secreted frizzled related protein 3

Overview
Namesecreted frizzled related protein 3 (ADO51626.1)
Smed IDSMED30019722
Length (bp)1235
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of secreted frizzled related protein 3 (SMED30019722) t-SNE clustered cells

Violin plots show distribution of expression levels for secreted frizzled related protein 3 (SMED30019722) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of secreted frizzled related protein 3 (SMED30019722) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for secreted frizzled related protein 3 (SMED30019722) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019722

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30019722SMESG000058717.1 HM751832.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30019722SMESG000058717.1 HM751832.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30019722SMESG000058717.1 dd_Smed_v4_11070_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019722SMESG000058717.1 dd_Smed_v4_11070_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30019722SMESG000058717.1 dd_Smed_v4_11070_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30019722SMESG000058717.1 dd_Smed_v6_11070_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30019722SMESG000058717.1 HM751832.1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30019722SMESG000058717.1 HM751832.1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30019722SMESG000058717.1 dd_Smed_v4_11070_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of secreted frizzled related protein 3 vs. Ensembl Human
Match: SFRP2 (secreted frizzled related protein 2 [Source:HGNC Symbol;Acc:HGNC:10777])

HSP 1 Score: 103.99 bits (258), Expect = 1.565e-24
Identity = 74/284 (26.06%), Postives = 128/284 (45.07%), Query Frame = 3
Query:  141 CYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPIC-NRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIH-----SSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMK 974
            C P  AN  LC G    N       LL +      + Q+  WI L+  +CH D +KFLC+++AP+CL     T + PC  LC  VK++C P +  +GF WP +++C +FP +N   CI L                      +  +L   E+    K C  C N+      + +  CK    ++ K+  I    +    I L+ KS  I+     S   ++ S+  L   +QC C  + +  +     +L+ G  + G+ ++  + +WQ+ +++F+ + R + K
Sbjct:   40 CKPIPANLQLCHGIEYQNM--RLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDET-IQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDL-CIPLAS--------------------SDHLLPATEEA--PKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDT-KIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINA----PYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRK 292          
BLAST of secreted frizzled related protein 3 vs. Ensembl Human
Match: SFRP5 (secreted frizzled related protein 5 [Source:HGNC Symbol;Acc:HGNC:10779])

HSP 1 Score: 87.8113 bits (216), Expect = 1.016e-18
Identity = 70/293 (23.89%), Postives = 120/293 (40.96%), Query Frame = 3
Query:  114 GANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQ----CKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMKKP 980
            G +  +  QC    A+  LC   G    M+    LL +        Q++ W+ LL  +CH D + FLC+++AP+CL       ++PC  LC +V+  C P ++ YGF WP ++ C KFPL+N   CI +  G        + K                        C  C  +   + L +  C    V++ +I  I  +      I  Q K  ++      R     L+  ++    C C  L +      G +L+ G   +GQ ++  + +W +K K+ +   + +   P
Sbjct:   44 GRSYSKPPQCLDIPADLPLCHTVGY-KRMR-LPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLD----RPIYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLDNDL-CIAVQFGHLPATAPPVTKI-----------------------CAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKPGPLKRKDTKRLVLHMKNGAGCPCPQLDSL----AGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFMFSYP 302          
BLAST of secreted frizzled related protein 3 vs. Ensembl Human
Match: SFRP1 (secreted frizzled related protein 1 [Source:HGNC Symbol;Acc:HGNC:10776])

HSP 1 Score: 87.4261 bits (215), Expect = 1.183e-18
Identity = 70/293 (23.89%), Postives = 123/293 (41.98%), Query Frame = 3
Query:  105 FRVGANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITE-----IQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQL 968
            ++ G    +  QC    A+  LC   G          LL +        Q++ W+ LL+  CH   + FLC+++AP+CL       ++PC  LC +V++ C P ++ +GF WP ++ C KFP  +   CI +T                     N T  S  + T     CP C+ ++  E + ++ C     +R KI  + +K  G   I  + K  +     PI+      +         C C  L N        +L+ G     Q+++  + KW +K K+F++  +++
Sbjct:   46 YQSGRFYTKPPQCVDIPADLRLCHNVGY--KKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLD----RPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGD--VCIAMT-------------------PPNATEASKPQGTTV---CPPCDNELKSEAIIEHLCASEFALRMKIKEV-KKENGDKKIVPKKKKPLKLG--PIKKKDLKKLVLYLKNGADCPCHQLDNLSH----HFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKM 301          
BLAST of secreted frizzled related protein 3 vs. Ensembl Human
Match: SFRP4 (secreted frizzled related protein 4 [Source:HGNC Symbol;Acc:HGNC:10778])

HSP 1 Score: 67.3958 bits (163), Expect = 1.107e-11
Identity = 51/187 (27.27%), Postives = 79/187 (42.25%), Query Frame = 3
Query:  273 LLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVP--LEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKC 827
            L+   C   L  FLC +YAPIC        + PC+ +C   ++ C P +K+Y   WP  + C + P+ ++  CI       +  +         D  + +  L    + L    C  C +  P     L+KN   YS VI AKI  + +     ++  +  K  I  SS PI  +   LIT   C+C
Sbjct:   64 LVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKRLSPDRCK-CKKVKPTLATYLSKN---YSYVIHAKIKAVQRSGCNEVTTVVDVK-EIFKSSSPIPRTQVPLITNSSCQC 245          
BLAST of secreted frizzled related protein 3 vs. Ensembl Human
Match: FRZB (frizzled related protein [Source:HGNC Symbol;Acc:HGNC:3959])

