFKAHHECTD-----QKVYQAVTDDLPAAFVDGTTSGGDSDAKSLRIVERES-GHYVEMHARYIGTTVFVRQV----GRYLTLAI-RMPEDLAMSYEES--QDL--QLCVNGCPLSERIDD 324          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. UniProt/SwissProt
Match: sp|Q9N0A6|RGMA_MACFA (Repulsive guidance molecule A OS=Macaca fascicularis OX=9541 GN=RGMA PE=2 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 3.255e-9
Identity = 43/167 (25.75%), Postives = 77/167 (46.11%), Query Frame = 2
Query:  245 TEEDCRTYRIYLGCLEILRSSNSHCQANLQFWLMLSTTEKLIKEKCSTGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCLESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCI 745
            T E C   R Y  C    R +   C+ +L +   +   E L+ +   + D  P   PR  + + P  G + +      +  C +S      + N Y  C +F  P+L  F+   QTC+++G+WPLI+N +L +Q+T     P     S  T  ++++++ K   +C+
Sbjct:   80 TPEFCAALRSYALCT---RRTARTCRGDLAYHSAVHGIEDLMSQHNCSKDG-PTSQPR--LHTLPPAGDSQERSDSPEICHCEKSFHKHSATPN-YTHCGLFGDPHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLP----GSAATATSKLTIIFKNFQECV 235          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. UniProt/SwissProt
Match: sp|Q7TQ32|RGMC_MOUSE (Hemojuvelin OS=Mus musculus OX=10090 GN=Hjv PE=1 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 9.727e-9
Identity = 51/168 (30.36%), Postives = 77/168 (45.83%), Query Frame = 2
Query:  257 CRTYRIYLGCLEILRSSNSHCQANLQFWLMLSTTEKL-IKEKCSTGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSP--C-LESSQGGERSRN-GYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCI 745
            CR  R Y  C    R +   C+ +L F   +   E L I+  CS     P  PP       PA G  L     + L+P  C  E+       R  G+  C+ F  P++  F  +  TCR++G+WPL++N FL +Q T   S+P     +  T I +I+++ K   +CI
Sbjct:   73 CRALRSYALCT---RRTARTCRGDLAFHSAVHGIEDLMIQHNCSR--QGPTAPP-------PARGPALPGAGPAPLTPDPCDYEARFSRLHGRAPGFLHCASFGDPHVRSFHNQFHTCRVQGAWPLLDNDFLFVQAT---SSPVS-SGANATTIRKITIIFKNMQECI 224          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. UniProt/SwissProt
Match: sp|Q6PCX7|RGMA_MOUSE (Repulsive guidance molecule A OS=Mus musculus OX=10090 GN=Rgma PE=1 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 1.725e-8
Identity = 45/168 (26.79%), Postives = 77/168 (45.83%), Query Frame = 2
Query:  251 EDCRTYRIYLGCLEILRSSNSHCQANLQFWLMLSTTEKLIKEKCSTGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCL---ESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCI 745
            E C   R Y  C    R +   C+ +L +   +   E L+ +   + D  P   PR  + + P  G    D +  S SP +   E S     +   Y  C +F  P+L  F+   QTC+++G+WPLI+N +L +Q+T     P     S  T  ++++++ K   +C+
Sbjct:   75 EFCAALRTYALCT---RRTARTCRGDLAYHSAVHGIEDLMSQHNCSKDG-PTSQPR--VRTLPPAG----DSQERSDSPEICHYEKSFHKHSAAPNYTHCGLFGDPHLRTFTDHFQTCKVQGAWPLIDNNYLNVQVTNTPVLP----GSAATATSKLTIIFKNFQECV 228          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. TrEMBL
Match: A0A3B3T6U6 (Repulsive guidance molecule BMP co-receptor b OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 8.854e-13
Identity = 77/281 (27.40%), Postives = 128/281 (45.55%), Query Frame = 2
Query:  251 EDCRTYRIYLGCLEILRSSNSHCQANLQFW-LMLSTTEKLIKEKCS----TGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCLESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISDFGIPKLIYVAXXXXXXXXXXXNGREEIPQSLISIKLVFRTSVQEKVELWLGHXXXXXXXXXXXXSDGEFTLSAITSLPLQVSTSQPRSRQQNLVRELCSSGCPASESID 1078
            E C+  R Y  C +  R+S S C+ NL F   ML  ++ + +  CS    T  T P  P     + N   G+                 Q G+ SR  Y  C +F  P+L  F    QTC++EG+WPLI+N +L++Q+T     P     S+ T   +I+++ KP   C ++  + + +      +    T+ +G  E     I  K+  R      VE+  G+    +I+ +     G + L+  T +P +++ +   S  Q+L  +LC +GCP +E ID
