GTP-binding protein 1

Overview
NameGTP-binding protein 1
Smed IDSMED30019723
Length (bp)1888
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GTP-binding protein 1 (SMED30019723) t-SNE clustered cells

Violin plots show distribution of expression levels for GTP-binding protein 1 (SMED30019723) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GTP-binding protein 1 (SMED30019723) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GTP-binding protein 1 (SMED30019723) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019723

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30019723h1SMcG0004711 SmedASXL_015113SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30019723h1SMcG0004711 dd_Smed_v4_2780_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019723h1SMcG0004711 dd_Smed_v4_2780_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30019723h1SMcG0004711 dd_Smed_v4_2780_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30019723h1SMcG0004711 dd_Smed_v4_2780_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019723h1SMcG0004711 Contig19489newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019723h1SMcG0004711 Contig19489uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GTP-binding protein 1 vs. Ensembl Human
Match: GTPBP1 (GTP binding protein 1 [Source:HGNC Symbol;Acc:HGNC:4669])

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 337/537 (62.76%), Postives = 426/537 (79.33%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVP-GLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNK--AVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTKA 1735
            L+ K + V+P+ + Y+ +  +  +++++  G+  + +G+G +    GL++ ++E S   ++ + ++  A  + LR+     G+V +Y VRK     DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHE+ESGRTSSVGNDILGFD  G +VNK  +  G L+W KICEKS KVITFIDLAGHEKYLKTTVFGMTGH PDF MLM+G+NAGI+GMTKEHLGLALALNVPVFVVVTKIDMCP NI+QET+ L+ R+LKSPGCRKIPV+V ++DDVI +A+NF +ER+CPIF +SNV+G+N+DLL+ FLNLLSPRT+    EPAEFQIDD +SVPGVGTVVSGT L+G+I++ND LLLGPDPLGNF    VKSIHRKRMPV+EVRG Q+ASF+LKKIKR+ IRKGM+M+SP L+P++ WEF A++++LHHPTTIS +YQAMVH G +RQTATI+ M K  LRTGDKA V FRFIK PEY+    RLVFREG+TKAVGT+T++    N    N + + +K  +T K 
Sbjct:   61 LTSKLVLVSPTSEQYDSLLRQMWERMDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEIESGRTSSVGNDILGFDSEGNVVNKPDSHGGSLEWTKICEKSTKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQSKDDVIVTASNFSSERMCPIFQISNVTGENLDLLKMFLNLLSPRTSYREEEPAEFQIDDTYSVPGVGTVVSGTTLRGLIKLNDTLLLGPDPLGNFLSIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPRLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMDKDCLRTGDKATVHFRFIKTPEYLHIDQRLVFREGRTKAVGTITKLLQTTNNSPMNSKPQQIKMQSTKKG 597          
BLAST of GTP-binding protein 1 vs. Ensembl Human
Match: GTPBP2 (GTP binding protein 2 [Source:HGNC Symbol;Acc:HGNC:4670])

HSP 1 Score: 457.988 bits (1177), Expect = 6.632e-154
Identity = 249/529 (47.07%), Postives = 356/529 (67.30%), Query Frame = 2
Query:  116 KSEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEV-PGLTDLEIEESLKVIERLVDENSA--TFVKLRDIIYPDG---KVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFI-TERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEP-----AEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGM-SKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQV 1663
            ++E+  + +K   VNPS   +E +  + K +L++ +G+  +Q+G  +N +  GL + E+  SLK + R+ ++  A  T ++ R++ Y      K+ E  VRK+P+   F+D+RVAV+GNVD+GKSTLLGVLT G+LDNGRG AR+ LFRH HE++SGRTSS+  +ILGF+  G++VN +        +ICE S+K+ITFIDLAGH KYL TT+FG+T + PD A+L++ AN GI G T+EHLGLALAL VP F+VV+KID+C    ++ T+  + RVLK PGC K+P++VT+EDD + +A  F  +  V PIF +S+VSG+++DLL+ FLN+L P TN    E       EFQ+D+I++VP VGTVV GT   GI R  D L++GP   G F    V SI R R   R +R  Q+A+ +L    R  +RKGM+M+SP ++P     F A++++L H TT    +Q  VH+G VRQTA +  + +K  LRTG+KA V+FRF+K+PEY+K G +L+FREG TK +G VT V
Sbjct:   62 EAEDGNIEYKLKLVNPSQYRFEHLVTQMKWRLQEGRGEAVYQIGVEDNGLLVGLAEEEMRASLKTLHRMAEKVGADITVLREREVDYDSDMPRKITEVLVRKVPDNQQFLDLRVAVLGNVDSGKSTLLGVLTQGELDNGRGRARLNLFRHLHEIQSGRTSSISFEILGFNSKGEVVNYS--DSRTAEEICESSSKMITFIDLAGHHKYLHTTIFGLTSYCPDCALLLVSANTGIAGTTREHLGLALALKVPFFIVVSKIDLCAKTTVERTVRQLERVLKQPGCHKVPMLVTSEDDAVTAAQQFAQSPNVTPIFTLSSVSGESLDLLKVFLNILPPLTNSKEQEELMQQLTEFQVDEIYTVPEVGTVVGGTLSSGICREGDQLVVGPTDDGCFLELRVCSIQRNRSACRVLRAGQAATLALGDFDRALLRKGMVMVSPEMNPTICSVFEAEIVLLFHATTFRRGFQVTVHVGNVRQTAVVEKIHAKDKLRTGEKAVVRFRFLKHPEYLKVGAKLLFREGVTKGIGHVTDV 588          
BLAST of GTP-binding protein 1 vs. Ensembl Human
Match: GTPBP2 (GTP binding protein 2 [Source:HGNC Symbol;Acc:HGNC:4670])

HSP 1 Score: 446.817 bits (1148), Expect = 7.603e-151
Identity = 242/502 (48.21%), Postives = 341/502 (67.93%), Query Frame = 2
Query:  197 FKKQLEDSQGDFFFQLGKGENEV-PGLTDLEIEESLKVIERLVDENSA--TFVKLRDIIYPDG---KVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFI-TERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEP-----AEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGM-SKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQV 1663
             K +L++ +G+  +Q+G  +N +  GL + E+  SLK + R+ ++  A  T ++ R++ Y      K+ E  VRK+P+   F+D+RVAV+GNVD+GKSTLLGVLT G+LDNGRG AR+ LFRH HE++SGRTSS+  +ILGF+  G++VN +        +ICE S+K+ITFIDLAGH KYL TT+FG+T + PD A+L++ AN GI G T+EHLGLALAL VP F+VV+KID+C    ++ T+  + RVLK PGC K+P++VT+EDD + +A  F  +  V PIF +S+VSG+++DLL+ FLN+L P TN    E       EFQ+D+I++VP VGTVV GT   GI R  D L++GP   G F    V SI R R   R +R  Q+A+ +L    R  +RKGM+M+SP ++P     F A++++L H TT    +Q  VH+G VRQTA +  + +K  LRTG+KA V+FRF+K+PEY+K G +L+FREG TK +G VT V
Sbjct:    1 MKWRLQEGRGEAVYQIGVEDNGLLVGLAEEEMRASLKTLHRMAEKVGADITVLREREVDYDSDMPRKITEVLVRKVPDNQQFLDLRVAVLGNVDSGKSTLLGVLTQGELDNGRGRARLNLFRHLHEIQSGRTSSISFEILGFNSKGEVVNYS--DSRTAEEICESSSKMITFIDLAGHHKYLHTTIFGLTSYCPDCALLLVSANTGIAGTTREHLGLALALKVPFFIVVSKIDLCAKTTVERTVRQLERVLKQPGCHKVPMLVTSEDDAVTAAQQFAQSPNVTPIFTLSSVSGESLDLLKVFLNILPPLTNSKEQEELMQQLTEFQVDEIYTVPEVGTVVGGTLSSGICREGDQLVVGPTDDGCFLELRVCSIQRNRSACRVLRAGQAATLALGDFDRALLRKGMVMVSPEMNPTICSVFEAEIVLLFHATTFRRGFQVTVHVGNVRQTAVVEKIHAKDKLRTGEKAVVRFRFLKHPEYLKVGAKLLFREGVTKGIGHVTDV 500          
BLAST of GTP-binding protein 1 vs. Ensembl Human
Match: GTPBP2 (GTP binding protein 2 [Source:HGNC Symbol;Acc:HGNC:4670])

HSP 1 Score: 279.641 bits (714), Expect = 1.121e-88
Identity = 139/290 (47.93%), Postives = 203/290 (70.00%), Query Frame = 2
Query:  116 KSEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEV-PGLTDLEIEESLKVIERLVDENSA--TFVKLRDIIYPDG---KVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIV 967
            ++E+  + +K   VNPS   +E +  + K +L++ +G+  +Q+G  +N +  GL + E+  SLK + R+ ++  A  T ++ R++ Y      K+ E  VRK+P+   F+D+RVAV+GNVD+GKSTLLGVLT G+LDNGRG AR+ LFRH HE++SGRTSS+  +ILGF+  G++VN +        +ICE S+K+ITFIDLAGH KYL TT+FG+T + PD A+L++ AN GI G T+EHLGLALAL VP F+VV+KID+C    ++ T+  + RVLK PGC K+P++V
Sbjct:   28 QAEDGNIEYKLKLVNPSQYRFEHLVTQMKWRLQEGRGEAVYQIGVEDNGLLVGLAEEEMRASLKTLHRMAEKVGADITVLREREVDYDSDMPRKITEVLVRKVPDNQQFLDLRVAVLGNVDSGKSTLLGVLTQGELDNGRGRARLNLFRHLHEIQSGRTSSISFEILGFNSKGEVVNYS--DSRTAEEICESSSKMITFIDLAGHHKYLHTTIFGLTSYCPDCALLLVSANTGIAGTTREHLGLALALKVPFFIVVSKIDLCAKTTVERTVRQLERVLKQPGCHKVPMLV 315          
BLAST of GTP-binding protein 1 vs. Ensembl Human
Match: GTPBP1 (GTP binding protein 1 [Source:HGNC Symbol;Acc:HGNC:4669])

HSP 1 Score: 229.565 bits (584), Expect = 4.895e-69
Identity = 110/175 (62.86%), Postives = 136/175 (77.71%), Query Frame = 2
Query: 1211 VNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTKA 1735
            +ND LLLGPDPLGNF    VKSIHRKRMPV+EVRG Q+ASF+LKKIKR+ IRKGM+M+SP L+P++ WEF A++++LHHPTTIS +YQAMVH G +RQTATI+ M K  LRTGDKA V FRFIK PEY+    RLVFREG+TKAVGT+T++    N    N + + +K  +T K 
Sbjct:    1 LNDTLLLGPDPLGNFLSIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPRLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMDKDCLRTGDKATVHFRFIKTPEYLHIDQRLVFREGRTKAVGTITKLLQTTNNSPMNSKPQQIKMQSTKKG 175          
BLAST of GTP-binding protein 1 vs. Ensembl Celegans
Match: cgp-1 (GTP-binding protein cgp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q18905])

HSP 1 Score: 554.288 bits (1427), Expect = 0.000e+0
Identity = 288/531 (54.24%), Postives = 386/531 (72.69%), Query Frame = 2
Query:  170 DDYERISNEFKKQLEDSQGDFFFQLG-----KGENEVPGLTDLEIEESLKVIERLVDENSATFVK-LRDIIYPDGKVIE--YAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAV--HGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTK 1732
            +D E+     +KQL + +G+   +LG       +N   GL++ +++++     +++++  A   K +R      G +    + +R  P   DFI+ RVAVVGNVDAGKSTLLGVLTH  LD+GRGAAR KLFRHKHE ESGRTSSVGNDILGFDV+G IVNK    +  LDW +I    AK++TFIDLAGHEKYLKTT+FGMTGH PD+ MLMIGAN GIIG TKEHL LAL+L+VPV++VVTKIDMCP NI++ETM  +TR+++S   +K+P++V N DDV+ +A NF +++VCPIF VSNV G N+ LL++FLN++  R   N N+PA FQIDDI+ V GVGT+ SGT L G IR+ND+LLLGP   G+F P P+KSIHRKRMPV  V+  QSASF+LKKI +  +RKGM+++ P + P +   F A++++LHHPTTI   YQAM+HIG VRQTAT++ M K++LRTGD+ +V+F+FI+ PEYI+ G ++VFREG+TKAVGTV+ V P  +   Q  + ++ ++    K
Sbjct:   46 EDVEKYMIHVRKQLMEGEGECLVELGAPINSNSKNPKSGLSEEDLDKAADAQLKILEKIPAVGTKVIRRKQTGGGSLFTEVWIIRDPPTEKDFIEARVAVVGNVDAGKSTLLGVLTHSALDDGRGAARTKLFRHKHEFESGRTSSVGNDILGFDVHGNIVNKPDPHNHNLDWVQIGSDCAKLVTFIDLAGHEKYLKTTIFGMTGHMPDYTMLMIGANMGIIGTTKEHLSLALSLHVPVYLVVTKIDMCPANILEETMKNITRLVRS--AKKLPILVRNMDDVVHAAVNFPSKKVCPIFQVSNVEGTNLPLLRQFLNIVPLRRQLNENDPAHFQIDDIYWVDGVGTIASGTLLSGTIRLNDILLLGPTSNGDFMPIPIKSIHRKRMPVGIVKCGQSASFALKKIPKKDVRKGMVLVDPKVKPVASMVFEAEILVLHHPTTIKPNYQAMLHIGSVRQTATLVSMGKEVLRTGDRDKVQFKFIRQPEYIRPGTKMVFREGRTKAVGTVSSVVPQESLAQQRAKQKDGRQKQYGK 574          
BLAST of GTP-binding protein 1 vs. Ensembl Celegans
Match: cgp-1 (GTP-binding protein cgp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q18905])

HSP 1 Score: 554.288 bits (1427), Expect = 0.000e+0
Identity = 288/531 (54.24%), Postives = 386/531 (72.69%), Query Frame = 2
Query:  170 DDYERISNEFKKQLEDSQGDFFFQLG-----KGENEVPGLTDLEIEESLKVIERLVDENSATFVK-LRDIIYPDGKVIE--YAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAV--HGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTK 1732
            +D E+     +KQL + +G+   +LG       +N   GL++ +++++     +++++  A   K +R      G +    + +R  P   DFI+ RVAVVGNVDAGKSTLLGVLTH  LD+GRGAAR KLFRHKHE ESGRTSSVGNDILGFDV+G IVNK    +  LDW +I    AK++TFIDLAGHEKYLKTT+FGMTGH PD+ MLMIGAN GIIG TKEHL LAL+L+VPV++VVTKIDMCP NI++ETM  +TR+++S   +K+P++V N DDV+ +A NF +++VCPIF VSNV G N+ LL++FLN++  R   N N+PA FQIDDI+ V GVGT+ SGT L G IR+ND+LLLGP   G+F P P+KSIHRKRMPV  V+  QSASF+LKKI +  +RKGM+++ P + P +   F A++++LHHPTTI   YQAM+HIG VRQTAT++ M K++LRTGD+ +V+F+FI+ PEYI+ G ++VFREG+TKAVGTV+ V P  +   Q  + ++ ++    K
Sbjct:   46 EDVEKYMIHVRKQLMEGEGECLVELGAPINSNSKNPKSGLSEEDLDKAADAQLKILEKIPAVGTKVIRRKQTGGGSLFTEVWIIRDPPTEKDFIEARVAVVGNVDAGKSTLLGVLTHSALDDGRGAARTKLFRHKHEFESGRTSSVGNDILGFDVHGNIVNKPDPHNHNLDWVQIGSDCAKLVTFIDLAGHEKYLKTTIFGMTGHMPDYTMLMIGANMGIIGTTKEHLSLALSLHVPVYLVVTKIDMCPANILEETMKNITRLVRS--AKKLPILVRNMDDVVHAAVNFPSKKVCPIFQVSNVEGTNLPLLRQFLNIVPLRRQLNENDPAHFQIDDIYWVDGVGTIASGTLLSGTIRLNDILLLGPTSNGDFMPIPIKSIHRKRMPVGIVKCGQSASFALKKIPKKDVRKGMVLVDPKVKPVASMVFEAEILVLHHPTTIKPNYQAMLHIGSVRQTATLVSMGKEVLRTGDRDKVQFKFIRQPEYIRPGTKMVFREGRTKAVGTVSSVVPQESLAQQRAKQKDGRQKQYGK 574          
BLAST of GTP-binding protein 1 vs. Ensembl Celegans
Match: T04H1.2 (pep chromosome:WBcel235:V:12242318:12245059:-1 gene:WBGene00011449.1 transcript:T04H1.2.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T04H1.2)

HSP 1 Score: 306.605 bits (784), Expect = 5.138e-96
Identity = 193/526 (36.69%), Postives = 295/526 (56.08%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEV-PGLTDLEIEESLKVIERLVDENSATFVKL--RDIIYPDGK----VIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPN-----INEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTT-ISIKYQAMVHIGPVRQTATIIGM-SKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYP 1669
            + +K   VNP+    + +  + K +L + QG+  +++G  +  +  GLTD E+ +SL+ +  +     A+ V L  +D+          V+E  VRK+PE   FI++R+AVVG  D GKSTL GVLT G LD+G G AR+ +FR  HE+ +G+TSSV ND++GFD  G++VN A   Q    ++ EKS+K++T IDLAG  KY KTT+ G+TG+ P FA L++ A+ GI   T+EHLGL  ALN+P+FV++TK+D+     +++ +  ++ ++   G       V  + D + +A       + P+  VS+VSG+    L+  LN LS           +  PA F I+++++VP VG VV G   +G +     +L+GP   G F    V SI R R  V  V   ++AS SL       +R+GM++      P   +EF+A+L++L H T  I   +QA V IG V  TA I  +     +R G  A VK  F   PE I+ G  ++ R+GKTK +G V +V+P
Sbjct:   63 IEYKAKLVNPTTSRIQHLITQMKWRLREGQGEAIYEIGVEDGGIMSGLTDEELNDSLRTLRTMAQALGASMVILTEKDVTVKGSNSRRTVVEVLVRKVPESQQFIEVRLAVVGGCDVGKSTLCGVLTQGCLDDGNGKARIGIFRFPHEVRTGKTSSVCNDVIGFDNRGKLVNYA---QNSLEEMVEKSSKLVTLIDLAGDAKYQKTTIHGLTGYTPHFACLVVAADRGITWATREHLGLIAALNIPMFVLITKMDLVDRQGLKKIIKDVSNLVAKAGMTAREKRVKTKRDAVKAAQELCVGSIVPVLAVSSVSGEGFRCLRTLLNCLSTAGTAESRIQLVGLPAFFTIEELYNVPHVGQVVGGMLSEGQLHEGADVLVGPMKDGTFEKITVGSIRRSRQAVGCVNPGEAASISLNLPDGVSLRRGMVLAEIDHQPPVCYEFTANLLLLCHSTKYICEGFQATVFIGSVCTTAIITHIDDADCIRPGKWAVVKMCFAYQPEVIREGSPIILRQGKTKGMGEVLKVFP 585          
BLAST of GTP-binding protein 1 vs. Ensembl Celegans
Match: T04H1.2 (pep chromosome:WBcel235:V:12241962:12245044:-1 gene:WBGene00011449.1 transcript:T04H1.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T04H1.2)