HSP 1 Score: 62.003 bits (149), Expect = 4.786e-10
Identity = 53/219 (24.20%), Postives = 92/219 (42.01%), Query Frame = 3
Query:  195 SMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCK--YSLVIRAKIANIFQK---PKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKCSIL 836
            +M      L +S    +I     +  LL T C  DL  FLC +YAPIC    +   + PC+ +C   ++ C P L  Y   WP  + C + P+ ++  CI           +++V     D  ++ +  + +  + ++  C       P+    K + +  Y+ VIRAK+  I  K       + ++   KS++++    I     NL T   C C  L
Sbjct:   49 NMTKMPNHLHHSTQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCIS---------PEAIVTADGADFPMDSSNGNCRGASSERCKCK------PIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVN----IPRDTVNLYTSSGCLCPPL 248          
BLAST of secreted frizzled related protein 3 vs. Ensembl Celegans
Match: sfrp-1 (Secreted Frizzled-Related Protein [Source:UniProtKB/TrEMBL;Acc:A0A0K3ARM8])

HSP 1 Score: 81.6481 bits (200), Expect = 2.164e-17
Identity = 63/260 (24.23%), Postives = 112/260 (43.08%), Query Frame = 3
Query:  207 FSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTR-VFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKI---ANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMK 974
               +L +     +I+ S  W  LL   CH D ++FLC+++AP+CL   +  R + PC+ LC +VK+ C  R+  YGF WP ++ C KF  E+   CI+           S                           C  C++    E L   FC+  LV++AK+   +    + +   S++   +   + S   IR+S     ++  C C+I    K+ ++   ++     +G+++   +  WQ K K F+    Q  +
Sbjct:    3 LPNILEHETVSEAIHASKDWESLLRLNCHPDTQRFLCSLFAPVCLM--QMDRLILPCKSLCMAVKQGCENRMANYGFPWPEMLSCEKF--EDDDMCIKPMQPAKPPAGSSTT-------------------------CTACSQVATYENLVDQFCRSHLVLKAKVIRDSPTHIRVRNGRSLKKGERRRGV-SDVEIRLSSE---SDGSCPCNI--PVKNQNEKLLVMASRQPDGKYLANLVLPWQ-KEKNFKRAIHQFQR 226          
BLAST of secreted frizzled related protein 3 vs. Ensembl Celegans
Match: sfrp-1 (Secreted Frizzled-Related Protein [Source:UniProtKB/TrEMBL;Acc:A0A0K3ARM8])

HSP 1 Score: 82.4185 bits (202), Expect = 2.732e-17
Identity = 65/277 (23.47%), Postives = 121/277 (43.68%), Query Frame = 3
Query:  156 ANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTR-VFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKI---ANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMK 974
            +N ++C G  +  +      +L +     +I+ S  W  LL   CH D ++FLC+++AP+CL   +  R + PC+ LC +VK+ C  R+  YGF WP ++ C KF  E+   CI                         + +   +        C  C++    E L   FC+  LV++AK+   +    + +   S++   +   + S   IR+S     ++  C C+I    K+ ++   ++     +G+++   +  WQ K K F+    Q  +
Sbjct:   42 SNLSICNG--IEYTQMRLPNILEHETVSEAIHASKDWESLLRLNCHPDTQRFLCSLFAPVCLM--QMDRLILPCKSLCMAVKQGCENRMANYGFPWPEMLSCEKF--EDDDMCI-------------------------KPMQPAKPPAGSSTTCTACSQVATYENLVDQFCRSHLVLKAKVIRDSPTHIRVRNGRSLKKGERRRGV-SDVEIRLSSE---SDGSCPCNI--PVKNQNEKLLVMASRQPDGKYLANLVLPWQ-KEKNFKRAIHQFQR 280          
BLAST of secreted frizzled related protein 3 vs. Ensembl Celegans
Match: mig-1 (Transmembrane receptor [Source:UniProtKB/TrEMBL;Acc:G5EF44])

HSP 1 Score: 71.2478 bits (173), Expect = 4.328e-13
Identity = 32/69 (46.38%), Postives = 44/69 (63.77%), Query Frame = 3
Query:  273 LLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLEN 479
            LL   C   L+ FLC++Y P+C        + PC  LC SV+E+CLP L+ +GF+WP ++ C KFPLEN
Sbjct:   66 LLSVVCSEQLKFFLCSVYFPMC-NEKLANPIGPCRPLCLSVQEKCLPVLESFGFKWPDVIRCDKFPLEN 133          
BLAST of secreted frizzled related protein 3 vs. Ensembl Celegans
Match: mig-1 (Transmembrane receptor [Source:UniProtKB/TrEMBL;Acc:G5EF44])