Sbjct:   73 EFCKVLRAYSACTQ--RTSKS-CRGNLVFHSAMLGISDLMSQRNCSRDGPTSSTHPEAPVEHCNYHNRHHGQ-----------------QAGDHSRPTYLFCGLFGDPHLRTFKDHFQTCKVEGAWPLIDNNYLSVQVTNVPVVP----GSSATATNKITIIFKPYQDC-TEQKVYQAVTDDLPVAFTDGTVSSGDGETRSLWIVEKVPGR-----HVEIHAGYTGITVIVRQL----GRY-LTLATRVPEELAMAYDES--QDL--QLCVNGCPTAERID 314          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. TrEMBL
Match: A0A3B3T7W5 (Repulsive guidance molecule BMP co-receptor b OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.206e-12
Identity = 77/281 (27.40%), Postives = 128/281 (45.55%), Query Frame = 2
Query:  251 EDCRTYRIYLGCLEILRSSNSHCQANLQFW-LMLSTTEKLIKEKCS----TGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCLESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISDFGIPKLIYVAXXXXXXXXXXXNGREEIPQSLISIKLVFRTSVQEKVELWLGHXXXXXXXXXXXXSDGEFTLSAITSLPLQVSTSQPRSRQQNLVRELCSSGCPASESID 1078
            E C+  R Y  C +  R+S S C+ NL F   ML  ++ + +  CS    T  T P  P     + N   G+                 Q G+ SR  Y  C +F  P+L  F    QTC++EG+WPLI+N +L++Q+T     P     S+ T   +I+++ KP   C ++  + + +      +    T+ +G  E     I  K+  R      VE+  G+    +I+ +     G + L+  T +P +++ +   S  Q+L  +LC +GCP +E ID
Sbjct:   72 EFCKVLRAYSACTQ--RTSKS-CRGNLVFHSAMLGISDLMSQRNCSRDGPTSSTHPEAPVEHCNYHNRHHGQ-----------------QAGDHSRPTYLFCGLFGDPHLRTFKDHFQTCKVEGAWPLIDNNYLSVQVTNVPVVP----GSSATATNKITIIFKPYQDC-TEQKVYQAVTDDLPVAFTDGTVSSGDGETRSLWIVEKVPGR-----HVEIHAGYTGITVIVRQL----GRY-LTLATRVPEELAMAYDES--QDL--QLCVNGCPTAERID 313          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. TrEMBL
Match: A0A4W4FPZ2 (Uncharacterized protein OS=Electrophorus electricus OX=8005 GN=rgmb PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 2.308e-12
Identity = 82/284 (28.87%), Postives = 135/284 (47.54%), Query Frame = 2
Query:  251 EDCRTYRIYLGCLEILRSSNSHCQANLQFW-LMLSTTEKLIKEKCST-GDTTPIEPPREIIFSNPAEGRNLDDEKMSSLS-PCLESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISDFGIPKLIYVAXXXXXXXXXXXNGREEIPQSLISIKLVFRTSVQEKVELWLGHXXXXXXXXXXXXSDGEFTLSAITSLPLQVSTSQPRSRQQNLVRELCSSGCPASESIDDRTLL 1093
            E C+  R Y GC +  R+S S C+ NL F   ML  ++ +I+  CS  G T+   P      + P E  N         + P   +++  E  R  +  C +F  P+L  F  + QTC++EG+WPLI+N +L++Q+T    N      S  T   +I+++ KP  +C       + +Y A +D   +  +            S+ +V RT+ +E VEL   +I   II+ +     G + L+    +P +V+ +      Q+L  +LC +GCP SE ID+   L
Sbjct:   71 EFCKALRAYSGCTQ--RTSKS-CRGNLVFHSAMLGISDLMIQRNCSKDGPTSSTHP------AVPIEPCNYHSRHHHPAALPGTGAARDSEPQRPTFLFCGLFGDPHLRTFKDQFQTCKVEGAWPLIDNNYLSVQVT----NVPVVLGSIATATDKITIIFKPYQECTE-----QKVYQAVTDDLPAAFVDGTVMGGDSETRSLLIVERTAGRE-VELHAAYIGVTIIVRQL----GRY-LTLAVRVPEEVAMA--FDETQDL--QLCMNGCPTSERIDEEGHL 326          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. TrEMBL
Match: W5KME8 (Repulsive guidance molecule BMP co-receptor b OS=Astyanax mexicanus OX=7994 PE=4 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 3.289e-12
Identity = 80/291 (27.49%), Postives = 134/291 (46.05%), Query Frame = 2
Query:  251 EDCRTYRIYLGCLEILRSSNSHCQANLQFW-LMLSTTEKLIKEKCS----TGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCLESSQ----------GGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISDFGIPKLIYVAXXXXXXXXXXXNGREEIPQSLISIKLVFRTSVQEKVELWLGHXXXXXXXXXXXXSDGEFTLSAITSLPLQVSTSQPRSRQQNLVRELCSSGCPASESID 1078
            E C+  R Y GC    R+S S C+ NL F   ML  ++ + +  CS    T  T P+ P                      + PC   S+          G E  R  Y  C +F  P+L  F  + QTC++EG+WPLI+N +L++Q+T    N    Q S+ T   +I+++ KP  +C +D  + + +      + +  T++ G  E+ +SL    LV   S    VE+   +I   +++ +     G + L+    +P +++ +      Q+L  +LC +GCP+SE ID