HSP 1 Score: 306.605 bits (784), Expect = 5.138e-96
Identity = 193/526 (36.69%), Postives = 295/526 (56.08%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEV-PGLTDLEIEESLKVIERLVDENSATFVKL--RDIIYPDGK----VIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPN-----INEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTT-ISIKYQAMVHIGPVRQTATIIGM-SKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYP 1669
            + +K   VNP+    + +  + K +L + QG+  +++G  +  +  GLTD E+ +SL+ +  +     A+ V L  +D+          V+E  VRK+PE   FI++R+AVVG  D GKSTL GVLT G LD+G G AR+ +FR  HE+ +G+TSSV ND++GFD  G++VN A   Q    ++ EKS+K++T IDLAG  KY KTT+ G+TG+ P FA L++ A+ GI   T+EHLGL  ALN+P+FV++TK+D+     +++ +  ++ ++   G       V  + D + +A       + P+  VS+VSG+    L+  LN LS           +  PA F I+++++VP VG VV G   +G +     +L+GP   G F    V SI R R  V  V   ++AS SL       +R+GM++      P   +EF+A+L++L H T  I   +QA V IG V  TA I  +     +R G  A VK  F   PE I+ G  ++ R+GKTK +G V +V+P
Sbjct:   63 IEYKAKLVNPTTSRIQHLITQMKWRLREGQGEAIYEIGVEDGGIMSGLTDEELNDSLRTLRTMAQALGASMVILTEKDVTVKGSNSRRTVVEVLVRKVPESQQFIEVRLAVVGGCDVGKSTLCGVLTQGCLDDGNGKARIGIFRFPHEVRTGKTSSVCNDVIGFDNRGKLVNYA---QNSLEEMVEKSSKLVTLIDLAGDAKYQKTTIHGLTGYTPHFACLVVAADRGITWATREHLGLIAALNIPMFVLITKMDLVDRQGLKKIIKDVSNLVAKAGMTAREKRVKTKRDAVKAAQELCVGSIVPVLAVSSVSGEGFRCLRTLLNCLSTAGTAESRIQLVGLPAFFTIEELYNVPHVGQVVGGMLSEGQLHEGADVLVGPMKDGTFEKITVGSIRRSRQAVGCVNPGEAASISLNLPDGVSLRRGMVLAEIDHQPPVCYEFTANLLLLCHSTKYICEGFQATVFIGSVCTTAIITHIDDADCIRPGKWAVVKMCFAYQPEVIREGSPIILRQGKTKGMGEVLKVFP 585          
BLAST of GTP-binding protein 1 vs. Ensembl Celegans
Match: cgp-1 (GTP-binding protein cgp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q18905])

HSP 1 Score: 179.874 bits (455), Expect = 1.106e-52
Identity = 82/158 (51.90%), Postives = 117/158 (74.05%), Query Frame = 2
Query: 1259 PHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTK 1732
            P P+KSIHRKRMPV  V+  QSASF+LKKI +  +RKGM+++ P + P +   F A++++LHHPTTI   YQAM+HIG VRQTAT++ M K++LRTGD+ +V+F+FI+ PEYI+ G ++VFREG+TKAVGTV+ V P  +   Q  + ++ ++    K
Sbjct:    2 PIPIKSIHRKRMPVGIVKCGQSASFALKKIPKKDVRKGMVLVDPKVKPVASMVFEAEILVLHHPTTIKPNYQAMLHIGSVRQTATLVSMGKEVLRTGDRDKVQFKFIRQPEYIRPGTKMVFREGRTKAVGTVSSVVPQESLAQQRAKQKDGRQKQYGK 159          
BLAST of GTP-binding protein 1 vs. Ensembl Fly
Match: Dgp-1 (gene:FBgn0027836 transcript:FBtr0086773)

HSP 1 Score: 652.129 bits (1681), Expect = 0.000e+0
Identity = 329/525 (62.67%), Postives = 408/525 (77.71%), Query Frame = 2
Query:  104 MEIDKSEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEV-PGLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHA 1675
            M +D S  R    K++ V P+ +  E +    + ++ D+ G+  +++G GE+    GL   + E S+  +  L     A  VKLR+     G+  ++ +RK  +  DF++IRVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR +LFRHKHE+ESGRTSSVGNDILGFD  G +VNK  HG LDW KICE SAKVITFIDLAGHE+YLKTTVFGMTGHAPDF MLMIGANAGIIGMTKEHLGLALAL VPVFVVVTKIDMCP N++QE M L+ ++LKS GCRK+PV+V + DDV+ SATNF++ER+CPIF VSNV+G N++LL+ FLNLLS R   + + PAEFQIDD+++VPGVGTVVSGTCL+G IR+ND L+LGPD +G+F P  +KSIHRKRM V  VR  Q+ASF+LKKIKR  +RKGM+M+S  L P++ WEF  ++++LHHPTTIS +YQAMVH G +RQTA+II MS+  LRTGDKA VKFRFIK PEYI++G RLVFREG+TKAVG + +  P+A
Sbjct:   37 MSVDYSSIR---GKDVLVQPTEEQIELLQKRLQDRIADNCGETIYEIGVGEDGSDSGLNPEQFEASVATLHLLAANIDADVVKLRERRAEKGQSAQFLIRKHIDTTDFMEIRVAVVGNVDAGKSTLLGVLTHGELDNGRGHARQRLFRHKHEIESGRTSSVGNDILGFDGVGNVVNKPDHGHLDWVKICENSAKVITFIDLAGHERYLKTTVFGMTGHAPDFGMLMIGANAGIIGMTKEHLGLALALAVPVFVVVTKIDMCPANVLQENMKLLFKMLKSQGCRKVPVVVRSHDDVVLSATNFVSERLCPIFQVSNVTGDNLELLKMFLNLLSTRMPGSESLPAEFQIDDVYAVPGVGTVVSGTCLQGTIRLNDCLMLGPDAVGSFVPITIKSIHRKRMNVARVRCGQTASFALKKIKRAYLRKGMVMVSQDLKPQACWEFEGEILVLHHPTTISARYQAMVHCGSIRQTASIIHMSRDCLRTGDKAHVKFRFIKQPEYIRAGQRLVFREGRTKAVGNILRPLPNA 558          
BLAST of GTP-binding protein 1 vs. Ensembl Fly
Match: Dgp-1 (gene:FBgn0027836 transcript:FBtr0086774)

HSP 1 Score: 652.129 bits (1681), Expect = 0.000e+0
Identity = 329/525 (62.67%), Postives = 408/525 (77.71%), Query Frame = 2
Query:  104 MEIDKSEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEV-PGLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHA 1675
            M +D S  R    K++ V P+ +  E +    + ++ D+ G+  +++G GE+    GL   + E S+  +  L     A  VKLR+     G+  ++ +RK  +  DF++IRVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR +LFRHKHE+ESGRTSSVGNDILGFD  G +VNK  HG LDW KICE SAKVITFIDLAGHE+YLKTTVFGMTGHAPDF MLMIGANAGIIGMTKEHLGLALAL VPVFVVVTKIDMCP N++QE M L+ ++LKS GCRK+PV+V + DDV+ SATNF++ER+CPIF VSNV+G N++LL+ FLNLLS R   + + PAEFQIDD+++VPGVGTVVSGTCL+G IR+ND L+LGPD +G+F P  +KSIHRKRM V  VR  Q+ASF+LKKIKR  +RKGM+M+S  L P++ WEF  ++++LHHPTTIS +YQAMVH G +RQTA+II MS+  LRTGDKA VKFRFIK PEYI++G RLVFREG+TKAVG + +  P+A
Sbjct:   37 MSVDYSSIR---GKDVLVQPTEEQIELLQKRLQDRIADNCGETIYEIGVGEDGSDSGLNPEQFEASVATLHLLAANIDADVVKLRERRAEKGQSAQFLIRKHIDTTDFMEIRVAVVGNVDAGKSTLLGVLTHGELDNGRGHARQRLFRHKHEIESGRTSSVGNDILGFDGVGNVVNKPDHGHLDWVKICENSAKVITFIDLAGHERYLKTTVFGMTGHAPDFGMLMIGANAGIIGMTKEHLGLALALAVPVFVVVTKIDMCPANVLQENMKLLFKMLKSQGCRKVPVVVRSHDDVVLSATNFVSERLCPIFQVSNVTGDNLELLKMFLNLLSTRMPGSESLPAEFQIDDVYAVPGVGTVVSGTCLQGTIRLNDCLMLGPDAVGSFVPITIKSIHRKRMNVARVRCGQTASFALKKIKRAYLRKGMVMVSQDLKPQACWEFEGEILVLHHPTTISARYQAMVHCGSIRQTASIIHMSRDCLRTGDKAHVKFRFIKQPEYIRAGQRLVFREGRTKAVGNILRPLPNA 558          
BLAST of GTP-binding protein 1 vs. Ensembl Fly
Match: CG2017 (gene:FBgn0037391 transcript:FBtr0114518)

HSP 1 Score: 399.438 bits (1025), Expect = 2.072e-131
Identity = 219/526 (41.63%), Postives = 332/526 (63.12%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGE-NEVPGLTDLEIEESLKVIERLVDE-NSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPN-IMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPR-TNPNIN----EPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKR-NQIRKGMMML----SPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIG-MSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYP 1669
            + +K   VNPS   +E +  + K +L +  G+  +++G  +   + GL+D ++  SL  ++++     ++T V  R  I     V E  VRKIP+    I++RVAV+G  DAGKSTLLGVLT  +LDNG G AR+ +FRH HE++SGRTS + ++ LGFD  G +VN   +  +   +I ++S+K++TF+DLAGH +Y++TTV  ++G++P +AML++ A +G    T+EHL +  AL++P FV+VTK D+  P+  +QE  NL+T +    GCRK+P +VTN D+ I + +N I+E + PIFCVSNV+G  ++L+ KFL +LSP  +N   +    E  EFQ+D+IF V  VG VV G  ++G++  N  + +GP P G+F P  V +IHR + P R VR  QSAS S    +    +R GM++L    + + +P   + F A + +L H T I + +Q  VHIG +RQTA I G M  + L T D A V F F+ +PEY++ GMR++FREG +K +G VTQV+P
Sbjct:   76 VEYKLKLVNPSKQRFEHLVTQMKWRLREGNGEAIYEIGVSDAGYLQGLSDKDMNASLTTLKQMAHSLGASTSVLRRKTIAARRAVAEVLVRKIPDDQHNIEVRVAVLGGADAGKSTLLGVLTQDELDNGHGRARLNMFRHMHEIQSGRTSCISHETLGFDALGNVVNYKYNEMMTAEEISDRSSKLVTFMDLAGHRRYMRTTVQALSGYSPHYAMLVVSAGSGCNDTTEEHLAIVRALDMPFFVLVTKTDITSPDATVQELCNLLTTI----GCRKVPFVVTNTDEAISAGSNQISENIVPIFCVSNVTGTGLNLVTKFLYVLSPGISNAEKDRLEQESCEFQVDEIFRVSDVGPVVGGLLVQGVLTENMAMKIGPLPDGSFHPVTVNTIHRNKAPCRVVRAGQSASLSFSMDQDVPTLRSGMVLLGDIGNSLDEPYGTFFFQAKVSVLFHATAIYVGFQTTVHIGSIRQTAVIRGIMGGERLGTNDCASVMFEFVGHPEYVRPGMRILFREGTSKGIGVVTQVFP 597          
BLAST of GTP-binding protein 1 vs. Ensembl Fly
Match: CG2017 (gene:FBgn0037391 transcript:FBtr0078663)

HSP 1 Score: 399.438 bits (1025), Expect = 2.072e-131
Identity = 219/526 (41.63%), Postives = 332/526 (63.12%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGE-NEVPGLTDLEIEESLKVIERLVDE-NSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPN-IMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPR-TNPNIN----EPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKR-NQIRKGMMML----SPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIG-MSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYP 1669
            + +K   VNPS   +E +  + K +L +  G+  +++G  +   + GL+D ++  SL  ++++     ++T V  R  I     V E  VRKIP+    I++RVAV+G  DAGKSTLLGVLT  +LDNG G AR+ +FRH HE++SGRTS + ++ LGFD  G +VN   +  +   +I ++S+K++TF+DLAGH +Y++TTV  ++G++P +AML++ A +G    T+EHL +  AL++P FV+VTK D+  P+  +QE  NL+T +    GCRK+P +VTN D+ I + +N I+E + PIFCVSNV+G  ++L+ KFL +LSP  +N   +    E  EFQ+D+IF V  VG VV G  ++G++  N  + +GP P G+F P  V +IHR + P R VR  QSAS S    +    +R GM++L    + + +P   + F A + +L H T I + +Q  VHIG +RQTA I G M  + L T D A V F F+ +PEY++ GMR++FREG +K +G VTQV+P
Sbjct:   76 VEYKLKLVNPSKQRFEHLVTQMKWRLREGNGEAIYEIGVSDAGYLQGLSDKDMNASLTTLKQMAHSLGASTSVLRRKTIAARRAVAEVLVRKIPDDQHNIEVRVAVLGGADAGKSTLLGVLTQDELDNGHGRARLNMFRHMHEIQSGRTSCISHETLGFDALGNVVNYKYNEMMTAEEISDRSSKLVTFMDLAGHRRYMRTTVQALSGYSPHYAMLVVSAGSGCNDTTEEHLAIVRALDMPFFVLVTKTDITSPDATVQELCNLLTTI----GCRKVPFVVTNTDEAISAGSNQISENIVPIFCVSNVTGTGLNLVTKFLYVLSPGISNAEKDRLEQESCEFQVDEIFRVSDVGPVVGGLLVQGVLTENMAMKIGPLPDGSFHPVTVNTIHRNKAPCRVVRAGQSASLSFSMDQDVPTLRSGMVLLGDIGNSLDEPYGTFFFQAKVSVLFHATAIYVGFQTTVHIGSIRQTAVIRGIMGGERLGTNDCASVMFEFVGHPEYVRPGMRILFREGTSKGIGVVTQVFP 597          
BLAST of GTP-binding protein 1 vs. Ensembl Fly
Match: CG2017 (gene:FBgn0037391 transcript:FBtr0078664)

HSP 1 Score: 399.438 bits (1025), Expect = 2.072e-131
Identity = 219/526 (41.63%), Postives = 332/526 (63.12%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGE-NEVPGLTDLEIEESLKVIERLVDE-NSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPN-IMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPR-TNPNIN----EPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKR-NQIRKGMMML----SPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIG-MSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYP 1669
            + +K   VNPS   +E +  + K +L +  G+  +++G  +   + GL+D ++  SL  ++++     ++T V  R  I     V E  VRKIP+    I++RVAV+G  DAGKSTLLGVLT  +LDNG G AR+ +FRH HE++SGRTS + ++ LGFD  G +VN   +  +   +I ++S+K++TF+DLAGH +Y++TTV  ++G++P +AML++ A +G    T+EHL +  AL++P FV+VTK D+  P+  +QE  NL+T +    GCRK+P +VTN D+ I + +N I+E + PIFCVSNV+G  ++L+ KFL +LSP  +N   +    E  EFQ+D+IF V  VG VV G  ++G++  N  + +GP P G+F P  V +IHR + P R VR  QSAS S    +    +R GM++L    + + +P   + F A + +L H T I + +Q  VHIG +RQTA I G M  + L T D A V F F+ +PEY++ GMR++FREG +K +G VTQV+P
Sbjct:   76 VEYKLKLVNPSKQRFEHLVTQMKWRLREGNGEAIYEIGVSDAGYLQGLSDKDMNASLTTLKQMAHSLGASTSVLRRKTIAARRAVAEVLVRKIPDDQHNIEVRVAVLGGADAGKSTLLGVLTQDELDNGHGRARLNMFRHMHEIQSGRTSCISHETLGFDALGNVVNYKYNEMMTAEEISDRSSKLVTFMDLAGHRRYMRTTVQALSGYSPHYAMLVVSAGSGCNDTTEEHLAIVRALDMPFFVLVTKTDITSPDATVQELCNLLTTI----GCRKVPFVVTNTDEAISAGSNQISENIVPIFCVSNVTGTGLNLVTKFLYVLSPGISNAEKDRLEQESCEFQVDEIFRVSDVGPVVGGLLVQGVLTENMAMKIGPLPDGSFHPVTVNTIHRNKAPCRVVRAGQSASLSFSMDQDVPTLRSGMVLLGDIGNSLDEPYGTFFFQAKVSVLFHATAIYVGFQTTVHIGSIRQTAVIRGIMGGERLGTNDCASVMFEFVGHPEYVRPGMRILFREGTSKGIGVVTQVFP 597          
BLAST of GTP-binding protein 1 vs. Ensembl Zebrafish
Match: gtpbp1l (GTP binding protein 1, like [Source:ZFIN;Acc:ZDB-GENE-041007-2])

HSP 1 Score: 683.33 bits (1762), Expect = 0.000e+0
Identity = 338/513 (65.89%), Postives = 423/513 (82.46%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVP-GLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNK--AVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQV 1663
            L+ K   V+P+ + Y+ +  + ++++E+  G+  + +G G +    GL + ++E S+  ++ L ++  A  + LR+ +   G+V +Y +R+     DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHEMESGRTSSVGNDILGFD  GQ+VNK  +  G LDW KICE+S+KVITFIDLAGHEKYLKTTVFGMTGH PDF MLM+G+NAGI+GMTKEHLGLALALNVPVFVVVTKIDMCP NI+QET+ L+ R+LKSPGCRKIPV+V N+DDVI +A+NF +ER+CPIF +SNV+G+N+DLL+ FLNLLSPRT+   +EP EFQIDD +SVPGVGTVVSGT L+G+IR+ND LLLGPDPLG F P  VKSIHRKRMPV+EVRG Q+ASFSLKKIKR+ IRKGM+M+SP L+P++ WEF A++++LHHPTTIS +YQAMVH G +RQTATIIGM+K+ LRTGDKA V FRFIK PEY+ S  RLVFREG+TKAVG++T++
Sbjct:   58 LTSKFALVSPTGEQYDCLQKQLRERIEEGCGETIYVIGMGTDGGDYGLDERDMEASVATVQSLCEQVEADLILLRERMETAGRVRDYLIRRRVGEADFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEMESGRTSSVGNDILGFDQEGQVVNKPDSHGGSLDWTKICERSSKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQNKDDVIVTASNFSSERMCPIFQISNVTGENMDLLKMFLNLLSPRTSYKDDEPPEFQIDDTYSVPGVGTVVSGTTLRGLIRLNDTLLLGPDPLGVFIPIAVKSIHRKRMPVKEVRGGQTASFSLKKIKRSSIRKGMVMVSPRLNPQACWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATIIGMNKECLRTGDKAAVHFRFIKTPEYLHSDQRLVFREGRTKAVGSITKL 570          
BLAST of GTP-binding protein 1 vs. Ensembl Zebrafish
Match: gtpbp1l (GTP binding protein 1, like [Source:ZFIN;Acc:ZDB-GENE-041007-2])