HSP 1 Score: 70.8626 bits (172), Expect = 4.576e-13
Identity = 32/69 (46.38%), Postives = 44/69 (63.77%), Query Frame = 3
Query:  273 LLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLEN 479
            LL   C   L+ FLC++Y P+C        + PC  LC SV+E+CLP L+ +GF+WP ++ C KFPLEN
Sbjct:   66 LLSVVCSEQLKFFLCSVYFPMC-NEKLANPIGPCRPLCLSVQEKCLPVLESFGFKWPDVIRCDKFPLEN 133          
BLAST of secreted frizzled related protein 3 vs. Ensembl Celegans
Match: mom-5 (pep chromosome:WBcel235:I:9965580:9970037:1 gene:WBGene00003397.1 transcript:T23D8.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-5)

HSP 1 Score: 68.9366 bits (167), Expect = 2.166e-12
Identity = 36/89 (40.45%), Postives = 51/89 (57.30%), Query Frame = 3
Query:  213 GLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLEN 479
            G    S++G +I Q N    L+  KC  D+  FLCT+YAP+C    +   + PC ELC S K  C   +K +GF+WP  +DC KFP+ +
Sbjct:   60 GHTTQSEAGPAIAQFNP---LIKVKCSEDIRLFLCTVYAPVCTVLEK--PIQPCRELCLSAKNGCESLMKKFGFQWPDQLDCNKFPVTD 143          
BLAST of secreted frizzled related protein 3 vs. Ensembl Fly
Match: fz4 (gene:FBgn0027342 transcript:FBtr0071017)

HSP 1 Score: 67.0106 bits (162), Expect = 1.173e-11
Identity = 29/69 (42.03%), Postives = 38/69 (55.07%), Query Frame = 3
Query:  273 LLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLEN 479
            L+   C   L+ FLC  Y P+C        + PC  LC SV+ +C P L+ +GF WP  +DC KFP EN
Sbjct:   86 LIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDKFPREN 154          
BLAST of secreted frizzled related protein 3 vs. Ensembl Fly
Match: fz4 (gene:FBgn0027342 transcript:FBtr0071018)

HSP 1 Score: 67.0106 bits (162), Expect = 1.173e-11
Identity = 29/69 (42.03%), Postives = 38/69 (55.07%), Query Frame = 3
Query:  273 LLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLEN 479
            L+   C   L+ FLC  Y P+C        + PC  LC SV+ +C P L+ +GF WP  +DC KFP EN
Sbjct:   86 LIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDKFPREN 154          
BLAST of secreted frizzled related protein 3 vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0112890)

HSP 1 Score: 57.7658 bits (138), Expect = 1.221e-8
Identity = 32/104 (30.77%), Postives = 53/104 (50.96%), Query Frame = 3
Query:  183 GVLNSMKTFSGLLRN---SKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFP-CEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENK 482
            G+  +M +F   + +    ++G  ++Q   W  L+  KC  DL+ FLC++Y PICL+ +   +  P C  +C   +  C P ++ Y FEWP  + C   PL   
Sbjct:   74 GIGYNMTSFPNEMNHETQDEAGLEVHQ--FWP-LVEIKCSPDLKFFLCSMYTPICLEDYH--KPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGD 172          
BLAST of secreted frizzled related protein 3 vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0075029)

HSP 1 Score: 57.7658 bits (138), Expect = 1.221e-8
Identity = 32/104 (30.77%), Postives = 53/104 (50.96%), Query Frame = 3
Query:  183 GVLNSMKTFSGLLRN---SKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFP-CEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENK 482
            G+  +M +F   + +    ++G  ++Q   W  L+  KC  DL+ FLC++Y PICL+ +   +  P C  +C   +  C P ++ Y FEWP  + C   PL   
Sbjct:   74 GIGYNMTSFPNEMNHETQDEAGLEVHQ--FWP-LVEIKCSPDLKFFLCSMYTPICLEDYH--KPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGD 172          
BLAST of secreted frizzled related protein 3 vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0332735)

HSP 1 Score: 57.7658 bits (138), Expect = 1.221e-8
Identity = 32/104 (30.77%), Postives = 53/104 (50.96%), Query Frame = 3
Query:  183 GVLNSMKTFSGLLRN---SKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFP-CEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENK 482
            G+  +M +F   + +    ++G  ++Q   W  L+  KC  DL+ FLC++Y PICL+ +   +  P C  +C   +  C P ++ Y FEWP  + C   PL   
Sbjct:   74 GIGYNMTSFPNEMNHETQDEAGLEVHQ--FWP-LVEIKCSPDLKFFLCSMYTPICLEDYH--KPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGD 172          
BLAST of secreted frizzled related protein 3 vs. Ensembl Zebrafish
Match: sfrp5 (secreted frizzled-related protein 5 [Source:ZFIN;Acc:ZDB-GENE-011108-2])

HSP 1 Score: 104.76 bits (260), Expect = 6.872e-25
Identity = 74/287 (25.78%), Postives = 127/287 (44.25%), Query Frame = 3
Query:  102 DFRVGANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQ----CKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFR 950
            +F  G    +  QC    A+  LC   G    M+    LL +        Q+  W+ LL  +CH D + FLC+++AP+CL       ++PC  LC +V++ C P ++ YGF WP ++ C KFP++N   CI +    G+               + QT +S        K CP C+ ++  + + +++C     ++ KI    ++      I  Q K  ++      +  L  L   I+    C CS L N  S     +L+ G   + Q ++  + KW +K K+ +
Sbjct:   39 NFHSGRFYAKQPQCVDIPADLRLCYNVGY-KKMR-LPNLLDHETMPEVKQQAGSWVPLLAKRCHADTQVFLCSLFAPVCLD----RPIYPCRSLCEAVRDSCAPVMETYGFPWPEMLQCEKFPIDNDL-CIPMQFSAGH---------------VTQTPVS--------KVCPPCDNELKADTIMEHYCASDFALKMKIKEAKKEKGDRKLIAAQKKKKVLKMGILRKKDLKKLTLYIKNGANCPCSQLDNLGS----NFLIMGRKVDQQLLLMSIHKWDKKSKELK 291          
BLAST of secreted frizzled related protein 3 vs. Ensembl Zebrafish
Match: sfrp2 (secreted frizzled-related protein 2 [Source:ZFIN;Acc:ZDB-GENE-061013-293])