Sbjct:   56 EFCKALRAYSGCTH--RTSKS-CRGNLVFHSAMLGISDLMSQRNCSKDGPTSSTHPVAP----------------------IEPCNYHSRYQHQATLPGTGAELPRPNYLFCGLFGDPHLRTFKDQFQTCKVEGAWPLIDNNYLSVQVT----NVPVVQGSSATATNKITIIFKPYQEC-TDQKVYQAVTDDLPAAFVDGTVIGGSSEM-RSL----LVLEKSPGRHVEVHAAYIGVTVVVRQL----GRY-LTLAVRMPEELAMA--FDETQDL--QLCMNGCPSSERID 302          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. TrEMBL
Match: V4B4Y5 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_83132 PE=4 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.652e-12
Identity = 51/166 (30.72%), Postives = 86/166 (51.81%), Query Frame = 2
Query:  257 CRTYRIYLGCLEILRSSNSHCQANLQFWLMLSTTE-KLIKEKCSTGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCLESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISD 751
            C T R Y  C+   + +   C+ +L +  + +  + K+ +  CS    T ++P +E     P+E             P   S QG +  R+    C +F  P+L  F+GE QTC+++G+WPL+NN  LT+Q+T   ++P    DS  T  ++++VVIK + +C SD
Sbjct:    1 CITLRTYWNCI---KKNARDCKGDLNYLTVRTGVKNKMKQHNCSVTGAT-VDPAKE----KPSE----------PTIPAECSYQGKQVFRH----CGLFGDPHLSTFNGEFQTCKVQGAWPLVNNEHLTVQVT---NDPV-IGDSGATATSKLTVVIKKNARCASD 140          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Cavefish
Match: rgmb (repulsive guidance molecule BMP co-receptor b [Source:NCBI gene;Acc:103043298])

HSP 1 Score: 79.7221 bits (195), Expect = 1.246e-15
Identity = 80/291 (27.49%), Postives = 134/291 (46.05%), Query Frame = 2
Query:  251 EDCRTYRIYLGCLEILRSSNSHCQANLQFW-LMLSTTEKLIKEKCS----TGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCLESSQ----------GGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISDFGIPKLIYVAXXXXXXXXXXXNGREEIPQSLISIKLVFRTSVQEKVELWLGHXXXXXXXXXXXXSDGEFTLSAITSLPLQVSTSQPRSRQQNLVRELCSSGCPASESID 1078
            E C+  R Y GC    R+S S C+ NL F   ML  ++ + +  CS    T  T P+ P                      + PC   S+          G E  R  Y  C +F  P+L  F  + QTC++EG+WPLI+N +L++Q+T    N    Q S+ T   +I+++ KP  +C +D  + + +      + +  T++ G  E+ +SL    LV   S    VE+   +I   +++ +     G + L+    +P +++ +      Q+L  +LC +GCP+SE ID
Sbjct:   56 EFCKALRAYSGCTH--RTSKS-CRGNLVFHSAMLGISDLMSQRNCSKDGPTSSTHPVAP----------------------IEPCNYHSRYQHQATLPGTGAELPRPNYLFCGLFGDPHLRTFKDQFQTCKVEGAWPLIDNNYLSVQVT----NVPVVQGSSATATNKITIIFKPYQEC-TDQKVYQAVTDDLPAAFVDGTVIGGSSEM-RSL----LVLEKSPGRHVEVHAAYIGVTVVVRQL----GRY-LTLAVRMPEELAMA--FDETQDL--QLCMNGCPSSERID 302          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Cavefish
Match: rgmb (repulsive guidance molecule BMP co-receptor b [Source:NCBI gene;Acc:103043298])

HSP 1 Score: 79.337 bits (194), Expect = 2.346e-15
Identity = 78/281 (27.76%), Postives = 136/281 (48.40%), Query Frame = 2
Query:  251 EDCRTYRIYLGCLEILRSSNSHCQANLQFW-LMLSTTEKLIKEKCS----TGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCLESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISDFGIPKLIYVAXXXXXXXXXXXNGREEIPQSLISIKLVFRTSVQEKVELWLGHXXXXXXXXXXXXSDGEFTLSAITSLPLQVSTSQPRSRQQNLVRELCSSGCPASESID 1078
            E C+  R Y GC    R+S S C+ NL F   ML  ++ + +  CS    T  T P+ P     + +         +  ++L        G E  R  Y  C +F  P+L  F  + QTC++EG+WPLI+N +L++Q+T    N    Q S+ T   +I+++ KP  +C +D  + + +      + +  T++ G  E+ +SL    LV   S    VE+   +I   +++ +     G + L+    +P +++ +   +  Q+L  +LC +GCP+SE ID
Sbjct:   71 EFCKALRAYSGCTH--RTSKS-CRGNLVFHSAMLGISDLMSQRNCSKDGPTSSTHPVAPIEPCNYHS-------RYQHQATLP-----GTGAELPRPNYLFCGLFGDPHLRTFKDQFQTCKVEGAWPLIDNNYLSVQVT----NVPVVQGSSATATNKITIIFKPYQEC-TDQKVYQAVTDDLPAAFVDGTVIGGSSEM-RSL----LVLEKSPGRHVEVHAAYIGVTVVVRQL----GRY-LTLAVRMPEELAMAFDET--QDL--QLCMNGCPSSERID 317          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Cavefish
Match: rgmd (RGM domain family member B-like [Source:NCBI gene;Acc:103044657])

HSP 1 Score: 65.4698 bits (158), Expect = 5.363e-11
Identity = 52/175 (29.71%), Postives = 82/175 (46.86%), Query Frame = 2