HSP 1 Score: 683.33 bits (1762), Expect = 0.000e+0
Identity = 338/513 (65.89%), Postives = 423/513 (82.46%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVP-GLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNK--AVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQV 1663
            L+ K   V+P+ + Y+ +  + ++++E+  G+  + +G G +    GL + ++E S+  ++ L ++  A  + LR+ +   G+V +Y +R+     DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHEMESGRTSSVGNDILGFD  GQ+VNK  +  G LDW KICE+S+KVITFIDLAGHEKYLKTTVFGMTGH PDF MLM+G+NAGI+GMTKEHLGLALALNVPVFVVVTKIDMCP NI+QET+ L+ R+LKSPGCRKIPV+V N+DDVI +A+NF +ER+CPIF +SNV+G+N+DLL+ FLNLLSPRT+   +EP EFQIDD +SVPGVGTVVSGT L+G+IR+ND LLLGPDPLG F P  VKSIHRKRMPV+EVRG Q+ASFSLKKIKR+ IRKGM+M+SP L+P++ WEF A++++LHHPTTIS +YQAMVH G +RQTATIIGM+K+ LRTGDKA V FRFIK PEY+ S  RLVFREG+TKAVG++T++
Sbjct:   58 LTSKFALVSPTGEQYDCLQKQLRERIEEGCGETIYVIGMGTDGGDYGLDERDMEASVATVQSLCEQVEADLILLRERMETAGRVRDYLIRRRVGEADFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEMESGRTSSVGNDILGFDQEGQVVNKPDSHGGSLDWTKICERSSKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQNKDDVIVTASNFSSERMCPIFQISNVTGENMDLLKMFLNLLSPRTSYKDDEPPEFQIDDTYSVPGVGTVVSGTTLRGLIRLNDTLLLGPDPLGVFIPIAVKSIHRKRMPVKEVRGGQTASFSLKKIKRSSIRKGMVMVSPRLNPQACWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATIIGMNKECLRTGDKAAVHFRFIKTPEYLHSDQRLVFREGRTKAVGSITKL 570          
BLAST of GTP-binding protein 1 vs. Ensembl Zebrafish
Match: gtpbp1 (GTP binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-030909-12])

HSP 1 Score: 670.618 bits (1729), Expect = 0.000e+0
Identity = 336/536 (62.69%), Postives = 425/536 (79.29%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVP-GLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNK--AVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTK 1732
             S K   V+P+ + Y+ +  + ++++++  G+  + LG G +    GL + +++ S+  +  + ++  A  + LR+     G+V +Y +R+     DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHEMESGRTSSVGNDILGFD  GQ+VNK  +  G LDW KICEKS+KVITFIDLAGHEKYLKTTVFGMTGH PDF MLMIG+NAGI+GMTKEHLGLALALNVPVFVVVTKIDMCP NI+QET+ L+ ++LKSPGCRKIPV+V N+DDVI +A+NF +ER+CPIF +SNV+G+N+DLL+ FLNLLS R++   +EPAEFQIDD +SVPGVGTVVSGT L+G+IR+ND LLLGPDPLG F    VKSIHRKRMPV+EVRG Q+ASF+LKKIKR+ IRKGM+M+SP L+P++ WEF A++++LHHPTTIS +YQAMVH G +RQTATI+ M++  LRTGDKA V FRFIK PEY+ +  RLVFREG+TKAVGT+T++    N    N +   +K  +T K
Sbjct:   60 FSSKLALVSPNGEQYDLLLRQLRERMDEGCGETIYVLGVGSDGGDYGLNESDMQASVATVRSMCEQIEADLILLRERTEAGGQVRDYLIRRRVGEADFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEMESGRTSSVGNDILGFDQEGQVVNKPDSHGGSLDWTKICEKSSKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMIGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQKILKSPGCRKIPVLVQNKDDVIVTASNFSSERICPIFQISNVTGENMDLLKMFLNLLSSRSSFKDHEPAEFQIDDTYSVPGVGTVVSGTTLRGLIRLNDTLLLGPDPLGAFLSITVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPRLNPQAYWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMTRDCLRTGDKATVHFRFIKTPEYLHTDQRLVFREGRTKAVGTITKLLLSTNNQPSNSKPPQIKMQSTKK 595          
BLAST of GTP-binding protein 1 vs. Ensembl Zebrafish
Match: gtpbp2b (GTP binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-050208-373])

HSP 1 Score: 473.396 bits (1217), Expect = 4.572e-161
Identity = 251/532 (47.18%), Postives = 361/532 (67.86%), Query Frame = 2
Query:  119 SEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEV-PGLTDLEIEESLKVIERLVDENSATFVKLR----DIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFI-TERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEP-----AEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATI-IGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHAN 1678
            +EE  + +K   VNP+   +E ++ + K +L++ +G+  +Q+G  +N +  GLT+ +++ SLK + R+ ++  A    LR    D      K+ E  VRK+P+   F+D+RVAV+GNVD+GKSTLLGVLT G+LDNGRG AR+ LFRH HE+++GRTSS+  +ILGF+  G++VN +     +  +ICE S+K+ITFIDLAGH KYLKTT+FG+T + PDFAML++GAN GI G T+EHLGLA+AL VP+F+VV+K+D+C  + +++T+  + RVLK PGC KIP++V N DD + +A  F  +  V PIF +S+VSG+N+DLL+ F N+L P +N    E       EFQ+D+I+SVP VGTVV GT   G+ R  D L++GP   G F    V SIHR R   R +R  Q+A+ +L    R+ +RKGM+M+SP ++P   W+F A +++L H  T    +Q  VHIG VRQTAT+   + K+ LRTG++A V FRF+K+PEY++ G +L+FREG TK +G VT    HA 
Sbjct:    1 AEEGNIEYKLKLVNPTQYRFEHLATQLKWRLQEGRGEAVYQIGVEDNGLLVGLTEEDMKASLKTLRRMAEKVGADITLLREREVDCDRARRKIAEVLVRKVPDDQQFLDLRVAVLGNVDSGKSTLLGVLTQGELDNGRGRARLNLFRHLHEIQTGRTSSISFEILGFNSKGEVVNYSDSRTAE--EICESSSKMITFIDLAGHYKYLKTTIFGLTSYCPDFAMLVVGANTGIAGTTREHLGLAMALKVPIFIVVSKVDLCGKSTVEKTVRQLERVLKQPGCNKIPMVVANPDDAVTAAQQFAQSSSVTPIFTLSSVSGENLDLLKVFFNILPPLSNSKEQEELMQQLTEFQVDEIYSVPDVGTVVGGTLYSGVCREGDRLVVGPTDDGKFLRLKVCSIHRNRSGCRVLRAGQAATLALGNFDRSLLRKGMVMVSPKMNPTICWQFEAAIVLLFHAKTFRRGFQVTVHIGNVRQTATVECLLGKEELRTGERAVVCFRFLKHPEYLRVGAKLLFREGVTKGIGHVTIRLGHAQ 530          
BLAST of GTP-binding protein 1 vs. Ensembl Zebrafish
Match: gtpbp2b (GTP binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-050208-373])

HSP 1 Score: 473.396 bits (1217), Expect = 5.065e-161
Identity = 250/529 (47.26%), Postives = 361/529 (68.24%), Query Frame = 2
Query:  119 SEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEV-PGLTDLEIEESLKVIERLVDENSATFVKLR----DIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFI-TERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEP-----AEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATI-IGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYP 1669
            +EE  + +K   VNP+   +E ++ + K +L++ +G+  +Q+G  +N +  GLT+ +++ SLK + R+ ++  A    LR    D      K+ E  VRK+P+   F+D+RVAV+GNVD+GKSTLLGVLT G+LDNGRG AR+ LFRH HE+++GRTSS+  +ILGF+  G++VN +     +  +ICE S+K+ITFIDLAGH KYLKTT+FG+T + PDFAML++GAN GI G T+EHLGLA+AL VP+F+VV+K+D+C  + +++T+  + RVLK PGC KIP++V N DD + +A  F  +  V PIF +S+VSG+N+DLL+ F N+L P +N    E       EFQ+D+I+SVP VGTVV GT   G+ R  D L++GP   G F    V SIHR R   R +R  Q+A+ +L    R+ +RKGM+M+SP ++P   W+F A +++L H  T    +Q  VHIG VRQTAT+   + K+ LRTG++A V FRF+K+PEY++ G +L+FREG TK +G VT + P
Sbjct:    1 AEEGNIEYKLKLVNPTQYRFEHLATQLKWRLQEGRGEAVYQIGVEDNGLLVGLTEEDMKASLKTLRRMAEKVGADITLLREREVDCDRARRKIAEVLVRKVPDDQQFLDLRVAVLGNVDSGKSTLLGVLTQGELDNGRGRARLNLFRHLHEIQTGRTSSISFEILGFNSKGEVVNYSDSRTAE--EICESSSKMITFIDLAGHYKYLKTTIFGLTSYCPDFAMLVVGANTGIAGTTREHLGLAMALKVPIFIVVSKVDLCGKSTVEKTVRQLERVLKQPGCNKIPMVVANPDDAVTAAQQFAQSSSVTPIFTLSSVSGENLDLLKVFFNILPPLSNSKEQEELMQQLTEFQVDEIYSVPDVGTVVGGTLYSGVCREGDRLVVGPTDDGKFLRLKVCSIHRNRSGCRVLRAGQAATLALGNFDRSLLRKGMVMVSPKMNPTICWQFEAAIVLLFHAKTFRRGFQVTVHIGNVRQTATVECLLGKEELRTGERAVVCFRFLKHPEYLRVGAKLLFREGVTKGIGHVTHLLP 527          
BLAST of GTP-binding protein 1 vs. Ensembl Xenopus
Match: chat (choline O-acetyltransferase [Source:Xenbase;Acc:XB-GENE-984174])

HSP 1 Score: 651.744 bits (1680), Expect = 0.000e+0
Identity = 338/537 (62.94%), Postives = 434/537 (80.82%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVP-GLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNK--AVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTKA 1735
            L+ K + V+PS + Y+ +  + + ++++ +G+  + +G+G +    GL + ++E S+  +  + ++  A  + LR+     GKV +Y VRK     DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHE+ESGRTSSVGNDILGFD +GQ+VNK  +  G L+W KICEKS+K+ITFIDLAGHEKYLKTTVFGMTGH PDF MLM+G+NAGI+GMTKEHLGLALALNVPVFVVVTKIDMCP NI+QET+ L+ R+LKSPGCRKIPV+V N+DDVI +A+NF +ER+CPIF +SNV+G+N++LL+ FLNLLSPR++    EPAEFQIDD +SVPGVGTVVSGT L+G+I++ND+LLLGPDPLGNF+   VKSIHRKRMPV+EVRG Q+ASF+LKKIKR+ IRKGM+M+SP L+P++ WEF A++++LHHPTTIS +YQAMVH G +RQTATI+ MS+  LRTGDKA V FRFIK PEY+    RLVFREG+TKAVGT+T++    N +  N + + +K  +T K+
Sbjct:   50 LTSKLVLVSPSAEQYDSLLRQLRDRMDEGRGETIYVIGQGSDGTEYGLNEADMEASVATVTSMAEQIIADMILLREHQEAGGKVRDYLVRKSVGDNDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEIESGRTSSVGNDILGFDSHGQVVNKPDSHGGSLEWTKICEKSSKIITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQNKDDVIVTASNFSSERMCPIFQISNVTGENMELLKMFLNLLSPRSSSREEEPAEFQIDDTYSVPGVGTVVSGTTLRGLIKLNDLLLLGPDPLGNFTSIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPRLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMSRDCLRTGDKATVHFRFIKTPEYLHIDQRLVFREGRTKAVGTITKLLQSTNNLPMNSKPQQVKMQSTKKS 586          
BLAST of GTP-binding protein 1 vs. Ensembl Xenopus
Match: chat (choline O-acetyltransferase [Source:Xenbase;Acc:XB-GENE-984174])

HSP 1 Score: 651.744 bits (1680), Expect = 0.000e+0
Identity = 338/537 (62.94%), Postives = 434/537 (80.82%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVP-GLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNK--AVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTKA 1735
            L+ K + V+PS + Y+ +  + + ++++ +G+  + +G+G +    GL + ++E S+  +  + ++  A  + LR+     GKV +Y VRK     DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHE+ESGRTSSVGNDILGFD +GQ+VNK  +  G L+W KICEKS+K+ITFIDLAGHEKYLKTTVFGMTGH PDF MLM+G+NAGI+GMTKEHLGLALALNVPVFVVVTKIDMCP NI+QET+ L+ R+LKSPGCRKIPV+V N+DDVI +A+NF +ER+CPIF +SNV+G+N++LL+ FLNLLSPR++    EPAEFQIDD +SVPGVGTVVSGT L+G+I++ND+LLLGPDPLGNF+   VKSIHRKRMPV+EVRG Q+ASF+LKKIKR+ IRKGM+M+SP L+P++ WEF A++++LHHPTTIS +YQAMVH G +RQTATI+ MS+  LRTGDKA V FRFIK PEY+    RLVFREG+TKAVGT+T++    N +  N + + +K  +T K+
Sbjct:   45 LTSKLVLVSPSAEQYDSLLRQLRDRMDEGRGETIYVIGQGSDGTEYGLNEADMEASVATVTSMAEQIIADMILLREHQEAGGKVRDYLVRKSVGDNDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEIESGRTSSVGNDILGFDSHGQVVNKPDSHGGSLEWTKICEKSSKIITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQNKDDVIVTASNFSSERMCPIFQISNVTGENMELLKMFLNLLSPRSSSREEEPAEFQIDDTYSVPGVGTVVSGTTLRGLIKLNDLLLLGPDPLGNFTSIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPRLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMSRDCLRTGDKATVHFRFIKTPEYLHIDQRLVFREGRTKAVGTITKLLQSTNNLPMNSKPQQVKMQSTKKS 581          
BLAST of GTP-binding protein 1 vs. Ensembl Xenopus
Match: chat (choline O-acetyltransferase [Source:Xenbase;Acc:XB-GENE-984174])

HSP 1 Score: 651.744 bits (1680), Expect = 0.000e+0
Identity = 338/537 (62.94%), Postives = 434/537 (80.82%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVP-GLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNK--AVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTKA 1735
            L+ K + V+PS + Y+ +  + + ++++ +G+  + +G+G +    GL + ++E S+  +  + ++  A  + LR+     GKV +Y VRK     DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHE+ESGRTSSVGNDILGFD +GQ+VNK  +  G L+W KICEKS+K+ITFIDLAGHEKYLKTTVFGMTGH PDF MLM+G+NAGI+GMTKEHLGLALALNVPVFVVVTKIDMCP NI+QET+ L+ R+LKSPGCRKIPV+V N+DDVI +A+NF +ER+CPIF +SNV+G+N++LL+ FLNLLSPR++    EPAEFQIDD +SVPGVGTVVSGT L+G+I++ND+LLLGPDPLGNF+   VKSIHRKRMPV+EVRG Q+ASF+LKKIKR+ IRKGM+M+SP L+P++ WEF A++++LHHPTTIS +YQAMVH G +RQTATI+ MS+  LRTGDKA V FRFIK PEY+    RLVFREG+TKAVGT+T++    N +  N + + +K  +T K+
Sbjct:   50 LTSKLVLVSPSAEQYDSLLRQLRDRMDEGRGETIYVIGQGSDGTEYGLNEADMEASVATVTSMAEQIIADMILLREHQEAGGKVRDYLVRKSVGDNDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEIESGRTSSVGNDILGFDSHGQVVNKPDSHGGSLEWTKICEKSSKIITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQNKDDVIVTASNFSSERMCPIFQISNVTGENMELLKMFLNLLSPRSSSREEEPAEFQIDDTYSVPGVGTVVSGTTLRGLIKLNDLLLLGPDPLGNFTSIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPRLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMSRDCLRTGDKATVHFRFIKTPEYLHIDQRLVFREGRTKAVGTITKLLQSTNNLPMNSKPQQVKMQSTKKS 586          
BLAST of GTP-binding protein 1 vs. Ensembl Xenopus
Match: chat (choline O-acetyltransferase [Source:Xenbase;Acc:XB-GENE-984174])

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 338/537 (62.94%), Postives = 434/537 (80.82%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVP-GLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNK--AVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTKA 1735
            L+ K + V+PS + Y+ +  + + ++++ +G+  + +G+G +    GL + ++E S+  +  + ++  A  + LR+     GKV +Y VRK     DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHE+ESGRTSSVGNDILGFD +GQ+VNK  +  G L+W KICEKS+K+ITFIDLAGHEKYLKTTVFGMTGH PDF MLM+G+NAGI+GMTKEHLGLALALNVPVFVVVTKIDMCP NI+QET+ L+ R+LKSPGCRKIPV+V N+DDVI +A+NF +ER+CPIF +SNV+G+N++LL+ FLNLLSPR++    EPAEFQIDD +SVPGVGTVVSGT L+G+I++ND+LLLGPDPLGNF+   VKSIHRKRMPV+EVRG Q+ASF+LKKIKR+ IRKGM+M+SP L+P++ WEF A++++LHHPTTIS +YQAMVH G +RQTATI+ MS+  LRTGDKA V FRFIK PEY+    RLVFREG+TKAVGT+T++    N +  N + + +K  +T K+
Sbjct:   63 LTSKLVLVSPSAEQYDSLLRQLRDRMDEGRGETIYVIGQGSDGTEYGLNEADMEASVATVTSMAEQIIADMILLREHQEAGGKVRDYLVRKSVGDNDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEIESGRTSSVGNDILGFDSHGQVVNKPDSHGGSLEWTKICEKSSKIITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQNKDDVIVTASNFSSERMCPIFQISNVTGENMELLKMFLNLLSPRSSSREEEPAEFQIDDTYSVPGVGTVVSGTTLRGLIKLNDLLLLGPDPLGNFTSIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPRLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMSRDCLRTGDKATVHFRFIKTPEYLHIDQRLVFREGRTKAVGTITKLLQSTNNLPMNSKPQQVKMQSTKKS 599          
BLAST of GTP-binding protein 1 vs. Ensembl Xenopus
Match: chat (choline O-acetyltransferase [Source:Xenbase;Acc:XB-GENE-984174])

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 338/537 (62.94%), Postives = 434/537 (80.82%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVP-GLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNK--AVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTKA 1735
            L+ K + V+PS + Y+ +  + + ++++ +G+  + +G+G +    GL + ++E S+  +  + ++  A  + LR+     GKV +Y VRK     DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHE+ESGRTSSVGNDILGFD +GQ+VNK  +  G L+W KICEKS+K+ITFIDLAGHEKYLKTTVFGMTGH PDF MLM+G+NAGI+GMTKEHLGLALALNVPVFVVVTKIDMCP NI+QET+ L+ R+LKSPGCRKIPV+V N+DDVI +A+NF +ER+CPIF +SNV+G+N++LL+ FLNLLSPR++    EPAEFQIDD +SVPGVGTVVSGT L+G+I++ND+LLLGPDPLGNF+   VKSIHRKRMPV+EVRG Q+ASF+LKKIKR+ IRKGM+M+SP L+P++ WEF A++++LHHPTTIS +YQAMVH G +RQTATI+ MS+  LRTGDKA V FRFIK PEY+    RLVFREG+TKAVGT+T++    N +  N + + +K  +T K+
Sbjct:   63 LTSKLVLVSPSAEQYDSLLRQLRDRMDEGRGETIYVIGQGSDGTEYGLNEADMEASVATVTSMAEQIIADMILLREHQEAGGKVRDYLVRKSVGDNDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEIESGRTSSVGNDILGFDSHGQVVNKPDSHGGSLEWTKICEKSSKIITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQNKDDVIVTASNFSSERMCPIFQISNVTGENMELLKMFLNLLSPRSSSREEEPAEFQIDDTYSVPGVGTVVSGTTLRGLIKLNDLLLLGPDPLGNFTSIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPRLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMSRDCLRTGDKATVHFRFIKTPEYLHIDQRLVFREGRTKAVGTITKLLQSTNNLPMNSKPQQVKMQSTKKS 599          
BLAST of GTP-binding protein 1 vs. Ensembl Mouse
Match: Gtpbp1 (GTP binding protein 1 [Source:MGI Symbol;Acc:MGI:109443])