HSP 1 Score: 100.523 bits (249), Expect = 1.569e-23
Identity = 73/290 (25.17%), Postives = 126/290 (43.45%), Query Frame = 3
Query:  126 QRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLE-ILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIH------SSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMK 974
            Q+ + C P   N  LC      N       LL +      + Q++ W  L+  +CH D +KFLC+++AP+CL       + PC  LC SVK  C P +  +GF WP ++DC +FPL+N   CI            +LV   +E                  + C  C  K   +  +  + CK    ++ K+  I     G   I  + K+ +I+      + H  R ++  L   +QC C  L +  +     +L+ G   +G  ++  + +WQ+ +++F+ + R + K
Sbjct:   33 QKKSNCKPIPTNLLLCHDIEYTNM--RLPNLLGHETMNEVLQQASSWTPLVQKQCHPDTKKFLCSLFAPVCLDDLD-EPIQPCRSLCESVKSGCAPVMAAFGFPWPDMLDCRRFPLDNDL-CIPPAGA------DALVPVTKE----------------VPRVCDACKEKPENDNEIVDSLCKNDFALKIKVKEISYM-NGDTKIIPETKTKMIYKTNGGVTDHDFRKTVLWLKDGLQCVCDELNDINAA----YLVMGQKMDGNLVITSVKRWQKGQREFKRISRSIRK 291          
BLAST of secreted frizzled related protein 3 vs. Ensembl Zebrafish
Match: sfrp2 (secreted frizzled-related protein 2 [Source:ZFIN;Acc:ZDB-GENE-061013-293])

HSP 1 Score: 100.523 bits (249), Expect = 1.569e-23
Identity = 73/290 (25.17%), Postives = 126/290 (43.45%), Query Frame = 3
Query:  126 QRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLE-ILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIH------SSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMK 974
            Q+ + C P   N  LC      N       LL +      + Q++ W  L+  +CH D +KFLC+++AP+CL       + PC  LC SVK  C P +  +GF WP ++DC +FPL+N   CI            +LV   +E                  + C  C  K   +  +  + CK    ++ K+  I     G   I  + K+ +I+      + H  R ++  L   +QC C  L +  +     +L+ G   +G  ++  + +WQ+ +++F+ + R + K
Sbjct:   33 QKKSNCKPIPTNLLLCHDIEYTNM--RLPNLLGHETMNEVLQQASSWTPLVQKQCHPDTKKFLCSLFAPVCLDDLD-EPIQPCRSLCESVKSGCAPVMAAFGFPWPDMLDCRRFPLDNDL-CIPPAGA------DALVPVTKE----------------VPRVCDACKEKPENDNEIVDSLCKNDFALKIKVKEISYM-NGDTKIIPETKTKMIYKTNGGVTDHDFRKTVLWLKDGLQCVCDELNDINAA----YLVMGQKMDGNLVITSVKRWQKGQREFKRISRSIRK 291          
BLAST of secreted frizzled related protein 3 vs. Ensembl Zebrafish
Match: sfrp1a (secreted frizzled-related protein 1a [Source:ZFIN;Acc:ZDB-GENE-040310-5])

HSP 1 Score: 93.2041 bits (230), Expect = 5.416e-21
Identity = 65/287 (22.65%), Postives = 119/287 (41.46%), Query Frame = 3
Query:  120 NRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITE----IQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQL 968
            N  +  QC     +  LC G G    +     LL +        Q+  W+ LLH  C    +  LC+++AP+C++      ++PC  LC +V++ C P +  +GF WP I+ C KFP ++   CI   + T                       S  E       CP C+ ++ ++++  + C     I+ KI  + ++      + LQ K   I      +  L  L         C C+ L N ++     +L+ G   + Q+++  + KW +  ++F+   ++L
Sbjct:   33 NYDKPPQCVDIPVDLRLCQGVGYHQML--LPNLLEHESMAEVKQQAGSWVPLLHKNCDPGTQLLLCSLFAPVCME----RPIYPCRRLCENVRDGCSPIMAAFGFPWPHILTCDKFPQDD--MCINTPNDT-----------------------STSEPNGHPPVCPPCDNEMKMDVILDHMCASEFAIKTKIQEV-KRENMDRKVTLQKKKRTIKMGTLKKKDLKKLTLYLKNGADCPCTQLDNTRNT----YLIMGRKVDKQYLLTGIHKWDKSNREFKKTMKKL 283          
BLAST of secreted frizzled related protein 3 vs. Ensembl Zebrafish
Match: sfrp2l (secreted frizzled-related protein 2 like [Source:ZFIN;Acc:ZDB-GENE-061122-2])