Query:  224 LYAQLSTTEEDCRTYRIYLGCLEILRSSNSHCQANLQFW-LMLSTTEKLIKEKCST-GDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCLESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKC 742
            L  ++ T  + C   R Y  C    R +   C+ +L +   +    E   +  CS+ G T+  + P     S PA     D E     S  L S    ++ + G+  C +F  P+L  F  E QTCR+EG+WPLI+NR+L++Q+T    N    + S+ T   +I+V+ K    C
Sbjct:   56 LQEEVLTDVDHCIALRAYSLCT---RRTARGCRGDLVYHSAVFRIKELFAQHNCSSDGPTSSAKAPST---SRPAVVDVCDYE-----SRALASGPAAQQKKYGH--CGLFGDPHLRTFRDEFQTCRVEGAWPLIHNRYLSVQVT----NVPVVEGSSATATNKITVIFKSYHDC 213          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Cavefish
Match: rgmd (RGM domain family member B-like [Source:NCBI gene;Acc:103044657])

HSP 1 Score: 65.4698 bits (158), Expect = 6.927e-11
Identity = 52/175 (29.71%), Postives = 82/175 (46.86%), Query Frame = 2
Query:  224 LYAQLSTTEEDCRTYRIYLGCLEILRSSNSHCQANLQFW-LMLSTTEKLIKEKCST-GDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCLESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKC 742
            L  ++ T  + C   R Y  C    R +   C+ +L +   +    E   +  CS+ G T+  + P     S PA     D E     S  L S    ++ + G+  C +F  P+L  F  E QTCR+EG+WPLI+NR+L++Q+T    N    + S+ T   +I+V+ K    C
Sbjct:  111 LQEEVLTDVDHCIALRAYSLCT---RRTARGCRGDLVYHSAVFRIKELFAQHNCSSDGPTSSAKAPST---SRPAVVDVCDYE-----SRALASGPAAQQKKYGH--CGLFGDPHLRTFRDEFQTCRVEGAWPLIHNRYLSVQVT----NVPVVEGSSATATNKITVIFKSYHDC 268          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Cavefish
Match: rgma (repulsive guidance molecule BMP co-receptor a [Source:NCBI gene;Acc:103033224])

HSP 1 Score: 62.3882 bits (150), Expect = 5.217e-10
Identity = 73/286 (25.52%), Postives = 125/286 (43.71%), Query Frame = 2
Query:  248 EEDCRTYRIYLGCLEILRSSNSHCQANLQFWLMLSTTEKLI-KEKCSTGDTTPIEPPREIIFSNPAEGRNLDDEK-MSSLSPCL---ESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISDFGIPKLIYVAXXXXXXXXXXXNGREEIPQSLISIKLVFRTSVQEKVELWLGHXXXXXXXXXXXXSDGEFTLSAITSLPLQVSTSQPRSRQQNLVRELCSSGCPASESIDDRTL 1090
            EE C   R Y  C+   R +   C+ +L +       E L+ +  CS     P   PR    S PA          + S  P +   E S     +   Y  C  F  P+L  F+ + QTC++EG+WPLI+N++L++Q+T     P     S  T  ++++++ K   +C+      K+ +  T +   +    +          ++++V +   Q  VE+   +I T I++ +     G +   A+  +P +V  S      Q+L   LC  GCPA++ ID RT 
Sbjct:   68 EEFCTALRAYNSCV---RRTARTCRGDLAYHSAQHGIEDLMTQHNCS--KEGPTASPRARTLSPPAPPLPPQTNNFVPSDGPEVCHYERSLPRHSAPPNYTHCGFFGDPHLRTFNDDFQTCKVEGAWPLIHNKYLSVQVTNTPVLP----GSAATATSKLTIIFKNFQECVDQ----KMYHAETDELPAAFADGSKNGGDRHGANTLRIVEKVPGQH-VEIQARYIGTTIVVRQV----GRYLTFAV-RMPEEVVNSVEDQENQDLY--LCLHGCPANQRIDFRTF 332          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006652.1 (pep scaffold:Pmarinus_7.0:GL476710:41757:42613:-1 gene:ENSPMAG00000006012.1 transcript:ENSPMAT00000006652.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 5.454e-10
Identity = 28/85 (32.94%), Postives = 47/85 (55.29%), Query Frame = 2
Query:  488 CLESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKC 742
            C  S   GER    Y  C +F  P+L  F  + QTC++EG+WPL++N +L++Q+T     P     S+ T   +++++ K   +C
Sbjct:   15 CSYSPPEGERDIV-YRHCGLFGDPHLRTFMDDFQTCKVEGAWPLVDNPYLSVQVTNIPVVP----GSSATATNKLTIIFKEYAEC 94          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Nematostella
Match: EDO31635 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXD8])

HSP 1 Score: 55.8398 bits (133), Expect = 2.711e-8
Identity = 51/197 (25.89%), Postives = 87/197 (44.16%), Query Frame = 2
Query:  152 GDKKSLRNSINNVSCDKIRSRCDKLYAQ--LSTTEEDCRTYRIYLGCLEILRSSNSHCQANLQFWLMLSTTEKLIKEKCSTGDTTPIEPPREIIFSNPAEGRNLDDE---KMSSLSPCLESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIK 727