HSP 1 Score: 674.855 bits (1740), Expect = 0.000e+0
Identity = 337/537 (62.76%), Postives = 427/537 (79.52%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVP-GLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNK--AVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTKA 1735
            L+ K + V+P+ + Y+ +  +  +++++  G+  + +G+G +    GL++ ++E S   ++ + ++  A  + LR+     G+V +Y VRK     DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHE+ESGRTSSVGNDILGFD  G +VNK  +  G L+W KICEKS+KVITFIDLAGHEKYLKTTVFGMTGH PDF MLM+G+NAGI+GMTKEHLGLALALNVPVFVVVTKIDMCP NI+QET+ L+ R+LKSPGCRKIPV+V ++DDVI +A+NF +ER+CPIF +SNV+G+N+DLL+ FLNLLSPRT+    EPAEFQIDD +SVPGVGTVVSGT L+G+I++ND LLLGPDPLGNF    VKSIHRKRMPV+EVRG Q+ASF+LKKIKR+ IRKGM+M+SP L+P++ WEF A++++LHHPTTIS +YQAMVH G +RQTATI+ M K  LRTGDKA V FRFIK PEY+    RLVFREG+TKAVGT+T++    N    N + + +K  +T K 
Sbjct:   61 LTSKLVLVSPTSEQYDSLLRQMWERMDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEIESGRTSSVGNDILGFDSEGNVVNKPDSHGGSLEWTKICEKSSKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQSKDDVIVTASNFSSERMCPIFQISNVTGENLDLLKMFLNLLSPRTSYREEEPAEFQIDDTYSVPGVGTVVSGTTLRGLIKLNDTLLLGPDPLGNFLSIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPRLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMDKDCLRTGDKATVHFRFIKTPEYLHIDQRLVFREGRTKAVGTITKLLQTTNNSPMNSKPQQIKMQSTKKG 597          
BLAST of GTP-binding protein 1 vs. Ensembl Mouse
Match: Gtpbp2 (GTP binding protein 2 [Source:MGI Symbol;Acc:MGI:1860138])

HSP 1 Score: 457.218 bits (1175), Expect = 7.406e-154
Identity = 248/529 (46.88%), Postives = 356/529 (67.30%), Query Frame = 2
Query:  116 KSEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEV-PGLTDLEIEESLKVIERLVDENSA--TFVKLRDIIYPDG---KVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFI-TERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEP-----AEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGM-SKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQV 1663
            ++E+  + +K   VNPS   +E +  + K +L++ +G+  +Q+G  +N +  GL + E+  SLK + R+ ++  A  T ++ R++ Y      K+ E  VRK+P+   F+D+RVAV+GNVD+GKSTLLGVLT G+LDNGRG AR+ LFRH HE++SGRTSS+  +ILGF+  G++VN +        +ICE S+K+ITFIDLAGH KYL TT+FG+T + PD A+L++ AN GI G T+EHLGLALAL VP F+VV+K+D+C    ++ T+  + RVLK PGC K+P++VT+EDD + +A  F  +  V PIF +S+VSG+++DLL+ FLN+L P TN    E       EFQ+D+I++VP VGTVV GT   GI R  D L++GP   G F    V SI R R   R +R  Q+A+ +L    R  +RKGM+M+SP ++P     F A++++L H TT    +Q  VH+G VRQTA +  + +K  LRTG+KA V+FRF+K+PEY+K G +L+FREG TK +G VT V
Sbjct:   62 EAEDGNIEYKLKLVNPSQYRFEHLVTQMKWRLQEGRGEAVYQIGVEDNGLLVGLAEEEMRASLKTLHRMAEKVGADITVLREREVDYDSDVPRKITEVLVRKVPDNQQFLDLRVAVLGNVDSGKSTLLGVLTQGELDNGRGRARLNLFRHLHEIQSGRTSSISFEILGFNSKGEVVNYS--DSRTAEEICESSSKMITFIDLAGHHKYLHTTIFGLTSYCPDCALLLVSANTGIAGTTREHLGLALALKVPFFIVVSKVDLCAKTTVERTVRQLERVLKQPGCHKVPMLVTSEDDAVTAAQQFAQSPNVTPIFTLSSVSGESLDLLKVFLNILPPLTNSKEQEELMQQLTEFQVDEIYTVPEVGTVVGGTLSSGICREGDQLVVGPTDDGCFLELRVCSIQRNRSACRVLRAGQAATLALGDFDRALLRKGMVMVSPEMNPTICSVFEAEIVLLFHATTFRRGFQVTVHVGNVRQTAVVEKIHAKDKLRTGEKAVVRFRFLKHPEYLKVGAKLLFREGVTKGIGHVTDV 588          
BLAST of GTP-binding protein 1 vs. Ensembl Mouse
Match: Gtpbp2 (GTP binding protein 2 [Source:MGI Symbol;Acc:MGI:1860138])

HSP 1 Score: 412.535 bits (1059), Expect = 2.076e-136
Identity = 227/494 (45.95%), Postives = 329/494 (66.60%), Query Frame = 2
Query:  116 KSEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEV-PGLTDLEIEESLKVIERLVDENSA--TFVKLRDIIYPDG---KVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFI-TERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEP-----AEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGM-SKQLLRTGDKA 1558
            ++E+  + +K   VNPS   +E +  + K +L++ +G+  +Q+G  +N +  GL + E+  SLK + R+ ++  A  T ++ R++ Y      K+ E  VRK+P+   F+D+RVAV+GNVD+GKSTLLGVLT G+LDNGRG AR+ LFRH HE++SGRTSS+  +ILGF+  G++VN +     +  +ICE S+K+ITFIDLAGH KYL TT+FG+T + PD A+L++ AN GI G T+EHLGLALAL VP F+VV+K+D+C    ++ T+  + RVLK PGC K+P++VT+EDD + +A  F  +  V PIF +S+VSG+++DLL+ FLN+L P TN    E       EFQ+D+I++VP VGTVV GT   GI R  D L++GP   G F    V SI R R   R +R  Q+A+ +L    R  +RKGM+M+SP ++P     F A++++L H TT    +Q  VH+G VRQTA +  + +K  LRTG+KA
Sbjct:   62 EAEDGNIEYKLKLVNPSQYRFEHLVTQMKWRLQEGRGEAVYQIGVEDNGLLVGLAEEEMRASLKTLHRMAEKVGADITVLREREVDYDSDVPRKITEVLVRKVPDNQQFLDLRVAVLGNVDSGKSTLLGVLTQGELDNGRGRARLNLFRHLHEIQSGRTSSISFEILGFNSKGEVVNYSDSRTAE--EICESSSKMITFIDLAGHHKYLHTTIFGLTSYCPDCALLLVSANTGIAGTTREHLGLALALKVPFFIVVSKVDLCAKTTVERTVRQLERVLKQPGCHKVPMLVTSEDDAVTAAQQFAQSPNVTPIFTLSSVSGESLDLLKVFLNILPPLTNSKEQEELMQQLTEFQVDEIYTVPEVGTVVGGTLSSGICREGDQLVVGPTDDGCFLELRVCSIQRNRSACRVLRAGQAATLALGDFDRALLRKGMVMVSPEMNPTICSVFEAEIVLLFHATTFRRGFQVTVHVGNVRQTAVVEKIHAKDKLRTGEKA 553          
BLAST of GTP-binding protein 1 vs. Ensembl Mouse
Match: Gtpbp1 (GTP binding protein 1 [Source:MGI Symbol;Acc:MGI:109443])

HSP 1 Score: 172.555 bits (436), Expect = 1.477e-50
Identity = 81/107 (75.70%), Postives = 89/107 (83.18%), Query Frame = 2
Query:  641 GQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMT--RVLKSPGCRKI 955
            G L+W KICEKS+KVITFIDLAGHEKYLKTTVFGMTGH PDF MLM+G+NAGI+GMTKEHLGLALALNVPVFVVVTKIDMCP NI+Q  +   T   V  +P C  I
Sbjct:    6 GSLEWTKICEKSSKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQGIVAFNTGPSVCLTPACISI 112          
BLAST of GTP-binding protein 1 vs. Ensembl Mouse
Match: Gtpbp1 (GTP binding protein 1 [Source:MGI Symbol;Acc:MGI:109443])

HSP 1 Score: 174.481 bits (441), Expect = 2.232e-50
Identity = 79/117 (67.52%), Postives = 98/117 (83.76%), Query Frame = 2
Query: 1310 RGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQ 1660
            RG Q+ASF+LKKIKR+ IRKGM+M+SP L+P++ WEF A++++LHHPTTIS +YQAMVH G +RQTATI+ M K  LRTGDKA V FRFIK PEY+    RLVFREG+TKAVGT+T+
Sbjct:    2 RGGQTASFALKKIKRSSIRKGMVMVSPRLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMDKDCLRTGDKATVHFRFIKTPEYLHIDQRLVFREGRTKAVGTITK 118          
BLAST of GTP-binding protein 1 vs. UniProt/SwissProt
Match: sp|D2XV59|GTPB1_RAT (GTP-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gtpbp1 PE=1 SV=1)

HSP 1 Score: 675.241 bits (1741), Expect = 0.000e+0
Identity = 337/537 (62.76%), Postives = 427/537 (79.52%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVP-GLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNK--AVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTKA 1735
            L+ K + V+P+ + Y+ +  +  +++++  G+  + +G+G +    GL++ ++E S   ++ + ++  A  + LR+     G+V +Y VRK     DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHE+ESGRTSSVGNDILGFD  G +VNK  +  G L+W KICEKS+KVITFIDLAGHEKYLKTTVFGMTGH PDF MLM+G+NAGI+GMTKEHLGLALALNVPVFVVVTKIDMCP NI+QET+ L+ R+LKSPGCRKIPV+V ++DDVI +A+NF +ER+CPIF +SNV+G+N+DLL+ FLNLLSPRT+    EPAEFQIDD +SVPGVGTVVSGT L+G+I++ND LLLGPDPLGNF    VKSIHRKRMPV+EVRG Q+ASF+LKKIKR+ IRKGM+M+SP L+P++ WEF A++++LHHPTTIS +YQAMVH G +RQTATI+ M K  LRTGDKA V FRFIK PEY+    RLVFREG+TKAVGT+T++    N    N + + +K  +T K 
Sbjct:   61 LTSKLVLVSPTSEQYDSLLRQMWERMDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQESGGRVRDYLVRKRVGDNDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEIESGRTSSVGNDILGFDSEGNVVNKPDSHGGSLEWTKICEKSSKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQSKDDVIVTASNFSSERMCPIFQISNVTGENLDLLKMFLNLLSPRTSYREEEPAEFQIDDTYSVPGVGTVVSGTTLRGLIKLNDTLLLGPDPLGNFLSIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPRLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMDKDCLRTGDKATVHFRFIKTPEYLHIDQRLVFREGRTKAVGTITKLLQTTNNSPMNSKPQQIKMQSTKKG 597          
BLAST of GTP-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q58DC5|GTPB1_BOVIN (GTP-binding protein 1 OS=Bos taurus OX=9913 GN=GTPBP1 PE=2 SV=2)

HSP 1 Score: 675.241 bits (1741), Expect = 0.000e+0
Identity = 337/537 (62.76%), Postives = 426/537 (79.33%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVP-GLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNK--AVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTKA 1735
            L+ K + V+P+ + Y+ +  +  +++++  G+  + +G+G +    GL++ ++E S   ++ + ++  A  + LR+     G+V +Y VRK     DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHE+ESGRTSSVGNDILGFD  G +VNK  +  G L+W KICEKS KVITFIDLAGHEKYLKTTVFGMTGH PDF MLM+G+NAGI+GMTKEHLGLALALNVPVFVVVTKIDMCP NI+QET+ L+ R+LKSPGCRKIPV+V ++DDVI +A+NF +ER+CPIF +SNV+G+N+DLL+ FLNLLSPRT+    EPAEFQIDD +SVPGVGTVVSGT L+G+I++ND LLLGPDPLGNF    VKSIHRKRMPV+EVRG Q+ASF+LKKIKR+ IRKGM+M+SP L+P++ WEF A++++LHHPTTIS +YQAMVH G +RQTATI+ M K  LRTGDKA V FRFIK PEY+    RLVFREG+TKAVGT+T++    N    N + + +K  +T K 
Sbjct:   61 LTSKLVLVSPTSEQYDSLLRQMWERMDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEIESGRTSSVGNDILGFDSEGNVVNKPDSHGGSLEWTKICEKSTKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQSKDDVIVTASNFSSERMCPIFQISNVTGENLDLLKMFLNLLSPRTSYREEEPAEFQIDDTYSVPGVGTVVSGTTLRGLIKLNDTLLLGPDPLGNFLSIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPRLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMDKDCLRTGDKATVHFRFIKTPEYLHIDQRLVFREGRTKAVGTITKLLQTTNNSPMNSKPQQIKMQSTKKG 597          
BLAST of GTP-binding protein 1 vs. UniProt/SwissProt
Match: sp|O08582|GTPB1_MOUSE (GTP-binding protein 1 OS=Mus musculus OX=10090 GN=Gtpbp1 PE=1 SV=2)

HSP 1 Score: 674.855 bits (1740), Expect = 0.000e+0
Identity = 337/537 (62.76%), Postives = 427/537 (79.52%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVP-GLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNK--AVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTKA 1735
            L+ K + V+P+ + Y+ +  +  +++++  G+  + +G+G +    GL++ ++E S   ++ + ++  A  + LR+     G+V +Y VRK     DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHE+ESGRTSSVGNDILGFD  G +VNK  +  G L+W KICEKS+KVITFIDLAGHEKYLKTTVFGMTGH PDF MLM+G+NAGI+GMTKEHLGLALALNVPVFVVVTKIDMCP NI+QET+ L+ R+LKSPGCRKIPV+V ++DDVI +A+NF +ER+CPIF +SNV+G+N+DLL+ FLNLLSPRT+    EPAEFQIDD +SVPGVGTVVSGT L+G+I++ND LLLGPDPLGNF    VKSIHRKRMPV+EVRG Q+ASF+LKKIKR+ IRKGM+M+SP L+P++ WEF A++++LHHPTTIS +YQAMVH G +RQTATI+ M K  LRTGDKA V FRFIK PEY+    RLVFREG+TKAVGT+T++    N    N + + +K  +T K 
Sbjct:   61 LTSKLVLVSPTSEQYDSLLRQMWERMDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEIESGRTSSVGNDILGFDSEGNVVNKPDSHGGSLEWTKICEKSSKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQSKDDVIVTASNFSSERMCPIFQISNVTGENLDLLKMFLNLLSPRTSYREEEPAEFQIDDTYSVPGVGTVVSGTTLRGLIKLNDTLLLGPDPLGNFLSIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPRLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMDKDCLRTGDKATVHFRFIKTPEYLHIDQRLVFREGRTKAVGTITKLLQTTNNSPMNSKPQQIKMQSTKKG 597          
BLAST of GTP-binding protein 1 vs. UniProt/SwissProt
Match: sp|O00178|GTPB1_HUMAN (GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP1 PE=1 SV=3)

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 337/537 (62.76%), Postives = 426/537 (79.33%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVP-GLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNK--AVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTKA 1735
            L+ K + V+P+ + Y+ +  +  +++++  G+  + +G+G +    GL++ ++E S   ++ + ++  A  + LR+     G+V +Y VRK     DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHE+ESGRTSSVGNDILGFD  G +VNK  +  G L+W KICEKS KVITFIDLAGHEKYLKTTVFGMTGH PDF MLM+G+NAGI+GMTKEHLGLALALNVPVFVVVTKIDMCP NI+QET+ L+ R+LKSPGCRKIPV+V ++DDVI +A+NF +ER+CPIF +SNV+G+N+DLL+ FLNLLSPRT+    EPAEFQIDD +SVPGVGTVVSGT L+G+I++ND LLLGPDPLGNF    VKSIHRKRMPV+EVRG Q+ASF+LKKIKR+ IRKGM+M+SP L+P++ WEF A++++LHHPTTIS +YQAMVH G +RQTATI+ M K  LRTGDKA V FRFIK PEY+    RLVFREG+TKAVGT+T++    N    N + + +K  +T K 
Sbjct:   61 LTSKLVLVSPTSEQYDSLLRQMWERMDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEIESGRTSSVGNDILGFDSEGNVVNKPDSHGGSLEWTKICEKSTKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQSKDDVIVTASNFSSERMCPIFQISNVTGENLDLLKMFLNLLSPRTSYREEEPAEFQIDDTYSVPGVGTVVSGTTLRGLIKLNDTLLLGPDPLGNFLSIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPRLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMDKDCLRTGDKATVHFRFIKTPEYLHIDQRLVFREGRTKAVGTITKLLQTTNNSPMNSKPQQIKMQSTKKG 597          
BLAST of GTP-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q5R8Q7|GTPB1_PONAB (GTP-binding protein 1 (Fragment) OS=Pongo abelii OX=9601 GN=GTPBP1 PE=2 SV=2)

HSP 1 Score: 669.078 bits (1725), Expect = 0.000e+0
Identity = 335/530 (63.21%), Postives = 421/530 (79.43%), Query Frame = 2
Query:  155 VNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVP-GLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNK--AVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTKA 1735
            V+P+ + Y+ +  +  +++++  G   + +G+G +    GL++ ++E S   ++ + ++  A  + LR+     G+V +Y VRK     DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHE+ESGRTSSVGNDILGFD  G +VNK  +  G L+W KICEKS KVITFIDLAGHEKYLKTTVFGMTGH PDF MLM+G+NAGI+GMTKEHLGLALALNVPVFVVVTKIDMCP NI+QET+ L+ R+LKSPGCRKIPV+V ++DDVI +A+NF +ER+CPIF +SNV+G+N+DLL+ FLNLLSPRT+    EPAEFQIDD +SVPGVGTVVSGT L+G+I++ND LLLGPDPLGNF    VKSIHRKRMPV+EVRG Q+ASF+LKKIKR+ IRKGM+M+SP L+P++ WEF A++++LHHPTTIS +YQAMVH G +RQTATI+ M K  LRTGDKA V FRFIK PEY+    RLVFREG+TKAVGT+T++    N    N + + +K  +T K 
Sbjct:    1 VSPTSEQYDSLLRQMWERMDEGCGGTIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEIESGRTSSVGNDILGFDSEGNVVNKPDSHGGSLEWTKICEKSTKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQSKDDVIVTASNFSSERMCPIFQISNVTGENLDLLKMFLNLLSPRTSYREEEPAEFQIDDTYSVPGVGTVVSGTTLRGLIKLNDTLLLGPDPLGNFLSIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPRLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMDKDCLRTGDKATVHFRFIKTPEYLHIDQRLVFREGRTKAVGTITKLLQTTNNSPMNSKPQQIKMQSTKKG 530          
BLAST of GTP-binding protein 1 vs. TrEMBL
Match: K1QC10 (GTP-binding protein 1 OS=Crassostrea gigas OX=29159 GN=CGI_10025807 PE=4 SV=1)