HSP 1 Score: 90.5077 bits (223), Expect = 8.479e-20
Identity = 66/282 (23.40%), Postives = 118/282 (41.84%), Query Frame = 3
Query:  141 CYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLE-ILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHP---IRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMK 974
            C P      LC G G    M+    LL +  +  +  QS  W+ L+  +CH D  +FLC+++AP+CL     T V PC  LC +V++ C P +  +GF WP + +C +F           TDG    +    +   R   +L  T           + C  C+     E  + + FC    V+R ++ +        + +  + +S ++    P   + + +  L   + C C  L    +     +++ G   +G+  +  + +W R  K  + L R L+K
Sbjct:   77 CKPVPNTMVLCFGIG-YREMR-LPNLLEHQSAREAQQQSAAWVPLIGKRCHRDTRRFLCSLFAPVCLP-EVPTPVSPCRNLCVAVRDACAPVMSAFGFPWPEMFNCSRF-----------TDGPELCIPGE-IDPLRAPTTLAPT---------GSEICEACSADGDGEREILQEFCTAQFVVRLRVGSC-SVIGSDLRVFPEGRSRVLRQQDPQAALELRVLWLPQALHCSCPALDGPLT---STYIILGHTHSGRMQIHRILRWTRDEKTLKKLIRTLLK 330          
BLAST of secreted frizzled related protein 3 vs. Ensembl Xenopus
Match: frzb2 (frizzled related protein 2 [Source:NCBI gene;Acc:549442])

HSP 1 Score: 98.9821 bits (245), Expect = 8.091e-23
Identity = 71/253 (28.06%), Postives = 115/253 (45.45%), Query Frame = 3
Query:  216 LLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQ-LTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNII-HSSHPIRISLANLITEIQCKCSILQN-AKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQ 965
            LL +      I QS+ W+ LL  +CH D   FLC+++APICL  +    ++PC  LC +V+  C P +  YG+ WP I+ C KFP E+   CI  +T+GTG+  ++++ +    D  L       +E +  K            EIL   FC    V + +I              L  K  I+ H S P    L  L   +    + +QN  +    G +++ G+++  + +V     WQ+K K  +   R+
Sbjct:   66 LLEHDTMAEVIQQSSSWLPLLARECHPDARIFLCSLFAPICLDRY----IYPCRSLCEAVRGSCAPIMACYGYPWPEILRCDKFP-EDHGMCISPITNGTGS-TRRTVPRASCRDCEL-------EEASTAK------------EIL-DTFCDNDFVAKVRITKKNITSANLYDFDLDSKLEILKHGSLPKTDVLPRLQQWLDLDATCVQNIMRGTRTGIYVIGGEVQEDKVVVNNAYAWQKKNKNLQFAVRK 292          
BLAST of secreted frizzled related protein 3 vs. Ensembl Xenopus
Match: sfrpx (secreted frizzled-related protein [Source:NCBI gene;Acc:100037908])

HSP 1 Score: 98.2117 bits (243), Expect = 1.450e-22
Identity = 68/288 (23.61%), Postives = 127/288 (44.10%), Query Frame = 3
Query:  129 RLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPIC-NRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIH-----SSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMK 974
            R + C    ++ TLC G G   S      LL +      + Q+  W+ LL  +CH D +KFLC+++AP+CL       V+PC  LC +V++ C P +  +GF WP + +C +FPL N+  C+                   ED+         Q++  ++  C  C NR    +   +N+C     ++  I ++    +G + +  + +S  ++     S   +R ++  L     C C  +    +      L+ G   + + ++ ++ KWQ+  K+ +   R + K
Sbjct:   30 RKSSCKAIPSSMTLCHGVGY--SEMRLPNLLGHDTMKEVLQQAGSWVPLLTKQCHADTKKFLCSLFAPVCLSELE-EAVYPCRSLCEAVRDGCTPVMAAFGFPWPDMFNCTQFPLGNEL-CVP--------------PAGSEDK---------QQEVKEEAPCSACRNRGDADKDFLQNYCSSDFALKINIRSV-STLEGDVMVVPEARSRTVYKSKGWSDEELRKTVLWLSDGDNCLCQDIHEPGATV----LVLGHRADDRLVISWVRKWQKSEKETKRFSRTVRK 285          
BLAST of secreted frizzled related protein 3 vs. Ensembl Xenopus
Match: sfrp1 (Xenopus tropicalis secreted frizzled-related protein 1 (sfrp1), mRNA. [Source:RefSeq mRNA;Acc:NM_001123406])

HSP 1 Score: 98.2117 bits (243), Expect = 1.806e-22
Identity = 74/290 (25.52%), Postives = 124/290 (42.76%), Query Frame = 3
Query:  105 FRVGANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMK 974
            ++ G    R  QC     + TLC G G  N M     LL +       YQ++ W+ LL  KCH   + FLC+++AP+CL       V+PC  LC SV++ C P ++ +GF WP ++ C ++P E    CI +           L    +  RS    +            CP C+ ++  + L ++ C     ++  I  + +K  G   + L+ K  +        I   +L     C C  L       KG++L+ G     Q ++  + KW +  ++F    R++ K
Sbjct:   42 YQSGRFYSRPAQCVEIPQDMTLCHGVG-YNKM-VLPNLLDHETMAEVKYQASSWVPLLSKKCHPGTQVFLCSLFAPVCLD----RPVYPCRRLCESVRDACEPVMQYFGFHWPEMLRCEQYPTEEDV-CIAV----------HLPNATQAPRSRKTEV------------CPQCDSEIKADSLYEHMCASEFALKVSIREV-KKDNGDRKLLLRKKKALKKGP----IQKKDLKNGANCPCHQLDQL----KGQFLVLGRKVKSQHLLTAIHKWDKTNREFNRFMRKVKK 293          
BLAST of secreted frizzled related protein 3 vs. Ensembl Xenopus
Match: sfrp2 (secreted frizzled-related protein 2 [Source:NCBI gene;Acc:394659])