            G KKS      N SC +++ +C   Y Q    T  + C + ++Y  CL+ +R     C+ +   +     T   +  +    D   + P +E    N  + R +      K +    C  + +   +S    Y C +F  P+L  F   +QTC +EG+WPL+ N FL +Q+T    N      S+ T   +I+V+I+
Sbjct:   37 GSKKS------NSSC-QVQPKCTDPYVQREADTAFKLCASLKLYKLCLDRIRK---QCRGSGGIYYNTVRTLVPVLMRNHKCDNVTL-PEKEKGLLNIFKKRQMQGNIPPKPTVKPKCTRTKRLYSKSEEKKY-CGLFGDPHLRTFGDAKQTCVVEGAWPLVENHFLIVQVT----NVPLVDGSSATATNKITVIIQ 217          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Medaka
Match: rgmb (repulsive guidance molecule BMP co-receptor b [Source:NCBI gene;Acc:101161978])

HSP 1 Score: 71.2478 bits (173), Expect = 9.537e-13
Identity = 49/168 (29.17%), Postives = 76/168 (45.24%), Query Frame = 2
Query:  251 EDCRTYRIYLGCLEILRSSNSHCQANLQFW-LMLSTTEKLIKEKCSTGDTTPIEPPREIIFSNPA--EGRNLDDEKMSSLSPCLES-SQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKC 742
            E C+  R Y  C +    S   C+ +L F   +L  ++ + +  CS    T    P   I + P     R+      S L     S +     SR GY  C +F  P+L  F    QTC++EG+WPLI+N +L++Q+T     P     S+ T   +I+++ KP   C
Sbjct:   78 EFCKALRAYSACTQKTAKS---CRGDLVFHSAVLGISDLMSQRNCSKDGPTSTSHPE--IHAEPCNYHSRSQQAHIHSHLHAHTHSHAHNSGHSRPGYLFCGLFGDPHLRTFKDSFQTCKVEGAWPLIDNDYLSVQVTNVPVVP----GSSATATNKITIIFKPYEGC 236          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Medaka
Match: rgmd (repulsive guidance molecule A [Source:NCBI gene;Acc:101170662])

HSP 1 Score: 61.2326 bits (147), Expect = 1.180e-9
Identity = 46/158 (29.11%), Postives = 75/158 (47.47%), Query Frame = 2
Query:  257 CRTYRIYLGCLEILRSSNSHCQANLQFW-LMLSTTEKLIKEKCSTGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCLESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIK 727
            C   R Y  C++  R + S C+ +L +   +    E   K  CS+   T           +P+  R    E  +  +  L S    ++ +  Y  C +F  P+L  F  E QTC++EG+WPLI+NRFL++Q+T    N      S+ T  ++I+V+ K
Sbjct:   67 CIALRAYALCVK--RQARS-CRGDLVYHSAVFPIKELFFKHNCSSDGPTSFA-------KSPSTPRPAASELCNYENRVLMSGSAAQQKK--YAHCGLFGDPHLRTFRDEFQTCKVEGAWPLIDNRFLSVQVT----NVPVVLGSSATATSKITVIFK 208          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Medaka
Match: rgma (repulsive guidance molecule BMP co-receptor a [Source:NCBI gene;Acc:101160903])

HSP 1 Score: 59.3066 bits (142), Expect = 5.092e-9
Identity = 74/291 (25.43%), Postives = 124/291 (42.61%), Query Frame = 2
Query:  221 KLYAQLSTT--EED-CRTYRIYLGCLEILRSSNSHCQANLQFWLMLSTTEKLI-KEKCSTGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPC-LESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISDFGIPKLIYVAXXXXXXXXXXXNGREEIPQSLISIKLVFRTSVQEKVELWLGHXXXXXXXXXXXXSDGEFTLSAITSLPLQVSTSQPRSRQQNLVRELCSSGCPASESID 1078
            +L+A  S T  EED C   R Y  C+   R +   C+ +L +         L+ +  CS  + T     R  +   P        E  S    C  E S       + Y  C  F  P+L  F  + QTC++EG+WPLI+N++L++Q+T     P     S  T  T+++++ K   +C+      + +Y A +D   S      +    +   +   V    + + VE+   +I T I++ +     G +   A+  +P +V  S      Q+L   LC  GCP ++ ID
Sbjct:   40 ELWASTSKTGPEEDFCIALRAYDNCV---RRTARTCRGDLTYHSAQHGIGDLMSQHNCSKEEPTSQPRARTPLPPPPPPPVLTSQEPSSGPEGCHYEHSLPRNAPPSNYTHCGFFGVPHLRTFGDDFQTCKVEGAWPLIHNKYLSVQVTNSPVVP----GSLATATTKLTIIFKNFQQCVD-----QKMYHAETDQLPSAFADGSKNGGDRHGANALQVVEKVLGQHVEIHARYIGTTIVVRQV----GRYLTFAV-RMPEEVVNSVEEGDNQDLY--LCLHGCPTNQRID 311          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Medaka
Match: rgma (repulsive guidance molecule BMP co-receptor a [Source:NCBI gene;Acc:101160903])

HSP 1 Score: 58.5362 bits (140), Expect = 8.070e-9
Identity = 74/291 (25.43%), Postives = 124/291 (42.61%), Query Frame = 2