HSP 1 Score: 735.717 bits (1898), Expect = 0.000e+0
Identity = 351/525 (66.86%), Postives = 435/525 (82.86%), Query Frame = 2
Query:  143 KNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVPGLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKK 1717
            K   ++P+ ++Y+ I +  K++L++ QG+  +++G GE + PGL+  +++ S+  ++ + D       +LR+    +G V E+ +R+  E  DF+++RVAVVGNVDAGKSTLLGVLTHGDLDNGRG AR +LFRHKHEMESGRTSSVGNDILGFD +G +VNK  HG LDW KICEKS+KVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAG+IGMTKEHLGLALALNVPVFVVVTKIDMCPPN++QET+ ++ R+LKSPGCRKIPVIV N DDV+CSATNF +ER+CPIF VSNVSG+N+DLL+ FLNLLS R       PAEFQIDD FSVPGVGTVVSGT L+G I++ND LLLGPD LG+F    VKSIHRKRMPVREV+G Q+ASFSLKK+KR+ IRKGM+M+SP L+PK+ WEF  ++++LHHPTTIS++YQAMVH+G VRQTATI+ M+K+ LRTGDK+ V+FRFIKNPEY+K+ MR+VFREG+TKA+G +T++YPH + VAQN R +   K
Sbjct:   30 KGHLISPNNEEYDIIVDMIKERLDEGQGETIYEVGTGEGDAPGLSQEDMQASIATLKSIADSLGLEMAQLRERKEGEGLVTEFLLRRSLEFDDFMEVRVAVVGNVDAGKSTLLGVLTHGDLDNGRGMARQRLFRHKHEMESGRTSSVGNDILGFDASGNVVNKPDHGNLDWIKICEKSSKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGVIGMTKEHLGLALALNVPVFVVVTKIDMCPPNVLQETLKMLQRILKSPGCRKIPVIVQNTDDVVCSATNFTSERMCPIFQVSNVSGENLDLLKMFLNLLSTRLKSETTAPAEFQIDDTFSVPGVGTVVSGTLLQGTIKLNDTLLLGPDALGHFQQITVKSIHRKRMPVREVKGGQTASFSLKKVKRSSIRKGMVMVSPKLEPKACWEFEGEILVLHHPTTISVRYQAMVHVGSVRQTATIMNMTKEHLRTGDKSIVRFRFIKNPEYLKTDMRMVFREGRTKAIGNITKLYPHVSAVAQNTRQQRAAK 554          
BLAST of GTP-binding protein 1 vs. TrEMBL
Match: A0A1I8HUC9 (Tr-type G domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 731.095 bits (1886), Expect = 0.000e+0
Identity = 357/530 (67.36%), Postives = 433/530 (81.70%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVPGLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDG--KVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKK 1717
            LS K  +V+PS  ++E++     K++     +   +LG GE E PGLT  E+  S+  ++ +  +  A    L+    P       +  +R+ P   DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHE ESGRTSSVGNDILGF+  G++VN   HGQLDW ++CE+SAKV+TFIDLAGHE+YLKTTVFGMTGH+PDFAMLMIG+NAG+IGMTKEHLGLALALNVPVFVVVTKIDMCPPN++ ET+ L+ ++L+S GCRKIPV+V   DDV+CSATNF +ER+CPIF VSNV+G+N+ LL +FLNLL+ RT+P + +PAEFQIDD FSVPGVGTVVSGTC KGIIRVNDVLLLGPDPLG F   P+KSIHRKR+PV EV GSQ+ASFSLKKIKR+QIRKGM+++SP+L+P + WEF AD++ILHHPTTIS++YQAMVH+GP+RQTATI+ MSK+ LRTGDKA V+FRFIKNPEYIK G RLVFREGKTKAVGTVT  +PH++CVAQN R RN KK
Sbjct: 1516 LSRKLAYVSPSHTEFEQLCVNLSKRMGQGVQEAIVELGSGEAEEPGLTADEMSASVATVQSMAVQLGADCSVLQRQQLPASGLHTAKLLIRRKPANGDFMEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEAESGRTSSVGNDILGFNSKGEVVNAPTHGQLDWQRVCERSAKVVTFIDLAGHERYLKTTVFGMTGHSPDFAMLMIGSNAGVIGMTKEHLGLALALNVPVFVVVTKIDMCPPNVLDETLRLLQKILRSSGCRKIPVMVNTPDDVVCSATNFTSERLCPIFRVSNVTGENLSLLTQFLNLLTSRTDPCLTQPAEFQIDDTFSVPGVGTVVSGTCNKGIIRVNDVLLLGPDPLGKFQSIPIKSIHRKRLPVMEVVGSQTASFSLKKIKRSQIRKGMVLVSPLLEPTACWEFEADVLILHHPTTISVRYQAMVHVGPIRQTATIVQMSKEHLRTGDKASVRFRFIKNPEYIKIGTRLVFREGKTKAVGTVTVAHPHSSCVAQNPRQRNGKK 2045          
BLAST of GTP-binding protein 1 vs. TrEMBL
Match: A0A267H1J7 (Tr-type G domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023442g1 PE=4 SV=1)

HSP 1 Score: 731.095 bits (1886), Expect = 0.000e+0
Identity = 357/530 (67.36%), Postives = 434/530 (81.89%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVPGLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKV--IEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKK 1717
            LS K  +V+PS  ++E++     K++     +   +LG GE E PGLT  E+  S+  ++ +  +  A    L+    P   +   +  +R+ P   DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHE ESGRTSSVGNDILGF+  G++VN   HGQLDW ++CE+SAKV+TFIDLAGHE+YLKTTVFGMTGH+PDFAMLMIG+NAG+IGMTKEHLGLALALNVPVFVVVTKIDMCPPN++ ET+ L+ ++L+S GCRKIPV+V   DDV+CSATNF +ER+CPIF VSNV+G+N+ LL +FLNLL+ RT+P + +PAEFQIDD FSVPGVGTVVSGTC KGIIRVNDVLLLGPDPLG F   P+KSIHRKR+PV EV GSQ+ASFSLKKIKR+QIRKGM+++SP+L+P + WEF AD++ILHHPTTIS++YQAMVH+GP+RQTATI+ MSK+ LRTGDKA V+FRFIKNPEYIK G RLVFREGKTKAVGTVT  +PH++CVAQN R RN KK
Sbjct:   28 LSRKLAYVSPSHTEFEQLCVNLSKRMGQGVQEAIVELGSGEAEEPGLTADEMSASVATVQSMAVQLGADCSVLQRQQLPASGLHTAKLLIRRKPANGDFMEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEAESGRTSSVGNDILGFNSKGEVVNAPTHGQLDWQRVCERSAKVVTFIDLAGHERYLKTTVFGMTGHSPDFAMLMIGSNAGVIGMTKEHLGLALALNVPVFVVVTKIDMCPPNVLDETLRLLQKILRSSGCRKIPVMVNTPDDVVCSATNFTSERLCPIFRVSNVTGENLSLLTQFLNLLTSRTDPCLTQPAEFQIDDTFSVPGVGTVVSGTCNKGIIRVNDVLLLGPDPLGKFQSIPIKSIHRKRLPVMEVVGSQTASFSLKKIKRSQIRKGMVLVSPLLEPTACWEFEADVLILHHPTTISVRYQAMVHVGPIRQTATIVQMSKEHLRTGDKASVRFRFIKNPEYIKIGTRLVFREGKTKAVGTVTVAHPHSSCVAQNPRQRNGKK 557          
BLAST of GTP-binding protein 1 vs. TrEMBL
Match: A0A2C9K6S5 (Tr-type G domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106053511 PE=4 SV=1)

HSP 1 Score: 730.324 bits (1884), Expect = 0.000e+0
Identity = 350/530 (66.04%), Postives = 437/530 (82.45%), Query Frame = 2
Query:  131 VLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVPGLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLR-HRNMKK 1717
             L+ K   V+P+ +++E +  + + ++ D+QG+  +++G GE + PGL D + + ++  ++ +        V LR+    +GKV E+ +RK  +  +F+++R+AVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHEMESGRTSSVGNDILGFD +G +VNK  HG LDW KICE +AKV+TFIDLAGHE+YLKTTVFGMTGHAPDFAMLMIGANAG+IGMTKEHLGLALALNVPVFVVVTKIDMCPPN++QET+ L+TR+LKSPGCRKIPV+V N DDV+ +ATNF +ER+CP+F VSNVSG+N+DLL+ FLNLLS R   + ++PAEFQIDD FSVPGVGTVVSGT L+G I++ND LLLGPD LG F P P+KSIHRKRMPVREVRG Q+ASF+LKKIKR  IRKGM+M+SP L+PK+ WEF  ++++LHHPTTIS++YQAMVH+G VRQTATII M++  LRTGDKA V+FRFIKNPEY+K+ MR+VFREG+TKAVG +T+++P  N VAQN R  R+ KK
Sbjct:   33 ALTSKMALVSPTNEEFEMLLEDIRTRIMDTQGETIYEIGTGEGDRPGLKDEDYQAAVATLQSISQTLDLVCVLLRERTAEEGKVAEFLLRKKLKQEEFMEVRIAVVGNVDAGKSTLLGVLTHGELDNGRGVARQKLFRHKHEMESGRTSSVGNDILGFDASGNVVNKPEHGHLDWIKICEDAAKVVTFIDLAGHERYLKTTVFGMTGHAPDFAMLMIGANAGVIGMTKEHLGLALALNVPVFVVVTKIDMCPPNVLQETLKLLTRILKSPGCRKIPVLVQNTDDVVVTATNFTSERMCPVFQVSNVSGENLDLLKMFLNLLSTRVKCDASQPAEFQIDDTFSVPGVGTVVSGTLLQGCIKLNDTLLLGPDALGQFQPVPIKSIHRKRMPVREVRGGQTASFALKKIKRASIRKGMVMVSPRLEPKACWEFEGEILVLHHPTTISVRYQAMVHVGSVRQTATIITMTEDHLRTGDKATVRFRFIKNPEYLKTDMRMVFREGRTKAVGNITKLFPQVNAVAQNTRNQRSAKK 562          
BLAST of GTP-binding protein 1 vs. TrEMBL
Match: A0A210QVJ7 (GTP-binding protein 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT06317 PE=4 SV=1)

HSP 1 Score: 727.628 bits (1877), Expect = 0.000e+0
Identity = 349/534 (65.36%), Postives = 443/534 (82.96%), Query Frame = 2
Query:  119 SEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVPGLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLR-HRNMKK 1717
            +E   LS K   V+P+ +++E +S   ++++ + QG+  +++G GE   PGL++ +++ S+  +  +    +   VKLR+    +G V+E+ +RK  E  DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR +LFRHKHEMESGRTSSVGNDILGFD  G++VNK  HG LDW KICEK++KV+TFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAG+IGMTKEHLGLALAL+VPVFVVVTKIDMCP N++QET+ ++ R+LKSPGCRKIPV+V N+DDV+CSATNF +ER+CPIF VSNVSG+N+DLL+ F+NLL+ R   +  EPAEFQIDD FSVPGVGTVVSGT L+G IR+ND +LLGPD LG+F P  +KSIHRKRM VREVRG Q+ASF+LKKIKR+ IRKGM+++SP L+PK+ WEF +++++LHHPTTIS++YQAMVH+G VRQTATII M+ + LRTGDKA V+FRFIKNPEY+K+ M++VFREG+TKA+G ++++YPH + VAQN R HR  KK
Sbjct:   28 AEMASLSLKTALVSPTSEEFEVLSETIQERIIEGQGETIYEIGTGEGGAPGLSEEDMQASIATLTSVAQPQNLEMVKLRERKEAEGIVVEFLLRKTLEPEDFMEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGMARQRLFRHKHEMESGRTSSVGNDILGFDSVGKVVNKPDHGHLDWVKICEKASKVVTFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGVIGMTKEHLGLALALSVPVFVVVTKIDMCPANVLQETLKMLQRILKSPGCRKIPVLVQNQDDVVCSATNFTSERMCPIFQVSNVSGENLDLLKMFMNLLTTRVKCHPTEPAEFQIDDTFSVPGVGTVVSGTLLQGQIRLNDTVLLGPDALGHFQPIIIKSIHRKRMAVREVRGGQTASFALKKIKRSSIRKGMVLISPRLEPKACWEFESEILVLHHPTTISVRYQAMVHVGSVRQTATIINMTSEHLRTGDKAIVRFRFIKNPEYLKTDMKMVFREGRTKAIGNISKLYPHVSAVAQNTRQHRAAKK 561          
BLAST of GTP-binding protein 1 vs. Ensembl Cavefish
Match: gtpbp1 (GTP binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-030909-12])

HSP 1 Score: 672.159 bits (1733), Expect = 0.000e+0
Identity = 337/536 (62.87%), Postives = 426/536 (79.48%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVP-GLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNK--AVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTK 1732
             S K   V+P+ + Y+ +  + ++++++  G+  + +G G +    GL + ++E S+  ++ L ++  A  + LR+     G+V +Y +R+     DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHEMESGRTSSVGNDILGFD  GQ+VNK  +  G LDW KICEKS+KVITFIDLAGHEKYLKTTVFGMTGH PDF MLM+G+NAGI+GMTKEHLGLALALNVPVFVVVTKIDMCP NI+QET+ L+ R+LKSPGCRKIPV+V N+DDVI +A+NF +ER+CPIF +SNV+G+N+DLL+ FLNLLS RT+   +EPAEFQIDD +SVPGVGTVVSGT L+G+IR+ND +LLGPDPLG F    VKSIHRKRMPV+EVRG Q+ASF+LKKIKR+ IRKGM+M+SP L+P++ WEF A++++LHHPTTIS +YQAMVH G +RQTATI+ M++  LRTGDKA V FRFIK PEY+ +  RLVFREG+TKAVGT+T++    N    N +   +K  +T K
Sbjct:   61 FSSKLALVSPNGEQYDSLLRQLRERMDEGCGETIYVVGVGSDGGDYGLNESDMEASVATVQSLCEQIEADLILLRERTESGGQVRDYLIRRRVGEADFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEMESGRTSSVGNDILGFDQEGQVVNKPDSHGGSLDWTKICEKSSKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQNKDDVIVTASNFSSERMCPIFQISNVTGENMDLLKMFLNLLSSRTSFKDDEPAEFQIDDTYSVPGVGTVVSGTTLRGLIRLNDTMLLGPDPLGAFISIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPRLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILTMNRDCLRTGDKATVHFRFIKTPEYLHTDQRLVFREGRTKAVGTITKLLQSTNNQPSNSKPPQIKMQSTKK 596          
BLAST of GTP-binding protein 1 vs. Ensembl Cavefish
Match: gtpbp1 (GTP binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-030909-12])

HSP 1 Score: 671.774 bits (1732), Expect = 0.000e+0
Identity = 337/536 (62.87%), Postives = 426/536 (79.48%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVP-GLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNK--AVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTK 1732
             S K   V+P+ + Y+ +  + ++++++  G+  + +G G +    GL + ++E S+  ++ L ++  A  + LR+     G+V +Y +R+     DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHEMESGRTSSVGNDILGFD  GQ+VNK  +  G LDW KICEKS+KVITFIDLAGHEKYLKTTVFGMTGH PDF MLM+G+NAGI+GMTKEHLGLALALNVPVFVVVTKIDMCP NI+QET+ L+ R+LKSPGCRKIPV+V N+DDVI +A+NF +ER+CPIF +SNV+G+N+DLL+ FLNLLS RT+   +EPAEFQIDD +SVPGVGTVVSGT L+G+IR+ND +LLGPDPLG F    VKSIHRKRMPV+EVRG Q+ASF+LKKIKR+ IRKGM+M+SP L+P++ WEF A++++LHHPTTIS +YQAMVH G +RQTATI+ M++  LRTGDKA V FRFIK PEY+ +  RLVFREG+TKAVGT+T++    N    N +   +K  +T K
Sbjct:   61 FSSKLALVSPNGEQYDSLLRQLRERMDEGCGETIYVVGVGSDGGDYGLNESDMEASVATVQSLCEQIEADLILLRERTESGGQVRDYLIRRRVGEADFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEMESGRTSSVGNDILGFDQEGQVVNKPDSHGGSLDWTKICEKSSKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQNKDDVIVTASNFSSERMCPIFQISNVTGENMDLLKMFLNLLSSRTSFKDDEPAEFQIDDTYSVPGVGTVVSGTTLRGLIRLNDTMLLGPDPLGAFISIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPRLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILTMNRDCLRTGDKATVHFRFIKTPEYLHTDQRLVFREGRTKAVGTITKLLQSTNNQPSNSKPPQIKMQSTKK 596          
BLAST of GTP-binding protein 1 vs. Ensembl Cavefish
Match: gtpbp1l (GTP-binding protein 1-like [Source:NCBI gene;Acc:103037942])

HSP 1 Score: 652.129 bits (1681), Expect = 0.000e+0
Identity = 326/522 (62.45%), Postives = 422/522 (80.84%), Query Frame = 2
Query:  113 DKSEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVP-GLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRK-IPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNK--AVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVY 1666
            + +++  L  K   V+P+ + Y+ +  + + + ++   +  + +G G +    GL + ++  S+  ++ L ++  A  V LR+     G+V +Y +R+ +PE  DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHE+ESGRTSSVGNDILGFD  G +VN+  +  G LDW +IC++S+KVITFIDLAGHEKYLKTTVFGMTGH PDF MLM+G+NAGIIGMTKEHLGLALAL+VPVFVVVTKIDMCP NI+QET+ L+ R+LKSPGCRKIPV+V N+DDVI +A+NF +ERVCPIF +SNV+G+N+DLL+ FLNLLS R++   +EPAEFQID+ +SVPGVGTVVSGT L+G I +ND LLLGPDPLG F P  VKSIHRKRMPV+EVRG Q+ASF+LKKIKR+ IRKGM+M+SP L+P++ WEF A++++LHHPTTIS +YQAMVH G +RQTA+I+ M+K+ LRTGDKA V+FRFIK PE++ +  RLVFREG+TKAVGT+T+++
Sbjct:   54 ESADQPGLCSKLALVSPTGEQYDCLLKDVQARTDEGSRETIYVVGVGSDGGNYGLDEKDMAASVATVQSLCEQIDADLVLLRERRESGGQVRDYLIRRRVPE-NDFMEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGLARQKLFRHKHELESGRTSSVGNDILGFDQQGVVVNQPDSHGGNLDWTRICQRSSKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIIGMTKEHLGLALALSVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQNKDDVIITASNFSSERVCPIFQISNVTGENMDLLKMFLNLLSSRSSFKDDEPAEFQIDETYSVPGVGTVVSGTTLRGWIHMNDTLLLGPDPLGVFLPITVKSIHRKRMPVKEVRGGQTASFALKKIKRSAIRKGMVMVSPQLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTASILSMNKECLRTGDKATVRFRFIKTPEFLHTEQRLVFREGRTKAVGTITKLF 574          
BLAST of GTP-binding protein 1 vs. Ensembl Cavefish
Match: gtpbp1l (GTP-binding protein 1-like [Source:NCBI gene;Acc:103037942])