HSP 1 Score: 93.2041 bits (230), Expect = 7.822e-21
Identity = 69/286 (24.13%), Postives = 123/286 (43.01%), Query Frame = 3
Query:  135 NQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPIC-NRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIH-----SSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMK 974
            + C P  A   LC      N       LL +      + Q++ WI L+  +CH D +KFLC+++AP+C+     T + PC  LC  VK+ C P +  +GF WP +++C +FP +N   CI           + +V   RE                  K C  C N       + +N CK    ++ K+  I     G   I  + K   I+     +   ++ ++  L   +QC C  + +  +     +L+ G    G+ ++  + +WQ+ +++F+ + R + K
Sbjct:   38 SNCKPIPATLVLCHDIEYPNM--RLPNLLGHETMKEVLQQASSWIPLVQKQCHQDTKKFLCSLFAPVCIDDLDET-IKPCRSLCEQVKDSCAPVMSAFGFPWPDMLECSRFPQDNDL-CIPPAS------TEHVVPVTRE----------------APKVCDACKNSNEDDNDIVENLCKNDFALKIKVKEIAYI-NGDTKIIPETKGKTIYKLNGVTERDLKKTVLWLKDGLQCTCDEMNDINA----PYLVMGQKLGGELVITSVKRWQKGQREFKRITRSIRK 292          
BLAST of secreted frizzled related protein 3 vs. Ensembl Xenopus
Match: sfrp5 (secreted frizzled-related protein 5 [Source:NCBI gene;Acc:448129])

HSP 1 Score: 90.1225 bits (222), Expect = 1.548e-19
Identity = 72/297 (24.24%), Postives = 124/297 (41.75%), Query Frame = 3
Query:  102 DFRVGANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQ----CKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMKKP 980
            +F+ G    + +QC    ++  LC   G    M+    LL +        Q++ W+ LL  +CH D + FLC+++APICL+      ++PC  LC  V++ C P ++ YGF WP +++C KFPL+N   CI +  G+    +  + K                        C  C  +   E +    C    V+R +I  +  +      I  Q K  ++ +    R     L+  I+    C C  L N      G +L+ G   + + ++  + KW +K K  +     +   P
Sbjct:   36 NFQNGRFYTKQSQCIDIPSDLHLCHNVGY-KKMR-LPNLLDHETMPEVKQQASSWVPLLAKRCHRDTQLFLCSLFAPICLE----RPIYPCRSLCEVVRDSCAPVMESYGFPWPEMLNCNKFPLDNDL-CITVQFGSKQVTQPPVTKI-----------------------CTQCEIEQKSETMRVQLCASDFVLRMRIKEVKIENGDRKLIAAQKKKKVLKAGKLKRKEFRKLVLYIKNAASCPCPQLDNL----SGSFLIMGRKVDNKLLLTAIYKWDKKSKDMKYAVNFMYSYP 298          
BLAST of secreted frizzled related protein 3 vs. Ensembl Mouse
Match: Sfrp2 (secreted frizzled-related protein 2 [Source:MGI Symbol;Acc:MGI:108078])

HSP 1 Score: 103.605 bits (257), Expect = 1.506e-24
Identity = 74/286 (25.87%), Postives = 129/286 (45.10%), Query Frame = 3
Query:  135 NQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLE-ILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIH-----SSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMK 974
            + C P  AN  LC G    N       LL +      + Q+  WI L+  +CH D +KFLC+++AP+CL     T + PC  LC  VK++C P +  +GF WP +++C +FP +N   CI L                      +  +L   E+    K C  C  K   +  + +  CK    ++ K+  I    +    I L+ KS  I+     S   ++ S+  L   +QC C  + +  +     +L+ G  + G+ ++  + +WQ+ +++F+ + R + K
Sbjct:   38 SNCKPIPANLQLCHGIEYQNM--RLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDET-IQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDL-CIPLAS--------------------SDHLLPATEEA--PKVCEACKTKNEDDNDIMETLCKNDFALKIKVKEITYINRDT-KIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINA----PYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRK 292          
BLAST of secreted frizzled related protein 3 vs. Ensembl Mouse
Match: Sfrp5 (secreted frizzled-related sequence protein 5 [Source:MGI Symbol;Acc:MGI:1860298])