Query:  221 KLYAQLSTT--EED-CRTYRIYLGCLEILRSSNSHCQANLQFWLMLSTTEKLI-KEKCSTGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPC-LESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISDFGIPKLIYVAXXXXXXXXXXXNGREEIPQSLISIKLVFRTSVQEKVELWLGHXXXXXXXXXXXXSDGEFTLSAITSLPLQVSTSQPRSRQQNLVRELCSSGCPASESID 1078
            +L+A  S T  EED C   R Y  C+   R +   C+ +L +         L+ +  CS  + T     R  +   P        E  S    C  E S       + Y  C  F  P+L  F  + QTC++EG+WPLI+N++L++Q+T     P     S  T  T+++++ K   +C+      + +Y A +D   S      +    +   +   V    + + VE+   +I T I++ +     G +   A+  +P +V  S      Q+L   LC  GCP ++ ID
Sbjct:   56 ELWASTSKTGPEEDFCIALRAYDNCV---RRTARTCRGDLTYHSAQHGIGDLMSQHNCSKEEPTSQPRARTPLPPPPPPPVLTSQEPSSGPEGCHYEHSLPRNAPPSNYTHCGFFGVPHLRTFGDDFQTCKVEGAWPLIHNKYLSVQVTNSPVVP----GSLATATTKLTIIFKNFQQCVD-----QKMYHAETDQLPSAFADGSKNGGDRHGANALQVVEKVLGQHVEIHARYIGTTIVVRQV----GRYLTFAV-RMPEEVVNSVEEGDNQDLY--LCLHGCPTNQRID 327          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Medaka
Match: hjv (hemojuvelin [Source:NCBI gene;Acc:101171109])

HSP 1 Score: 52.7582 bits (125), Expect = 6.520e-7
Identity = 24/72 (33.33%), Postives = 43/72 (59.72%), Query Frame = 2
Query:  530 YYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCI 745
            Y  C+IF  P++  F+ E QTC ++G+WP+I+N +L +Q T   +    +     T +T+I+++ K   +CI
Sbjct:  153 YLHCAIFGDPHIRTFNNEFQTCAVQGAWPVIDNEYLYVQATSSPAKEGLYP----TILTKITIIFKNWRQCI 220          
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Planmine SMEST
Match: SMESG000033522.1 (SMESG000033522.1)

HSP 1 Score: 874.004 bits (2257), Expect = 0.000e+0
Identity = 471/472 (99.79%), Postives = 471/472 (99.79%), Query Frame = 2
Query:  107 MVSSKLSFNENPYVLGDKKSLRNSINNVSCDKIRSRCDKLYAQLSTTEEDCRTYRIYLGCLEILRSSNSHCQANLQFWLMLSTTEKLIKEKCSTGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCLESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISDFGIPKLIYVAXXXXXXXXXXXNGREEIPQSLISIKLVFRTSVQEKVELWLGHXXXXXXXXXXXXSDGEFTLSAITSLPLQVSTSQPRSRQQNLVRELCSSGCPASESIDDRTLLDNMYXXXXXXXXXXXXXXXFCLVHKFQGLFFDICYLMSELLLTTKYIIPQSPETLKSLENYIVSSISVIQTNIFQFSHLASVNFSFDLSSRTGFIPFRPLWKIRSLQILSQNPKNSSVVTSSDYKFAITILLLSLLCFYRWHI 1522
            MVSSKLSFNENPYVLGDKKSLRNSINNVSCDKIRSRCDKLYAQLSTTEEDCRTYRIYLGCLEILRSSNSHCQANLQFWLMLSTTEKLIKEKCSTGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCLESSQ GERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISDFGIPKLIYVATSDSTLSTTLLNGREEIPQSLISIKLVFRTSVQEKVELWLGHINTRIIIIRTEISDGEFTLSAITSLPLQVSTSQPRSRQQNLVRELCSSGCPASESIDDRTLLDNMYLKSKNKSLSQNKSKNFCLVHKFQGLFFDICYLMSELLLTTKYIIPQSPETLKSLENYIVSSISVIQTNIFQFSHLASVNFSFDLSSRTGFIPFRPLWKIRSLQILSQNPKNSSVVTSSDYKFAITILLLSLLCFYRWHI
Sbjct:    1 MVSSKLSFNENPYVLGDKKSLRNSINNVSCDKIRSRCDKLYAQLSTTEEDCRTYRIYLGCLEILRSSNSHCQANLQFWLMLSTTEKLIKEKCSTGDTTPIEPPREIIFSNPAEGRNLDDEKMSSLSPCLESSQDGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINNRFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISDFGIPKLIYVATSDSTLSTTLLNGREEIPQSLISIKLVFRTSVQEKVELWLGHINTRIIIIRTEISDGEFTLSAITSLPLQVSTSQPRSRQQNLVRELCSSGCPASESIDDRTLLDNMYLKSKNKSLSQNKSKNFCLVHKFQGLFFDICYLMSELLLTTKYIIPQSPETLKSLENYIVSSISVIQTNIFQFSHLASVNFSFDLSSRTGFIPFRPLWKIRSLQILSQNPKNSSVVTSSDYKFAITILLLSLLCFYRWHI 472          
The following BLAST results are available for this feature:
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RGMB3.438e-1327.62repulsive guidance molecule BMP co-receptor b [Sou... [more]
RGMB7.764e-1327.62repulsive guidance molecule BMP co-receptor b [Sou... [more]
RGMA3.050e-927.06repulsive guidance molecule BMP co-receptor a [Sou... [more]
RGMA3.050e-927.06repulsive guidance molecule BMP co-receptor a [Sou... [more]
RGMA3.050e-927.06repulsive guidance molecule BMP co-receptor a [Sou... [more]
back to top
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
drag-16.410e-724.66RGM domain family member drag-1 [Source:UniProtKB... [more]