HSP 1 Score: 650.203 bits (1676), Expect = 0.000e+0
Identity = 327/521 (62.76%), Postives = 421/521 (80.81%), Query Frame = 2
Query:  113 DKSEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVP-GLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRK-IPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNK--AVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQV 1663
            + +++  L  K   V+P+ + Y+ +  + + + ++   +  + +G G +    GL + ++  S+  ++ L ++  A  V LR+     G+V +Y +R+ +PE  DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHE+ESGRTSSVGNDILGFD  G +VN+  +  G LDW +IC++S+KVITFIDLAGHEKYLKTTVFGMTGH PDF MLM+G+NAGIIGMTKEHLGLALAL+VPVFVVVTKIDMCP NI+QET+ L+ R+LKSPGCRKIPV+V N+DDVI +A+NF +ERVCPIF +SNV+G+N+DLL+ FLNLLS R++   +EPAEFQID+ +SVPGVGTVVSGT L+G I +ND LLLGPDPLG F P  VKSIHRKRMPV+EVRG Q+ASF+LKKIKR+ IRKGM+M+SP L+P++ WEF A++++LHHPTTIS +YQAMVH G +RQTA+I+ M+K+ LRTGDKA V+FRFIK PE++ +  RLVFREG+TKAVGT+T+V
Sbjct:   56 ESADQPGLCSKLALVSPTGEQYDCLLKDVQARTDEGSRETIYVVGVGSDGGNYGLDEKDMAASVATVQSLCEQIDADLVLLRERRESGGQVRDYLIRRRVPE-NDFMEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGLARQKLFRHKHELESGRTSSVGNDILGFDQQGVVVNQPDSHGGNLDWTRICQRSSKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIIGMTKEHLGLALALSVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQNKDDVIITASNFSSERVCPIFQISNVTGENMDLLKMFLNLLSSRSSFKDDEPAEFQIDETYSVPGVGTVVSGTTLRGWIHMNDTLLLGPDPLGVFLPITVKSIHRKRMPVKEVRGGQTASFALKKIKRSAIRKGMVMVSPQLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTASILSMNKECLRTGDKATVRFRFIKTPEFLHTEQRLVFREGRTKAVGTITKV 575          
BLAST of GTP-binding protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000050613.1 (GTP binding protein 2 [Source:NCBI gene;Acc:103026583])

HSP 1 Score: 465.692 bits (1197), Expect = 3.164e-157
Identity = 240/529 (45.37%), Postives = 362/529 (68.43%), Query Frame = 2
Query:  122 EERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEV-PGLTDLEIEESLKVIERLVDENSA--TFVKLRDIIYPDG---KVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFI-TERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEP-----AEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMS-KQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYP 1669
            EE  + +K   VNP+   +E ++ + K +L++ +G+  +Q+G  +N +  GL++ ++  SL+ + R+ ++  A  T ++ R++ Y      K+ E  VRK+P+   F+D+RVAV+GNVD+GKSTLLGVLT G+LDNGRG AR+ LFRH HE+++GRTSS+  +ILGFD  G++VN +     +  +ICE ++K+ITFIDLAGH KYLKTT+FG+T + PDFAML++ AN GI+G T+EHLGLA+AL VP+F+VV+K+D+C    ++ T+  + R+LK PGC K+P++V++ DD + +A  F  +  + PIF +S+VSG+N++LL+ F N+L P +N    E       EFQ+D+I++VP VGTVV GT   GI R  + L++GP   G F    V SI R R   R +R  Q+A+ +L    R+ +RKGM+M+SP ++P   W F A++++L H  T    +Q  VH+G VRQTAT+  +  K+ LRTG+KA V+F+FIK+PEY+K G +L+FR G TK +G VT++ P
Sbjct:   68 EEGNVEYKLKLVNPTQYRFEHLATQMKWRLQEGRGEAIYQIGVEDNGLLVGLSEADMRASLRTLRRMAEKVGADITVLREREVEYDSDEMRKIAEVLVRKVPDDQQFLDLRVAVLGNVDSGKSTLLGVLTQGELDNGRGRARLNLFRHLHEIQTGRTSSISFEILGFDSKGEVVNYSESRTAE--EICESASKMITFIDLAGHHKYLKTTIFGLTSYCPDFAMLVVSANTGIVGTTREHLGLAMALKVPIFIVVSKVDLCTKATVERTVRQLERILKQPGCNKVPLVVSSTDDAVTAAQQFAQSPSITPIFTLSSVSGENLELLKVFFNILPPLSNSKEQEELMQQLTEFQVDEIYTVPDVGTVVGGTLYSGICREGEQLVVGPTDEGQFRELTVCSIQRNRSGCRVLRAGQAATLALGDFDRSLLRKGMVMVSPEMNPTICWMFEAEIVLLFHAKTFHKGFQVTVHVGNVRQTATVEALQGKEELRTGEKAVVRFKFIKHPEYLKVGAKLLFRHGVTKGIGQVTKLQP 594          
BLAST of GTP-binding protein 1 vs. Ensembl Sea Lamprey
Match: gtpbp2b (GTP binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-050208-373])

HSP 1 Score: 463.766 bits (1192), Expect = 6.434e-158
Identity = 245/533 (45.97%), Postives = 358/533 (67.17%), Query Frame = 2
Query:  116 KSEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGE-NEVPGLTDLEIEESLKVIERLVDENSA--TFVKLRDIIYPDG---KVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVC----PIFCVSNVSGKNIDLLQKFLNLLSPRTN-----PNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIG-MSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVY 1666
            ++EE  + +K   VNPS    E +  + K +L++ +G+  +Q+G  +   + GL+  E+  SLK + R+ D+  A  T ++ R++ + D     V E  +RK+P+   F+D+RVAV+GNVDAGKSTLLGVLT G+LDNGRG AR+ LFRH HE++SGRTSS+  +ILGF+  G++VN   +G     +ICE S+K+ITFIDLAGH KYL+TT+FG+T +APDFAML++GAN G++G  KEHLGLA+AL VP F+VV+K+D+C P  ++ T+  + R+L+SP C K+P++V   DD + +AT F     C    PIF VSNV+GKN+DLL+ FLN+L P++N       + + AEFQ+D+I++VP VGTVV GT   G+ R  D  ++GP   G F P  V +I R R P R +R  Q+A+ +L    R  +RKGM+++SP + P   W F A++++L H  T+   +Q  VH+  VRQTA +   + K+ +RTG+KA V  RFIK PEYI+ G +L+ REG T+ +G VT+++
Sbjct:    1 QAEEGNIEYKLKLVNPSQYRLEHLVTQMKWRLQEGRGEAIYQIGVEDCGLIAGLSLEEMRASLKTLRRMADKLGADLTILRERNVEFEDKCPKMVAEVLIRKVPDDQQFLDLRVAVLGNVDAGKSTLLGVLTQGELDNGRGRARLNLFRHLHEIQSGRTSSISFEILGFNSKGEVVN--YNGSRTAEEICESSSKMITFIDLAGHHKYLRTTIFGLTSYAPDFAMLVVGANTGLVGTAKEHLGLAMALKVPFFIVVSKVDVCSPGTVERTVRQLERLLRSPSCSKVPLLVCGPDDAMTAATKFPQCPQCSSITPIFTVSNVTGKNLDLLKTFLNVLPPQSNVQEQEQLMQQLAEFQVDEIYTVPEVGTVVGGTLYSGVCREGDGFVVGPTERGEFLPVAVATIQRNRAPSRVLRAGQAATLALGPFDRYLLRKGMVLVSPKMCPTVCWAFDAEIVLLFHAKTVRQGFQVTVHVSNVRQTAIVEDILDKENVRTGEKAVVTLRFIKQPEYIRLGAKLLIREGATRGMGHVTKLH 531          
BLAST of GTP-binding protein 1 vs. Ensembl Sea Lamprey
Match: gtpbp1 (GTP binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-030909-12])

HSP 1 Score: 351.288 bits (900), Expect = 2.927e-117
Identity = 178/280 (63.57%), Postives = 224/280 (80.00%), Query Frame = 2
Query:  902 ETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVT--QVYPHANCVAQNLRHRNMKKDNTTKA 1735
            +T+ L+ R+LKSPGCRKIPV+V   DDV+ +ATNF +ER+CPIF +SNVSG+N+DLL+ FLNLLS R   +  EPAEFQIDD +SVPGVGTVVSGT L+G+IR+ND LLLGPDPLG F+   VKSIHRKRMPVREVRG Q+ASF+LKKIKR  IRKGM+M+SP ++P++ WEF A++++LHHPTTIS +YQAMVH G +RQTATI+GMS+  LRTGDKA V FRFIK+PE++    RLVFREG+TKAVGT+T  Q+    N    N++ + +K   + K 
Sbjct:    1 DTLKLLQRLLKSPGCRKIPVLVQTRDDVVVTATNFTSERICPIFQISNVSGENLDLLKMFLNLLSARMGFSEAEPAEFQIDDTYSVPGVGTVVSGTVLRGLIRLNDTLLLGPDPLGAFTAIAVKSIHRKRMPVREVRGGQTASFALKKIKRAWIRKGMVMVSPRVNPQAYWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILGMSRDCLRTGDKANVHFRFIKSPEFLHPDTRLVFREGRTKAVGTITKRQLISSVNTAPTNMKTQQVKMQPSKKG 280          
BLAST of GTP-binding protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011427.1 (pep scaffold:Pmarinus_7.0:GL499053:103:1494:1 gene:ENSPMAG00000010399.1 transcript:ENSPMAT00000011427.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 2.018e-12
Identity = 99/429 (23.08%), Postives = 177/429 (41.26%), Query Frame = 2
Query:  431 IRVAVVGNVDAGKSTLLGVLTH--GDLDN-------------GRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGII-------GMTKEHLGLALALNVPVFVV-VTKIDMCPP--------NIMQETMNLMTRVLKSPGCRK-IPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNID----LLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPK-SVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSG 1606
            I + V+G+VD+GKST  G L +  G +D              G+G+ +      K + E  R  ++   +  F                     E     +T ID  GH  ++K  + G +    D A+L++ A  G         G T+EH  LA  L V   +V + K+D   P         I++E    + ++  +P     +P+   + D+++ ++TN       P F    V  K+ +     L + L+ + P + P  ++P    + D++ + G+GTV  G    G+++   V+   P  +       VKS+      + E     +  F++K +    +R+G +      DP      F+A +I+L+HP  I+  Y  +V       TA I     +L    D+   K +   NP+++KSG
Sbjct:    8 INIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKF---------------------ETQKYYVTIIDAPGHRDFIKNMITGTS--QADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPPYSSDRYNEIVKEVGTYIKKIGYNPAAVGFVPISGWHGDNMLEASTNM------PWFKGWKVERKDGNASGTTLLEALDAILPPSRPT-DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTT----EVKSVEMHHEALTEAVPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAGVFTAQVIVLNHPGQINAGYSPVVDC----HTAHIACKFAELKEKIDRRSGK-KLEDNPKFLKSG 397          
BLAST of GTP-binding protein 1 vs. Ensembl Sea Lamprey
Match: hbs1l (HBS1-like translational GTPase [Source:ZFIN;Acc:ZDB-GENE-030131-2987])

HSP 1 Score: 53.9138 bits (128), Expect = 8.936e-8
Identity = 76/298 (25.50%), Postives = 126/298 (42.28%), Query Frame = 2
Query:  431 IRVAVVGNVDAGKSTLLGVLTH--GDLDNGRGAARMKLFRHKHEMES---GRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGII-------GMTKEHLGLALALNVP-VFVVVTKIDM--CPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPN--------------INEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGP 1237
            I + V+G+VDAGKSTL+G L +  G+++        K   HK+E ES   G+ S     +L  D  G+   + V   +   K  E   K++T +D  GH+ ++   + G      D A+L++ +  G         G T+EH  L  +L V  + V + K+DM        +E  + + + LK  G +        E DV    T             S +SG+N+ +  K   L S  + P               +++P    + D+F   G G  V+G    G ++  D L++ P
Sbjct:  261 INLVVIGHVDAGKSTLMGHLLYLLGNVN--------KRAMHKYEQESKKAGKASFAYAWVL--DETGEERERGVTMDVGLTKF-ESKTKLVTLMDAPGHKDFIPNMITGAA--QADVALLVVDSITGEFEAGFEAGGQTREHALLVRSLGVTQLAVAINKMDMLNWSKERFEEITSKLGQFLKQAGFK--------ESDVTYIPT-------------SGLSGENLAMRSKDEKLTSWYSGPCLLDCIDSFRPPQRPVDKPCRLCVSDVFKDVGAGFSVAGKVEAGYVQTGDRLVVMP 524          
BLAST of GTP-binding protein 1 vs. Ensembl Yeast
Match: TEF1 (Translational elongation factor EF-1 alpha; in the GTP-bound active form, binds to and delivers aminoacylated tRNA to the A-site of ribosomes for elongation of nascent polypeptides; associates with vacuolar Rho1p GTPase; may also have a role in tRNA re-export from the nucleus; TEF1 has a paralog, TEF2, that arose from the whole genome duplication [Source:SGD;Acc:S000006284])

HSP 1 Score: 73.1738 bits (178), Expect = 3.907e-14
Identity = 105/423 (24.82%), Postives = 177/423 (41.84%), Query Frame = 2
Query:  431 IRVAVVGNVDAGKSTLLGVLTH--GDLDN-------------GRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGII-------GMTKEHLGLALALNV-PVFVVVTKIDMCPPN------IMQETMNLMTRVLKSPGCRK-IPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDP-KSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSG 1606
            I V V+G+VD+GKST  G L +  G +D              G+G+ +      K + E  R  ++   +  F                     E     +T ID  GH  ++K  + G +    D A+L+I    G         G T+EH  LA  L V  + V V K+D    +      I++ET N + +V  +P     +P+   N D++I + TN    +       + V  K   LL+    +  P + P  ++P    + D++ + G+GTV  G    G+I+   V+   P  +       VKS+      + +     +  F++K +   +IR+G +      DP K    F+A +I+L+HP  IS  Y  ++       TA I     +LL   D+   K +   +P+++KSG
Sbjct:    8 INVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKF---------------------ETPKYQVTVIDAPGHRDFIKNMITGTS--QADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVV-KGKTLLEAIDAIEQP-SRPT-DKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTT----EVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDC----HTAHIACRFDELLEKNDRRSGK-KLEDHPKFLKSG 395          
BLAST of GTP-binding protein 1 vs. Ensembl Yeast
Match: TEF2 (Translational elongation factor EF-1 alpha; in the GTP-bound active form, binds to and delivers aminoacylated tRNA to the A-site of ribosomes for elongation of nascent polypeptides; associates with vacuolar Rho1p GTPase; TEF2-RFP levels increase during replicative aging; may also have a role in tRNA re-export from the nucleus; TEF2 has a paralog, TEF1, that arose from the whole genome duplication [Source:SGD;Acc:S000000322])

HSP 1 Score: 73.1738 bits (178), Expect = 3.907e-14
Identity = 105/423 (24.82%), Postives = 177/423 (41.84%), Query Frame = 2
Query:  431 IRVAVVGNVDAGKSTLLGVLTH--GDLDN-------------GRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGII-------GMTKEHLGLALALNV-PVFVVVTKIDMCPPN------IMQETMNLMTRVLKSPGCRK-IPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDP-KSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSG 1606
            I V V+G+VD+GKST  G L +  G +D              G+G+ +      K + E  R  ++   +  F                     E     +T ID  GH  ++K  + G +    D A+L+I    G         G T+EH  LA  L V  + V V K+D    +      I++ET N + +V  +P     +P+   N D++I + TN    +       + V  K   LL+    +  P + P  ++P    + D++ + G+GTV  G    G+I+   V+   P  +       VKS+      + +     +  F++K +   +IR+G +      DP K    F+A +I+L+HP  IS  Y  ++       TA I     +LL   D+   K +   +P+++KSG
Sbjct:    8 INVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKF---------------------ETPKYQVTVIDAPGHRDFIKNMITGTS--QADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVV-KGKTLLEAIDAIEQP-SRPT-DKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTT----EVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDC----HTAHIACRFDELLEKNDRRSGK-KLEDHPKFLKSG 395          
BLAST of GTP-binding protein 1 vs. Ensembl Nematostella
Match: EDO38094 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDY7])

HSP 1 Score: 687.567 bits (1773), Expect = 0.000e+0
Identity = 345/530 (65.09%), Postives = 424/530 (80.00%), Query Frame = 2
Query:  152 FVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVPGLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKA-VHG-QLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHAN---CVAQNLRHRNMKKDNT 1726
             V+P    ++ + +  K++L    G+  +++G G+    GL   ++  S+  ++ L +  +A  + LR+     G V EY VR   +  DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR +LFRHKHEMESGRTSSVGNDILGFD  GQ+VNKA  HG  +DWAKIC++S+KVITFIDLAGHE+YLKTT+FGMTGH PDFAMLM+G+NAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPN++QETM L+ R+LKSPGCRKIPV+V N+DDV+ SATNFI+ERVCPIF VSNV+G+N+DLL+ FLNLLS R      EP+EFQIDD +SVPGVGTV+SGTC+KGIIR+ND LLLGPDPLG F P  ++SIHRKRMPV+EVRG Q+ASFSLKKIKR+QIRKGM+ML   L P++ WEF A+++ILHHPTTIS KYQAM+H GP+RQTATI+ MSK+ LRT DKA VKFRFIK PEY+K   R++FREG+TKAVGT+ ++ P A+    +A  L+HR   +  T
Sbjct:   59 LVSPDELGFDVLLSRLKQRLSIGHGETIYEVGVGDGTSSGLDPEDLHASVATLKTLAEACNADAMLLREKTAELGTVGEYLVRVRMDENDFMEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGTARQRLFRHKHEMESGRTSSVGNDILGFDNTGQVVNKAEQHGANVDWAKICKESSKVITFIDLAGHERYLKTTIFGMTGHVPDFAMLMVGSNAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNVLQETMKLLARILKSPGCRKIPVVVQNKDDVVVSATNFISERVCPIFQVSNVTGENLDLLKMFLNLLSVRVESKDEEPSEFQIDDTYSVPGVGTVISGTCMKGIIRLNDTLLLGPDPLGQFQPVAIRSIHRKRMPVKEVRGGQTASFSLKKIKRSQIRKGMVMLDKRLKPQACWEFEAEVLILHHPTTISCKYQAMIHCGPLRQTATIVEMSKEHLRTADKAVVKFRFIKQPEYLKPDSRMIFREGRTKAVGTILRIDPDAHPPPQIAGKLKHRGPGRHGT 588          
BLAST of GTP-binding protein 1 vs. Ensembl Nematostella
Match: EDO48451 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIS7])