HSP 1 Score: 88.5817 bits (218), Expect = 3.959e-19
Identity = 71/293 (24.23%), Postives = 119/293 (40.61%), Query Frame = 3
Query:  114 GANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQ----CKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMKKP 980
            G +  +  QC    A+  LC   G    M+    LL +        Q++ W+ LL  +CH D + FLC+++AP+CL       ++PC  LC +V+  C P ++ YGF WP ++ C KFPL+N   CI +  G        + K                        C  C  +   + L +  C    V++ +I  I         I  Q K  ++ +    R     L+  ++    C C  L N      G +L+ G    GQ ++  + +W +K K+ +   + +   P
Sbjct:   41 GRSYSKPPQCLDIPADLPLCHTVGY-KRMR-LPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLD----RPIYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLDNDL-CIAVQFGHLPATAPPVTKI-----------------------CAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIDNGDRKLIGAQKKKKLLKAGPLKRKDTKKLVLHMKNGASCPCPQLDNL----TGSFLVMGRKVEGQLLLTAVYRWDKKNKEMKFAVKFMFSYP 299          
BLAST of secreted frizzled related protein 3 vs. Ensembl Mouse
Match: Sfrp1 (secreted frizzled-related protein 1 [Source:MGI Symbol;Acc:MGI:892014])

HSP 1 Score: 87.8113 bits (216), Expect = 6.394e-19
Identity = 63/244 (25.82%), Postives = 113/244 (46.31%), Query Frame = 3
Query:  252 QSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPI-RISLANLITEIQ----CKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQL 968
            Q++ W+ LL+  CH+  + FLC+++AP+CL       ++PC  LC +V++ C P ++ +GF WP ++ C KFP      CI +T                     N T  S  + T     CP C+ ++  E + ++ C     +R KI  + +K  G   I  + K  +     PI +  L  L+  ++    C C  L N        +L+ G     Q+++  + KW +K K+F++  +++
Sbjct:   93 QASSWVPLLNKNCHMGTQVFLCSLFAPVCLD----RPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFP--EGDVCIAMT-------------------PPNTTEASKPQGTTV---CPPCDNELKSEAIIEHLCASEFALRMKIKEV-KKENGDKKIVPKKKKPLKLG--PIKKKELKRLVLFLKNGADCPCHQLDNLSH----NFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKRM 301          
BLAST of secreted frizzled related protein 3 vs. Ensembl Mouse
Match: Sfrp4 (secreted frizzled-related protein 4 [Source:MGI Symbol;Acc:MGI:892010])

HSP 1 Score: 63.1586 bits (152), Expect = 1.675e-10
Identity = 49/187 (26.20%), Postives = 77/187 (41.18%), Query Frame = 3
Query:  273 LLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVP--LEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKC 827
            L+   C   L  FLC +YAPIC        + PC+ +C   ++ C P +K+Y   WP  + C + P+ ++  CI       +  +         D  + +       + L    C  C +  P     L+KN   YS VI AKI  + +     ++  +  K  I  S  PI  +   LIT   C+C
Sbjct:   64 LVDVNCSSVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERSFDADCKRLSPDRCK-CKKVKPTLATYLSKN---YSYVIHAKIKAVQRSGCNEVTTVVDVK-EIFKSLSPIPRTQVPLITNSSCQC 245          
BLAST of secreted frizzled related protein 3 vs. Ensembl Mouse
Match: Frzb (frizzled-related protein [Source:MGI Symbol;Acc:MGI:892032])

HSP 1 Score: 62.7734 bits (151), Expect = 1.847e-10
Identity = 63/267 (23.60%), Postives = 108/267 (40.45%), Query Frame = 3
Query:  198 MKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCK--YSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKCSILQ-NAKSVSKGKWLLFGDIENGQFIV---KFLTKWQ----RKRKKFRSLFRQL 968
            M      L +S    +I     +  LL T C  DL  FLC +YAPIC    +   + PC+ +C   ++ C P L  Y   WP  + C + P+ ++  CI           +++V     D  ++ +    +  + ++  C       P+    K + +  Y+ VIRAK+  +  K     ++ ++ K  +  S   I     NL T   C C  L  N + V  G    + D E  + ++       KW+    +K K++    R L
Sbjct:   50 MTKMPNHLHHSTQANAILAMEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCEPILIKYRHSWPESLACDELPVYDRGVCIS---------PEAIVTADGADFPMDSSTGHCRGASSERCKCK------PVRATQKTYFRNNYNYVIRAKVKEVKMKCHDVTAV-VEVKEILKASLVNIPRDTVNLYTTSGCLCPPLTVNEEYVIMG----YEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHL 296          
BLAST of secreted frizzled related protein 3 vs. UniProt/SwissProt
Match: sp|Q96HF1|SFRP2_HUMAN (Secreted frizzled-related protein 2 OS=Homo sapiens OX=9606 GN=SFRP2 PE=1 SV=2)

HSP 1 Score: 103.99 bits (258), Expect = 7.517e-24
Identity = 74/284 (26.06%), Postives = 128/284 (45.07%), Query Frame = 3
Query:  141 CYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPIC-NRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIH-----SSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMK 974
            C P  AN  LC G    N       LL +      + Q+  WI L+  +CH D +KFLC+++AP+CL     T + PC  LC  VK++C P +  +GF WP +++C +FP +N   CI L                      +  +L   E+    K C  C N+      + +  CK    ++ K+  I    +    I L+ KS  I+     S   ++ S+  L   +QC C  + +  +     +L+ G  + G+ ++  + +WQ+ +++F+ + R + K
Sbjct:   40 CKPIPANLQLCHGIEYQNM--RLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDET-IQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDL-CIPLAS--------------------SDHLLPATEEA--PKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDT-KIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINA----PYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRK 292          
BLAST of secreted frizzled related protein 3 vs. UniProt/SwissProt
Match: sp|P97299|SFRP2_MOUSE (Secreted frizzled-related protein 2 OS=Mus musculus OX=10090 GN=Sfrp2 PE=1 SV=2)