back to top
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgmb4.868e-1230.12repulsive guidance molecule BMP co-receptor b [Sou... [more]
rgma1.700e-1024.32repulsive guidance molecule BMP co-receptor a [Sou... [more]
rgma1.912e-1024.32repulsive guidance molecule BMP co-receptor a [Sou... [more]
rgma2.067e-1024.32repulsive guidance molecule BMP co-receptor a [Sou... [more]
rgmd9.154e-1036.90RGM domain family, member D [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aacs3.956e-1124.91acetoacetyl-CoA synthetase [Source:Xenbase;Acc:XB-... [more]
aacs9.135e-1124.91acetoacetyl-CoA synthetase [Source:Xenbase;Acc:XB-... [more]
bcas24.365e-1024.22breast carcinoma amplified sequence 2 [Source:Xenb... [more]
bcas24.987e-1024.22breast carcinoma amplified sequence 2 [Source:Xenb... [more]
HJV6.586e-938.27hemojuvelin BMP co-receptor [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rgmb9.654e-1426.04repulsive guidance molecule family member B [Sourc... [more]
Rgmb2.220e-1230.77repulsive guidance molecule family member B [Sourc... [more]
Hjv1.391e-930.36hemojuvelin BMP co-receptor [Source:MGI Symbol;Acc... [more]
Rgma1.822e-926.79repulsive guidance molecule family member A [Sourc... [more]
Rgma2.466e-926.79repulsive guidance molecule family member A [Sourc... [more]
back to top
BLAST of Repulsive guidance molecule BMP co-receptor b vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7TQ33|RGMB_MOUSE6.753e-1326.04RGM domain family member B OS=Mus musculus OX=1009... [more]
sp|Q6NW40|RGMB_HUMAN1.651e-1227.62RGM domain family member B OS=Homo sapiens OX=9606... [more]
sp|Q9N0A6|RGMA_MACFA3.255e-925.75Repulsive guidance molecule A OS=Macaca fascicular... [more]
sp|Q7TQ32|RGMC_MOUSE9.727e-930.36Hemojuvelin OS=Mus musculus OX=10090 GN=Hjv PE=1 S... [more]
sp|Q6PCX7|RGMA_MOUSE1.725e-826.79Repulsive guidance molecule A OS=Mus musculus OX=1... [more]
back to top
BLAST of Repulsive guidance molecule BMP co-receptor b vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B3T6U68.854e-1327.40Repulsive guidance molecule BMP co-receptor b OS=P... [more]
A0A3B3T7W51.206e-1227.40Repulsive guidance molecule BMP co-receptor b OS=P... [more]
A0A4W4FPZ22.308e-1228.87Uncharacterized protein OS=Electrophorus electricu... [more]
W5KME83.289e-1227.49Repulsive guidance molecule BMP co-receptor b OS=A... [more]
V4B4Y53.652e-1230.72Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
back to top
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgmb1.246e-1527.49repulsive guidance molecule BMP co-receptor b [Sou... [more]
rgmb2.346e-1527.76repulsive guidance molecule BMP co-receptor b [Sou... [more]
rgmd5.363e-1129.71RGM domain family member B-like [Source:NCBI gene;... [more]
rgmd6.927e-1129.71RGM domain family member B-like [Source:NCBI gene;... [more]
rgma5.217e-1025.52repulsive guidance molecule BMP co-receptor a [Sou... [more]
back to top
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000006652.15.454e-1032.94pep scaffold:Pmarinus_7.0:GL476710:41757:42613:-1 ... [more]
back to top
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO316352.711e-825.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgmb9.537e-1329.17repulsive guidance molecule BMP co-receptor b [Sou... [more]
rgmd1.180e-929.11repulsive guidance molecule A [Source:NCBI gene;Ac... [more]
rgma5.092e-925.43repulsive guidance molecule BMP co-receptor a [Sou... [more]
rgma8.070e-925.43repulsive guidance molecule BMP co-receptor a [Sou... [more]
hjv6.520e-733.33hemojuvelin [Source:NCBI gene;Acc:101171109][more]
back to top