HSP 1 Score: 434.491 bits (1116), Expect = 6.879e-147
Identity = 233/496 (46.98%), Postives = 337/496 (67.94%), Query Frame = 2
Query:  197 FKKQLEDSQGDFFFQLGKGENE-VPGLTDLEIEESLKVIERLVDENSATFVKLRDI-IYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPN-----INEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQV 1663
             K +L++ QG+  + +G  +N  + GL + E++ SL  +  +  +  AT   LR   +    KV+E  VR++P+   F DIR+AV+GNV++GKSTLLGVLT+ +LDNG+G AR+ LFRH HE++SGRTSS+ ++ILGF   G++VN +  G+     +CE+S+K+ITFIDLAGH KY+KTT+FG+TGH+PD+AML+I  NAGI+G TKEHLGLA+AL VP  +++TK D+C P ++Q T  L+ R+L+SP C K+P+ V  E+D   +A NF + +V PIF +S V+G+N+ LL+KFL +L P  +         E  +++ID+ F+VPG G VV GT   GI+   D L++GP   G+F    + S+ R R P R VR  QSAS +L  I+R+++R+GM+M  P L+P++   F AD+ +L HP  IS ++QA V+I  V Q A I  MSK  L+TG +A+V+FRF+K PE+I+ G RL FREG TK +G V  V
Sbjct:    1 MKWRLQEGQGEAIYGIGVEDNGGLVGLPEKELKSSLATLNTMASKLGATTSILRQRNVEEMRKVVEVLVRQVPDDQQFTDIRMAVLGNVESGKSTLLGVLTYDELDNGQGRARLNLFRHLHEIQSGRTSSISHEILGFSCTGEVVNYS-DGR-SAEDVCEQSSKLITFIDLAGHHKYMKTTIFGLTGHSPDYAMLVIAGNAGIVGTTKEHLGLAMALKVPTLIIITKTDICTPAMLQRTTRLVERILQSPACNKVPIRVLAEEDAEDAAENFASGQVTPIFTLSCVTGENLSLLKKFLKVLPPVMSSADQEKLAQEITQYKIDETFNVPGTGPVVLGTLTSGILHEGDTLVVGPLCSGHFQTVRILSLKRNRAPCRVVRAGQSASAALSGIERHELRRGMVMTDPSLEPRACMCFWADVYLLFHPAAISKRFQATVYIDNVIQNAIIDDMSKDYLKTGQRAKVRFRFVKQPEFIREGSRLFFREGHTKGIGQVISV 494          
BLAST of GTP-binding protein 1 vs. Ensembl Nematostella
Match: EDO27599 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8T5])

HSP 1 Score: 164.851 bits (416), Expect = 4.075e-47
Identity = 77/124 (62.10%), Postives = 99/124 (79.84%), Query Frame = 2
Query: 1343 KIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANC---VAQNLRHR 1705
            +IKR+QIRKGM+ML   L P++ WEF A+++ILHHPTTIS KYQAM+H GP+RQTATI+ MSK+ LRT DKA VKFRFIK PEY+K   R++FREG+TKAVGT+ ++ P A+    +A  L+HR
Sbjct:   80 QIKRSQIRKGMVMLDKRLKPQACWEFEAEVLILHHPTTISCKYQAMIHCGPLRQTATIVEMSKEHLRTADKAVVKFRFIKQPEYLKPDSRMIFREGRTKAVGTILRIDPDAHPPPQIAGKLKHR 203          

HSP 2 Score: 121.324 bits (303), Expect = 2.178e-31
Identity = 54/67 (80.60%), Postives = 63/67 (94.03%), Query Frame = 2
Query:  821 LGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERV 1021
            LGLALALNVPVFVVVTKIDMCPPN++QETM L+ R+LKSPGCRKIPV+V N+DDV+ SATNFI+ER+
Sbjct:    2 LGLALALNVPVFVVVTKIDMCPPNVLQETMKLLARILKSPGCRKIPVVVQNKDDVVVSATNFISERI 68          
BLAST of GTP-binding protein 1 vs. Ensembl Nematostella
Match: EDO48034 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKR5])

HSP 1 Score: 57.7658 bits (138), Expect = 7.859e-9
Identity = 92/406 (22.66%), Postives = 163/406 (40.15%), Query Frame = 2
Query:  431 IRVAVVGNVDAGKSTLLGVLTH--GDLDNGRGAARMKLFRHKHEMESG-RTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGII-------GMTKEHLGLALALNVPVFVV-VTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVI---CSATNF------ITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQL-LRTGDKAEVKFRFIKN 1585
            + +  +G+VDAGKST+ G + +  G +D        K    K+E E+  +           D N +  +K    ++  A   +   K  T +D  GH+ ++   + G      D  +L+I A  G         G T+EH  LA    V   V+ V K+D  P     E      +V  +P  +K+      + D++   CS          +  +VCP +     SGK      K+++ L P    +++ P    I D +   G   +       G I     L+L P+ +       + ++      +   R   +    LK ++   +  G ++ SP     +V  F A ++IL H + I   Y A++HI  V +  + + +   +  +TG K + + RFIK 
Sbjct:   30 VNIIFIGHVDAGKSTIGGHVMYLTGQVD--------KRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAAF-DTDTKHFTLLDAPGHKSFVPNMISGAA--QADLGVLVISARKGEFETGFERGGQTREHAMLAKTAGVKHLVILVNKMD-DPTVKWNEERYEEIKVKLTPFLKKVGF--NPKTDIMYMPCSGLTGANLKEPLDPQVCPWY-----SGKP---FLKYIDQL-PSLTRSVDGPVRLPIADKYRDMGTIVLGKVES--GTINKGQTLVLMPNKVNV----ELTTVIYDEEEMTSARAGDNVKLRLKGVEEEDVSPGFVLCSPHNLCHTVRTFDAQVVILEHKSIICAGYSAVLHIHNVVEEVSFLTLIALIDKKTGKKGQTRPRFIKQ 406          
BLAST of GTP-binding protein 1 vs. Ensembl Nematostella
Match: EDO39883 (Elongation factor Tu [Source:UniProtKB/TrEMBL;Acc:A7S8T2])

HSP 1 Score: 52.373 bits (124), Expect = 3.720e-7
Identity = 105/437 (24.03%), Postives = 185/437 (42.33%), Query Frame = 2
Query:  431 IRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKV-ITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLA-----LALNVP-VFVVVTKIDMCP-PNIMQETMNLMTRVLKSPG--CRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDL----LQKFLNLLS---PRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVND-VLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIIL-------HHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREG-KTKAVGTVTQV 1663
            + +  +G+VD GK+TL   +T    D G  AA  K +                     D++     +A    ++ A +  ++ K     +D  GH  Y+K  + G      D A+L++    G +  T+EHL LA      ++ V  + V V K DM   P +++     +  +L   G      P+I+ +    +C+                 + GKN DL    ++K L  +    P    ++++P    I+D+FS+ G GTVV+G   +G+I+  D V  +G       +   ++  H+  +  R   G    +  ++ +KR  +++GM++  P    KS  +F A + IL       H P   S   Q  V  G V  T T+    K+ +  G+ A    + + +   ++ G+R   REG KT   G VT++
Sbjct:   16 VNIGTIGHVDHGKTTLTAAITKVLADTG--AANFKSYG--------------------DIDNAPEERARGITINTAHVEYQTEKRHYGHVDCPGHADYIKNMITGAA--QMDGAILVVAGTDGQMPQTREHLLLANQASKCSVGVKDIVVYVNKADMIDDPELLELVELELRELLSEYGYDGDNTPIIIGS---ALCA-----------------LEGKNDDLGINSIKKLLEAVDSHIPTPARDLDKPFLLPIEDVFSISGRGTVVTGRIERGVIKKGDEVEFVGHGSKIKTTVTGIEMFHK--ILDRGEAGDNLGAL-VRGVKREDVKRGMVLCQPGT-VKSHSKFEAQVYILKKEEGGRHKPFVTSYTPQMYVRTGDVAATITLP-EGKEFVMPGEDASFTVQLLFDVP-LEQGLRFTLREGSKTVGTGVVTKI 402          
BLAST of GTP-binding protein 1 vs. Ensembl Medaka
Match: gtpbp1 (GTP binding protein 1 [Source:NCBI gene;Acc:101172981])

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 338/536 (63.06%), Postives = 425/536 (79.29%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVP-GLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNK--AVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTK 1732
             S K   V+P+ + Y+ +  + + ++++  G+  + +G G +    GL + ++E S+  +  L ++  A  + LRD     G V +Y +R+     DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHEMESGRTSSVGNDILGFD  GQ+VNK  +  G LDW KICEKS+KVITFIDLAGHEKYLKTTVFGMTGH PDF MLM+G+NAGI+GMTKEHLGLALALNVPVFVVVTKIDMCP NI+QET+ L+ R+LKSPGCRKIPV+V N+DDVI +A+NF +ER+CPIF +SNV+G+N+DLL+ FLNLLS RT+   ++PAEFQIDD +SVPGVGTVVSGT L+G+IR+ND +LLGPDPLG+F P  VKSIHRKRMPV+EVRG Q+ASF+LKKIKR+ IRKGM+M+SP L+P++ WEF A++++LHHPTTIS +YQAMVH G +RQTATI+ M++  LRTGDKA V FRFIK PEY+    RLVFREG+TKAVGT+T++    N +  N +   +K  +T K
Sbjct:   62 FSSKLALVSPNGEQYDLLLRQLRDRMDEGSGETIYVVGMGSDGGDWGLNESDMEASVATVRSLCEQLDADLIPLRDRSEAAGLVRDYLIRRRVGELDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEMESGRTSSVGNDILGFDQEGQVVNKPDSHGGSLDWTKICEKSSKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQNKDDVIVAASNFSSERMCPIFQISNVTGENMDLLKMFLNLLSSRTSYRDDQPAEFQIDDTYSVPGVGTVVSGTTLRGLIRLNDTMLLGPDPLGSFIPIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPKLNPQATWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMNRDCLRTGDKASVHFRFIKTPEYLHCDQRLVFREGRTKAVGTITKLLQSTNNMPSNSKPPQIKMQSTKK 597          
BLAST of GTP-binding protein 1 vs. Ensembl Medaka
Match: gtpbp1 (GTP binding protein 1 [Source:NCBI gene;Acc:101172981])

HSP 1 Score: 676.781 bits (1745), Expect = 0.000e+0
Identity = 338/536 (63.06%), Postives = 425/536 (79.29%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVP-GLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNK--AVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTK 1732
             S K   V+P+ + Y+ +  + + ++++  G+  + +G G +    GL + ++E S+  +  L ++  A  + LRD     G V +Y +R+     DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHEMESGRTSSVGNDILGFD  GQ+VNK  +  G LDW KICEKS+KVITFIDLAGHEKYLKTTVFGMTGH PDF MLM+G+NAGI+GMTKEHLGLALALNVPVFVVVTKIDMCP NI+QET+ L+ R+LKSPGCRKIPV+V N+DDVI +A+NF +ER+CPIF +SNV+G+N+DLL+ FLNLLS RT+   ++PAEFQIDD +SVPGVGTVVSGT L+G+IR+ND +LLGPDPLG+F P  VKSIHRKRMPV+EVRG Q+ASF+LKKIKR+ IRKGM+M+SP L+P++ WEF A++++LHHPTTIS +YQAMVH G +RQTATI+ M++  LRTGDKA V FRFIK PEY+    RLVFREG+TKAVGT+T++    N +  N +   +K  +T K
Sbjct:   62 FSSKLALVSPNGEQYDLLLRQLRDRMDEGSGETIYVVGMGSDGGDWGLNESDMEASVATVRSLCEQLDADLIPLRDRSEAAGLVRDYLIRRRVGELDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEMESGRTSSVGNDILGFDQEGQVVNKPDSHGGSLDWTKICEKSSKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQNKDDVIVAASNFSSERMCPIFQISNVTGENMDLLKMFLNLLSSRTSYRDDQPAEFQIDDTYSVPGVGTVVSGTTLRGLIRLNDTMLLGPDPLGSFIPIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPKLNPQATWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMNRDCLRTGDKASVHFRFIKTPEYLHCDQRLVFREGRTKAVGTITKLLQSTNNMPSNSKPPQIKMQSTKK 597          
BLAST of GTP-binding protein 1 vs. Ensembl Medaka
Match: gtpbp1 (GTP binding protein 1 [Source:NCBI gene;Acc:101172981])

HSP 1 Score: 676.396 bits (1744), Expect = 0.000e+0
Identity = 338/536 (63.06%), Postives = 425/536 (79.29%), Query Frame = 2
Query:  134 LSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVP-GLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNK--AVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTK 1732
             S K   V+P+ + Y+ +  + + ++++  G+  + +G G +    GL + ++E S+  +  L ++  A  + LRD     G V +Y +R+     DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHEMESGRTSSVGNDILGFD  GQ+VNK  +  G LDW KICEKS+KVITFIDLAGHEKYLKTTVFGMTGH PDF MLM+G+NAGI+GMTKEHLGLALALNVPVFVVVTKIDMCP NI+QET+ L+ R+LKSPGCRKIPV+V N+DDVI +A+NF +ER+CPIF +SNV+G+N+DLL+ FLNLLS RT+   ++PAEFQIDD +SVPGVGTVVSGT L+G+IR+ND +LLGPDPLG+F P  VKSIHRKRMPV+EVRG Q+ASF+LKKIKR+ IRKGM+M+SP L+P++ WEF A++++LHHPTTIS +YQAMVH G +RQTATI+ M++  LRTGDKA V FRFIK PEY+    RLVFREG+TKAVGT+T++    N +  N +   +K  +T K
Sbjct:   62 FSSKLALVSPNGEQYDLLLRQLRDRMDEGSGETIYVVGMGSDGGDWGLNESDMEASVATVRSLCEQLDADLIPLRDRSEAAGLVRDYLIRRRVGELDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEMESGRTSSVGNDILGFDQEGQVVNKPDSHGGSLDWTKICEKSSKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQNKDDVIVAASNFSSERMCPIFQISNVTGENMDLLKMFLNLLSSRTSYRDDQPAEFQIDDTYSVPGVGTVVSGTTLRGLIRLNDTMLLGPDPLGSFIPIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPKLNPQATWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMNRDCLRTGDKASVHFRFIKTPEYLHCDQRLVFREGRTKAVGTITKLLQSTNNMPSNSKPPQIKMQSTKK 597          
BLAST of GTP-binding protein 1 vs. Ensembl Medaka
Match: gtpbp1 (GTP binding protein 1 [Source:NCBI gene;Acc:101172981])

HSP 1 Score: 593.193 bits (1528), Expect = 0.000e+0
Identity = 307/515 (59.61%), Postives = 381/515 (73.98%), Query Frame = 2
Query:  197 FKKQLEDSQGDFFFQLGKGENEVP-GLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNK--AVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTK 1732
             + ++++  G+  + +G G +    GL + ++E S+  +  L ++  A  + LRD     G V +Y +R+     DF+++RVAVVGNVDAGKSTLLGVLTHG+LDNGRG AR KLFRHKHEMESGRTSSVGNDILGFD  GQ+VNK  +  G LDW KICEKS+KVITFIDLAGHEKYLKTTVFGMTGH PDF MLM+G+NAGI+GMTKEHLGLALALNVPVFVVVTKIDMCP NI+QET+ L+ R+LKSPGCRKIPV+V N+DDVI +A+NF +ER               D+LQ                     +  IF + GVGTVVSGT L+G+IR+ND +LLGPDPLG+F P  VKSIHRKRMPV+EVRG Q+ASF+LKKIKR+ IRKGM+M+SP L+P++ WEF A++++LHHPTTIS +YQAMVH G +RQTATI+ M++  LRTGDKA V FRFIK PEY+    RLVFREG+TKAVGT+T++    N +  N +   +K  +T K
Sbjct:    1 LRDRMDEGSGETIYVVGMGSDGGDWGLNESDMEASVATVRSLCEQLDADLIPLRDRSEAAGLVRDYLIRRRVGELDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEMESGRTSSVGNDILGFDQEGQVVNKPDSHGGSLDWTKICEKSSKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQNKDDVIVAASNFSSER-----------KHGPDVLQG-------------RSACRAVLMFIFILQGVGTVVSGTTLRGLIRLNDTMLLGPDPLGSFIPIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPKLNPQATWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMNRDCLRTGDKASVHFRFIKTPEYLHCDQRLVFREGRTKAVGTITKLLQSTNNMPSNSKPPQIKMQSTKK 491          
BLAST of GTP-binding protein 1 vs. Ensembl Medaka
Match: ENSORLT00000008169.2 (GTP-binding protein 2 [Source:NCBI gene;Acc:101173967])

HSP 1 Score: 465.307 bits (1196), Expect = 5.095e-157
Identity = 245/540 (45.37%), Postives = 364/540 (67.41%), Query Frame = 2
Query:  116 KSEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENE-VPGLTDLEIEESLKVIERLVDENSA--TFVKLRDIIYPDG---KVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNF-ITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEP-----AEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGM-SKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNL 1696
            ++EE  + +K   +NP+   +E ++ + K +L++ +G+  +Q+G  +N  + GL++ ++  SLK +  L ++  A  T ++ R++ Y       + E  +RK+P+   F+D+RVAV+GNVD+GKSTLLGVLT G+LDNGRG AR+ LFRH HE+++GRTSS+  +ILGF   G++VN +     +  +ICE S+K+ITFIDLAGH KYLKTT+FG+T + PDFAML++ AN GI G T+EHLGLA+AL VP+F+VV+K+D+C    ++ T+  + RVLK PGC K+P+ V++ DD + +A  F ++  + PIF +S+VSG+++DLL+ F N++ P +N    E       EFQ+D+I++VP VGTVV GT   GI R  D L++GP  LG F    V SI R R   R +R  Q+A+ +L    R+ +RKGM+M+SP +DP   W F A++++L H  T    +Q  VHIG VRQTAT+  +  K  LRTG+KA V F+FIK+PEY+K G +++FREG TK +G VT++ P A+  A  L
Sbjct:   66 EAEEGNIEYKLKLINPTQYRFEHLATQMKWRLQEGRGEAVYQIGVEDNGMLVGLSEEDMRASLKTLHMLAEKIGADITILRQREVDYDADVPRNIAEVLIRKVPDDQQFLDLRVAVLGNVDSGKSTLLGVLTQGELDNGRGRARLNLFRHLHEIQTGRTSSISFEILGFTSKGEVVNYSESRTAE--EICESSSKMITFIDLAGHHKYLKTTIFGLTSYCPDFAMLVVSANTGIAGTTREHLGLAMALKVPIFIVVSKVDLCTRATVERTVRQLERVLKQPGCNKVPMAVSSTDDAVTAAQQFALSPNITPIFTLSSVSGESLDLLKVFFNIIPPLSNSKEQEELMQQLTEFQVDEIYTVPEVGTVVGGTLYSGICREGDHLVVGPTELGQFHRLTVGSIQRNRSACRVLRAGQAATLALGNFDRSLLRKGMVMVSPEMDPTICWMFEAEIVLLFHAKTFHKGFQVTVHIGNVRQTATVEALYGKDELRTGEKAVVLFKFIKHPEYLKVGAKVLFREGATKGIGHVTKLQPIAHFPASQL 603          
BLAST of GTP-binding protein 1 vs. Planmine SMEST
Match: SMESG000031581.1 (SMESG000031581.1)