BLAST of Repulsive guidance molecule BMP co-receptor b vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000033522.10.000e+099.79SMESG000033522.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019725 ID=SMED30019725|Name=Repulsive guidance molecule BMP co-receptor b|organism=Schmidtea mediterranea sexual|type=transcript|length=1634bp
CTAAATCCGCATAAATGTGAAAAAATTTATGTTATTTTTAACATATCTTT
TAAAAATTAGACGTATTCAAAATATATTCTTAACTTTTGTAGCATTTCAG
ATCTATATGGTTTCTTCAAAGTTATCTTTTAATGAAAATCCCTACGTGTT
GGGAGACAAAAAGTCGTTGAGAAATTCTATTAATAATGTTTCATGTGATA
AAATTCGTTCGCGTTGTGATAAGCTGTACGCACAATTGTCGACAACGGAA
GAGGATTGCCGTACATATCGGATTTATTTGGGTTGCTTGGAAATTTTGAG
GTCATCGAATTCTCATTGTCAAGCCAATCTTCAATTCTGGTTAATGTTAT
CAACTACAGAAAAGCTAATTAAAGAAAAGTGTTCCACGGGAGATACAACT
CCAATAGAGCCCCCTAGAGAGATTATATTTTCCAATCCTGCAGAGGGCCG
AAATTTAGATGACGAAAAAATGTCCAGTCTTTCACCATGCCTTGAATCTA
GTCAAGGTGGAGAACGTTCAAGAAATGGATATTATATTTGTTCGATATTT
GCTCATCCAAATCTGTTGTTATTTTCCGGTGAACGTCAAACATGCCGGTT
AGAGGGGTCATGGCCTCTGATAAATAATCGGTTTCTTACTATTCAAATAA
CAGGTCAAAAGTCAAACCCATTTCATTTCCAAGATTCGACCTTAACTAAA
ATAACTCAGATTAGTGTAGTTATTAAACCAGATGGAAAATGCATTAGTGA
TTTTGGTATTCCAAAATTAATTTATGTAGCCACATCAGATTCTACTTTAT
CAACAACTTTGCTAAATGGTCGTGAAGAAATTCCTCAGTCATTGATATCT
ATCAAATTAGTCTTTCGTACGAGTGTTCAAGAAAAAGTTGAACTATGGTT
AGGTCACATCAATACTCGCATAATAATAATTAGGACAGAAATATCCGATG
GAGAGTTTACGTTGTCTGCTATTACTTCACTTCCTCTCCAGGTCTCTACT
TCCCAGCCAAGATCTCGACAACAGAATTTAGTTCGTGAATTATGCTCTTC
CGGGTGCCCGGCTTCAGAGTCTATCGATGATAGGACGCTACTAGACAATA
TGTACCTCAAATCCAAAAACAAATCTTTATCTCAAAACAAATCGAAAAAC
TTCTGCTTAGTCCACAAATTTCAAGGGCTATTTTTTGATATTTGCTACTT
GATGTCGGAACTTTTGTTGACTACAAAATATATTATTCCACAATCACCAG
AAACTCTGAAATCTCTCGAAAATTATATTGTCAGTTCTATTTCAGTGATT
CAGACTAACATTTTCCAGTTTTCACATTTGGCCTCTGTGAATTTCAGTTT
TGATCTTTCATCAAGAACGGGATTCATTCCGTTTCGGCCGCTCTGGAAAA
TTCGCAGTCTCCAAATTCTCAGTCAAAATCCAAAGAATTCCTCAGTTGTA
ACATCTTCAGATTACAAATTCGCTATAACAATTCTACTGTTGAGTTTACT
TTGTTTTTACAGATGGCATATATAGATAAAAATTTCAGAAAATCCAACTT
GATTTCTGTTTATCGGAATTTTTTTTTCATTCTTTTTCTTCAATTTTTGT
GCAGCTATTGATGATGAGAAATATCTTTGTAAAC
back to top

protein sequence of SMED30019725-orf-1

>SMED30019725-orf-1 ID=SMED30019725-orf-1|Name=SMED30019725-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=499bp
MLFLTYLLKIRRIQNIFLTFVAFQIYMVSSKLSFNENPYVLGDKKSLRNS
INNVSCDKIRSRCDKLYAQLSTTEEDCRTYRIYLGCLEILRSSNSHCQAN
LQFWLMLSTTEKLIKEKCSTGDTTPIEPPREIIFSNPAEGRNLDDEKMSS
LSPCLESSQGGERSRNGYYICSIFAHPNLLLFSGERQTCRLEGSWPLINN
RFLTIQITGQKSNPFHFQDSTLTKITQISVVIKPDGKCISDFGIPKLIYV
ATSDSTLSTTLLNGREEIPQSLISIKLVFRTSVQEKVELWLGHINTRIII
IRTEISDGEFTLSAITSLPLQVSTSQPRSRQQNLVRELCSSGCPASESID
DRTLLDNMYLKSKNKSLSQNKSKNFCLVHKFQGLFFDICYLMSELLLTTK
YIIPQSPETLKSLENYIVSSISVIQTNIFQFSHLASVNFSFDLSSRTGFI
PFRPLWKIRSLQILSQNPKNSSVVTSSDYKFAITILLLSLLCFYRWHI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
GO:0010975regulation of neuron projection development
GO:0030509BMP signaling pathway
GO:0048681negative regulation of axon regeneration
Vocabulary: cellular component
TermDefinition
GO:0046658anchored component of plasma membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR016123Mog1/PsbP_a/b/a-sand
IPR040287RGM
IPR009496RGM_C
IPR010536RGM_N
Vocabulary: molecular function
TermDefinition
GO:0015026coreceptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009496Repulsive guidance molecule, C-terminalPFAMPF06534RGM_Ccoord: 247..390
e-value: 2.5E-9
score: 36.9
IPR010536Repulsive guidance molecule, N-terminalPFAMPF06535RGM_Ncoord: 70..233
e-value: 3.7E-23
score: 82.5
IPR016123Mog1/PsbP, alpha/beta/alpha sandwichGENE3DG3DSA:3.40.1000.10coord: 177..348
e-value: 2.2E-23
score: 84.5
IPR040287Repulsive guidance moleculePANTHERPTHR31428FAMILY NOT NAMEDcoord: 62..390
NoneNo IPR availablePANTHERPTHR31428:SF6RGM DOMAIN FAMILY MEMBER DRAG-1coord: 62..390