HSP 1 Score: 1093.95 bits (2828), Expect = 0.000e+0
Identity = 544/544 (100.00%), Postives = 544/544 (100.00%), Query Frame = 2
Query:  104 MEIDKSEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVPGLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTKA 1735
            MEIDKSEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVPGLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFSVPGVGTVVSGTCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTKA
Sbjct:    1 MEIDKSEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVPGLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFSVPGVGTVVSGTCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTKA 544          
BLAST of GTP-binding protein 1 vs. Planmine SMEST
Match: SMESG000013231.1 (SMESG000013231.1)

HSP 1 Score: 1093.95 bits (2828), Expect = 0.000e+0
Identity = 544/544 (100.00%), Postives = 544/544 (100.00%), Query Frame = 2
Query:  104 MEIDKSEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVPGLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTKA 1735
            MEIDKSEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVPGLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFSVPGVGTVVSGTCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTKA
Sbjct:    1 MEIDKSEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVPGLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFSVPGVGTVVSGTCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTKA 544          
BLAST of GTP-binding protein 1 vs. Planmine SMEST
Match: SMESG000031581.1 (SMESG000031581.1)

HSP 1 Score: 1031.17 bits (2665), Expect = 0.000e+0
Identity = 515/515 (100.00%), Postives = 515/515 (100.00%), Query Frame = 2
Query:  104 MEIDKSEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVPGLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVG 1648
            MEIDKSEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVPGLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFSVPGVGTVVSGTCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVG
Sbjct:    1 MEIDKSEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVPGLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFSVPGVGTVVSGTCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVG 515          
BLAST of GTP-binding protein 1 vs. Planmine SMEST
Match: SMESG000031581.1 (SMESG000031581.1)

HSP 1 Score: 722.62 bits (1864), Expect = 0.000e+0
Identity = 350/350 (100.00%), Postives = 350/350 (100.00%), Query Frame = 2
Query:  104 MEIDKSEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVPGLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIF 1153
            MEIDKSEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVPGLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIF
Sbjct:    1 MEIDKSEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKGENEVPGLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIF 350          

HSP 2 Score: 258.07 bits (658), Expect = 1.059e-78
Identity = 122/122 (100.00%), Postives = 122/122 (100.00%), Query Frame = 2
Query: 1370 GMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTKA 1735
            GMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTKA
Sbjct:  354 GMMMLSPMLDPKSVWEFSADLIILHHPTTISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKSGMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTKA 475          
BLAST of GTP-binding protein 1 vs. Planmine SMEST
Match: SMESG000041954.1 (SMESG000041954.1)

HSP 1 Score: 213.772 bits (543), Expect = 7.118e-60
Identity = 167/560 (29.82%), Postives = 266/560 (47.50%), Query Frame = 2
Query:  179 ERISNEFKKQLEDSQGDFFFQLG-KGENEVPGLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRKIPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKHEMESGRTSSVGNDILGFDVNGQIVN----KAVHGQLDWAKICEKSAKVITFIDLAGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPVFVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATNFITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIFXXXXXXXXXXXXCL--KGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVREVRGSQSASFSLK----------------KIK-------------RNQIRKGMMMLS--PMLDPKSVWEF-----SADLIILHHPTTISIKYQA----------------MVHIGPVRQTATII---GMSKQLLRTGDKA----EVKFRFIKNPEYIKSGMRLVFREG--KTKAVGTV 1654
            + +  + K +L + +G+  +++G   + +V GL   E+ ES+  +  + +  +A+   LR+      + +E  +R +P  +   + RVAV+GN+DAGKSTL+GVLT G LDNG+G  R+  FRH HE+ SGRTSS+   +LGFD +  + N    K         ++   S+K++  IDLAG  KY +TT+F +T   P F +L+I AN G  G + +H  LA+ L VP+ VVVTK D  PP+   + ++ ++  L +    +   IV++       A N   +   P+F +S V+G  ID+L  FL  +      + +  AE  ID +              L   G+IR ND + +GP   GNF    V+SIHR R+    V   Q ASF++                 K++                +R+GM++LS  P  D   ++E+     S D  I       +IK  A                +VH G V Q + I+    MS +   +  KA    +V F F   P++I +   +VF +     K  G++
Sbjct:  130 QHLITQLKWRLAEGEGEAIYEIGVDDDGKVSGLEKQELMESVMNLRTMAETLNASVSLLRECHVGTRRALELLIRNVPTHFSTRETRVAVLGNMDAGKSTLIGVLTQGVLDNGQGKTRLATFRHVHEVRSGRTSSISCQLLGFDKDHNLYNFYRQKDRLHHRSHEEVVLSSSKLVALIDLAGCHKYQRTTLFALTARRPHFILLVIPANHGFKGTSVDHCQLAITLQVPIVVVVTKTDRSPPD---QAISQLSSWLTAKSVFQPISIVSSVHQAKQVAMNISIDNCIPVFPLSCVTGFGIDILISFLGNIQTVEQFSRHLNAEIWIDQMHYEVPRVDGCVVGGLVYTGLIRENDSMYIGPQKEGNFVRVSVQSIHRNRVQQTTVENGQYASFAVSASDLIPDEEDVIWISDKLRDLPMGLNSQFDETETCVRRGMVLLSTLPNTDINYLYEYIDNNNSCDGHIAWGVVVSNIKMLADQEVSIIDLYKQQGSWIVHCGNVYQKSNILEFENMSNRFQASLKKAAISNDVIFNFKLFPQFIHANYPVVFHKAGQNVKVYGSI 686          
The following BLAST results are available for this feature:
BLAST of GTP-binding protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GTPBP10.000e+062.76GTP binding protein 1 [Source:HGNC Symbol;Acc:HGNC... [more]
GTPBP26.632e-15447.07GTP binding protein 2 [Source:HGNC Symbol;Acc:HGNC... [more]
GTPBP27.603e-15148.21GTP binding protein 2 [Source:HGNC Symbol;Acc:HGNC... [more]
GTPBP21.121e-8847.93GTP binding protein 2 [Source:HGNC Symbol;Acc:HGNC... [more]
GTPBP14.895e-6962.86GTP binding protein 1 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of GTP-binding protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cgp-10.000e+054.24GTP-binding protein cgp-1 [Source:UniProtKB/Swiss... [more]
cgp-10.000e+054.24GTP-binding protein cgp-1 [Source:UniProtKB/Swiss... [more]
T04H1.25.138e-9636.69pep chromosome:WBcel235:V:12242318:12245059:-1 gen... [more]
T04H1.25.138e-9636.69pep chromosome:WBcel235:V:12241962:12245044:-1 gen... [more]
cgp-11.106e-5251.90GTP-binding protein cgp-1 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of GTP-binding protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dgp-10.000e+062.67gene:FBgn0027836 transcript:FBtr0086773[more]
Dgp-10.000e+062.67gene:FBgn0027836 transcript:FBtr0086774[more]
CG20172.072e-13141.63gene:FBgn0037391 transcript:FBtr0114518[more]
CG20172.072e-13141.63gene:FBgn0037391 transcript:FBtr0078663[more]
CG20172.072e-13141.63gene:FBgn0037391 transcript:FBtr0078664[more]
back to top
BLAST of GTP-binding protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gtpbp1l0.000e+065.89GTP binding protein 1, like [Source:ZFIN;Acc:ZDB-G... [more]
gtpbp1l0.000e+065.89GTP binding protein 1, like [Source:ZFIN;Acc:ZDB-G... [more]
gtpbp10.000e+062.69GTP binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
gtpbp2b4.572e-16147.18GTP binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-0... [more]
gtpbp2b5.065e-16147.26GTP binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of GTP-binding protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chat0.000e+062.94choline O-acetyltransferase [Source:Xenbase;Acc:XB... [more]
chat0.000e+062.94choline O-acetyltransferase [Source:Xenbase;Acc:XB... [more]
chat0.000e+062.94choline O-acetyltransferase [Source:Xenbase;Acc:XB... [more]
chat0.000e+062.94choline O-acetyltransferase [Source:Xenbase;Acc:XB... [more]
chat0.000e+062.94choline O-acetyltransferase [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of GTP-binding protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gtpbp10.000e+062.76GTP binding protein 1 [Source:MGI Symbol;Acc:MGI:1... [more]
Gtpbp27.406e-15446.88GTP binding protein 2 [Source:MGI Symbol;Acc:MGI:1... [more]
Gtpbp22.076e-13645.95GTP binding protein 2 [Source:MGI Symbol;Acc:MGI:1... [more]
Gtpbp11.477e-5075.70GTP binding protein 1 [Source:MGI Symbol;Acc:MGI:1... [more]
Gtpbp12.232e-5067.52GTP binding protein 1 [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of GTP-binding protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|D2XV59|GTPB1_RAT0.000e+062.76GTP-binding protein 1 OS=Rattus norvegicus OX=1011... [more]
sp|Q58DC5|GTPB1_BOVIN0.000e+062.76GTP-binding protein 1 OS=Bos taurus OX=9913 GN=GTP... [more]
sp|O08582|GTPB1_MOUSE0.000e+062.76GTP-binding protein 1 OS=Mus musculus OX=10090 GN=... [more]
sp|O00178|GTPB1_HUMAN0.000e+062.76GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=G... [more]
sp|Q5R8Q7|GTPB1_PONAB0.000e+063.21GTP-binding protein 1 (Fragment) OS=Pongo abelii O... [more]
back to top
BLAST of GTP-binding protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QC100.000e+066.86GTP-binding protein 1 OS=Crassostrea gigas OX=2915... [more]
A0A1I8HUC90.000e+067.36Tr-type G domain-containing protein OS=Macrostomum... [more]
A0A267H1J70.000e+067.36Tr-type G domain-containing protein OS=Macrostomum... [more]
A0A2C9K6S50.000e+066.04Tr-type G domain-containing protein OS=Biomphalari... [more]
A0A210QVJ70.000e+065.36GTP-binding protein 1 OS=Mizuhopecten yessoensis O... [more]
back to top
BLAST of GTP-binding protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gtpbp10.000e+062.87GTP binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
gtpbp10.000e+062.87GTP binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
gtpbp1l0.000e+062.45GTP-binding protein 1-like [Source:NCBI gene;Acc:1... [more]
gtpbp1l0.000e+062.76GTP-binding protein 1-like [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000050613.13.164e-15745.37GTP binding protein 2 [Source:NCBI gene;Acc:103026... [more]
back to top
BLAST of GTP-binding protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gtpbp2b6.434e-15845.97GTP binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-0... [more]
gtpbp12.927e-11763.57GTP binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
ENSPMAT00000011427.12.018e-1223.08pep scaffold:Pmarinus_7.0:GL499053:103:1494:1 gene... [more]
hbs1l8.936e-825.50HBS1-like translational GTPase [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of GTP-binding protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
TEF13.907e-1424.82Translational elongation factor EF-1 alpha; in the... [more]
TEF23.907e-1424.82Translational elongation factor EF-1 alpha; in the... [more]
back to top
BLAST of GTP-binding protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO380940.000e+065.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484516.879e-14746.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO275994.075e-4762.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480347.859e-922.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398833.720e-724.03Elongation factor Tu [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of GTP-binding protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gtpbp10.000e+063.06GTP binding protein 1 [Source:NCBI gene;Acc:101172... [more]
gtpbp10.000e+063.06GTP binding protein 1 [Source:NCBI gene;Acc:101172... [more]
gtpbp10.000e+063.06GTP binding protein 1 [Source:NCBI gene;Acc:101172... [more]
gtpbp10.000e+059.61GTP binding protein 1 [Source:NCBI gene;Acc:101172... [more]
ENSORLT00000008169.25.095e-15745.37GTP-binding protein 2 [Source:NCBI gene;Acc:101173... [more]
back to top
BLAST of GTP-binding protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031581.10.000e+0100.00SMESG000031581.1[more]
SMESG000013231.10.000e+0100.00SMESG000013231.1[more]
SMESG000031581.10.000e+0100.00SMESG000031581.1[more]
SMESG000031581.11.059e-78100.00SMESG000031581.1[more]
SMESG000041954.17.118e-6029.82SMESG000041954.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019723 ID=SMED30019723|Name=GTP-binding protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1888bp
TGACTAAATTCTTTAATTAAAATAATATTTTTACCAAAGCATTTTTGATA
ATATTTAATAATAATTCCATCGTTTATTAATAATTTAATAAATACAAATT
TTCATGGAAATTGATAAAAGTGAGGAGAGAGTTTTATCCCATAAAAATAT
CTTTGTAAATCCGTCTGTTGACGATTATGAAAGAATATCAAATGAATTTA
AGAAACAGCTTGAAGACAGTCAAGGTGACTTTTTCTTTCAGCTGGGAAAA
GGAGAAAATGAAGTACCAGGATTAACAGATTTAGAAATAGAAGAATCATT
AAAAGTTATAGAAAGATTAGTCGATGAAAATTCTGCTACTTTTGTAAAAT
TGAGAGATATTATTTATCCTGATGGAAAAGTTATTGAATATGCAGTTCGA
AAAATTCCCGAATTATATGATTTTATAGACATTAGAGTTGCTGTTGTTGG
AAATGTAGATGCTGGTAAATCAACTCTCCTTGGTGTTTTAACCCACGGTG
ATCTCGATAATGGCCGTGGTGCAGCAAGAATGAAGCTATTTCGTCATAAA
CACGAAATGGAGTCTGGAAGGACTAGCTCAGTTGGTAACGACATTCTTGG
GTTTGATGTAAACGGACAGATCGTCAATAAAGCTGTCCATGGGCAATTGG
ATTGGGCGAAAATTTGCGAGAAATCTGCAAAAGTTATTACATTTATTGAT
TTGGCGGGCCATGAGAAATATCTCAAAACAACTGTGTTCGGCATGACGGG
CCATGCACCAGATTTTGCAATGTTAATGATTGGCGCCAATGCAGGAATCA
TAGGAATGACCAAGGAGCATCTTGGACTAGCACTGGCGCTCAATGTTCCG
GTATTCGTCGTTGTTACTAAAATCGATATGTGTCCACCAAATATTATGCA
AGAAACAATGAATCTTATGACCCGAGTATTAAAATCTCCTGGTTGTCGAA
AAATACCCGTAATTGTTACCAATGAAGATGATGTGATATGTTCGGCGACA
AATTTCATCACTGAACGAGTTTGTCCGATATTTTGTGTATCAAACGTCTC
TGGTAAAAACATTGATCTTCTTCAGAAATTTCTCAATCTGTTGAGCCCTC
GCACGAATCCAAATATCAACGAGCCAGCTGAATTTCAAATAGATGATATT
TTTTCTGTTCCGGGTGTGGGAACAGTTGTATCTGGAACGTGTTTGAAAGG
CATTATTAGAGTGAATGACGTTTTGCTATTGGGCCCAGATCCGTTGGGTA
ATTTCTCGCCTCACCCCGTAAAAAGCATTCACAGAAAGCGAATGCCCGTC
AGAGAAGTGCGCGGTAGTCAATCTGCATCTTTTTCACTGAAGAAAATCAA
AAGAAATCAAATCAGAAAAGGAATGATGATGTTGTCTCCGATGTTGGATC
CGAAATCCGTATGGGAATTTTCAGCTGATCTTATAATTTTACATCATCCC
ACAACTATTTCAATTAAATACCAGGCTATGGTCCATATTGGGCCCGTTCG
ACAAACCGCGACAATAATCGGTATGTCCAAGCAGCTGTTGAGAACCGGAG
ATAAGGCTGAGGTGAAATTCAGATTCATTAAAAATCCGGAATACATTAAA
AGTGGAATGCGATTGGTATTTCGAGAGGGTAAAACGAAAGCTGTGGGAAC
GGTGACGCAAGTGTATCCTCATGCTAATTGCGTGGCACAGAATCTTCGGC
ATAGAAATATGAAAAAAGACAACACCACAAAAGCATAAGAAGTATTTATG
AAACGATTCAAAATTTGAAAATATTTATGATTCCATTTGGAAATAGAATT
CTTCTGTCTTTTCATATCGAATGTAATTTCTAATCATTTTGTATTAGTTG
GAATCTGTTTTTCAATAAAATATTTAACTTTTAAAAAA
back to top

protein sequence of SMED30019723-orf-1

>SMED30019723-orf-1 ID=SMED30019723-orf-1|Name=SMED30019723-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=545bp
MEIDKSEERVLSHKNIFVNPSVDDYERISNEFKKQLEDSQGDFFFQLGKG
ENEVPGLTDLEIEESLKVIERLVDENSATFVKLRDIIYPDGKVIEYAVRK
IPELYDFIDIRVAVVGNVDAGKSTLLGVLTHGDLDNGRGAARMKLFRHKH
EMESGRTSSVGNDILGFDVNGQIVNKAVHGQLDWAKICEKSAKVITFIDL
AGHEKYLKTTVFGMTGHAPDFAMLMIGANAGIIGMTKEHLGLALALNVPV
FVVVTKIDMCPPNIMQETMNLMTRVLKSPGCRKIPVIVTNEDDVICSATN
FITERVCPIFCVSNVSGKNIDLLQKFLNLLSPRTNPNINEPAEFQIDDIF
SVPGVGTVVSGTCLKGIIRVNDVLLLGPDPLGNFSPHPVKSIHRKRMPVR
EVRGSQSASFSLKKIKRNQIRKGMMMLSPMLDPKSVWEFSADLIILHHPT
TISIKYQAMVHIGPVRQTATIIGMSKQLLRTGDKAEVKFRFIKNPEYIKS
GMRLVFREGKTKAVGTVTQVYPHANCVAQNLRHRNMKKDNTTKA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002111X2 cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR039263GTPB1
IPR035531GTPBP1-like
IPR027417P-loop_NTPase
IPR000795TF_GTP-bd_dom
IPR009000Transl_B-barrel_sf
IPR009001Transl_elong_EF1A/Init_IF2_C
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:2.40.30.10coord: 434..503
e-value: 1.2E-5
score: 27.6
NoneNo IPR availableGENE3DG3DSA:2.40.30.10coord: 337..431
e-value: 2.5E-21
score: 77.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 108..333
e-value: 2.5E-42
score: 146.7
NoneNo IPR availablePANTHERPTHR43721FAMILY NOT NAMEDcoord: 6..523
NoneNo IPR availableCDDcd03708GTPBP_IIIcoord: 434..520
e-value: 3.19982E-48
score: 159.991
NoneNo IPR availableCDDcd03694GTPBP_IIcoord: 342..428
e-value: 9.8017E-44
score: 148.137
IPR000795Transcription factor, GTP-binding domainPFAMPF00009GTP_EFTUcoord: 111..328
e-value: 1.9E-23
score: 83.0
IPR000795Transcription factor, GTP-binding domainPROSITEPS51722G_TR_2coord: 107..337
score: 41.559
IPR039263GTP-binding protein 1PANTHERPTHR43721:SF9GTP-BINDING PROTEIN 1coord: 6..523
IPR035531GTP binding protein 1-like, GTP-binding domainCDDcd04165GTPBP1_likecoord: 111..333
e-value: 9.80049E-148
score: 421.314
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 110..341
IPR009001Translation elongation factor EF1A/initiation factor IF2gamma, C-terminalSUPERFAMILYSSF50465EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domaincoord: 433..521
IPR009000Translation protein, beta-barrel domain superfamilySUPERFAMILYSSF50447Translation proteinscoord: 340..463