HSP 1 Score: 103.605 bits (257), Expect = 1.054e-23
Identity = 74/286 (25.87%), Postives = 129/286 (45.10%), Query Frame = 3
Query:  135 NQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLE-ILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIH-----SSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMK 974
            + C P  AN  LC G    N       LL +      + Q+  WI L+  +CH D +KFLC+++AP+CL     T + PC  LC  VK++C P +  +GF WP +++C +FP +N   CI L                      +  +L   E+    K C  C  K   +  + +  CK    ++ K+  I    +    I L+ KS  I+     S   ++ S+  L   +QC C  + +  +     +L+ G  + G+ ++  + +WQ+ +++F+ + R + K
Sbjct:   38 SNCKPIPANLQLCHGIEYQNM--RLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDET-IQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDL-CIPLAS--------------------SDHLLPATEEA--PKVCEACKTKNEDDNDIMETLCKNDFALKIKVKEITYINRDT-KIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINA----PYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRK 292          
BLAST of secreted frizzled related protein 3 vs. UniProt/SwissProt
Match: sp|Q863H1|SFRP2_CANLF (Secreted frizzled-related protein 2 OS=Canis lupus familiaris OX=9615 GN=SFRP2 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.454e-23
Identity = 74/286 (25.87%), Postives = 128/286 (44.76%), Query Frame = 3
Query:  135 NQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPIC-NRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIH-----SSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMK 974
            + C P  AN  LC G    N       LL +      + Q+  WI L+  +CH D +KFLC+++AP+CL     T + PC  LC  VK++C P +  +GF WP +++C +FP +N   CI L                      +  +L   E+    K C  C N+      + +  CK    ++ K+  I    +    I L+ KS  I+     S   ++ S+  L   +QC C  + +  +     +L+ G    G+ ++  + +WQ+ +++F+ + R + K
Sbjct:   37 SNCKPIPANLQLCHGIEYQNM--RLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDET-IQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDL-CIPLAS--------------------SDHLLPATEEA--PKVCEACKNKNEDDNDIMETLCKNDFALKIKVKEITYINRDT-KIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINA----PYLVMGQKLGGELVITSVKRWQKGQREFKRISRSIRK 291          
BLAST of secreted frizzled related protein 3 vs. UniProt/SwissProt
Match: sp|Q9IA96|SFRP2_CHICK (Secreted frizzled-related protein 2 OS=Gallus gallus OX=9031 GN=SFRP2 PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.665e-22
Identity = 75/286 (26.22%), Postives = 122/286 (42.66%), Query Frame = 3
Query:  135 NQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPIC-NRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIH-----SSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMK 974
            + C P  A   LC G     SM+    LL +      + Q+  WI L+  +CH D  KFLC+++AP+C+       + PC  LC  VKE C P +  +GF WP ++DC +FP +N   CI L           ++   RE                  K C  C N+      + +N CK    ++ K+  I     G   I  + KS  I+     +   +R  +  L   +QC C  + +        +L+ G  + G+ ++  L +WQ+ ++ F+   R + K
Sbjct:   35 SNCKPIPAPMLLCRGIEY-QSMR-LPNLLGHETVQEVLEQATTWIPLVQKQCHPDTRKFLCSLFAPVCIDDLDEI-IQPCHSLCEEVKESCAPVMSAFGFPWPDMLDCSRFPKDNDL-CIPLASS------DHILPVTRE----------------APKVCDACKNKNEDDNDIMENLCKNDFALKIKVKEIAYI-NGDTKITPETKSKTIYKLNGLTERDLRKIVLWLKGGLQCTCDEMNDINV----PYLVMGQKQAGELVITSLKRWQKGQRAFKRFSRSIRK 289          
BLAST of secreted frizzled related protein 3 vs. UniProt/SwissProt
Match: sp|Q9XSC1|SFRP5_BOVIN (Secreted frizzled-related protein 5 OS=Bos taurus OX=9913 GN=SFRP5 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 8.573e-20
Identity = 71/293 (24.23%), Postives = 121/293 (41.30%), Query Frame = 3
Query:  114 GANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQ----CKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMKKP 980
            G +  +  QC    A+  LC   G    M+    LL +        Q++ W+ LL  +CH D + FLC+++AP+CL       ++PC  LC +V+  C P ++ YGF WP ++ C KFPL+N   CI +  G        +                        K C  C  +   + L +  C    V++ +I  I  +      I  Q K  ++ S    R     L+  ++    C C  L +      G +L+ G   +GQ ++  + +W +K K+ +   + +   P
Sbjct:   42 GRSYSKPPQCLDIPADLPLCHTVGY-KRMR-LPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLD----RPIYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLDNDL-CIAVQFGHLPATAPPVT-----------------------KICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKSGPLKRKDTKRLVLHMKNSAGCPCPQLDSL----AGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFMFSYP 300          
BLAST of secreted frizzled related protein 3 vs. TrEMBL
Match: E3UZJ5 (Secreted frizzled related protein 3 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 723.391 bits (1866), Expect = 0.000e+0
Identity = 370/370 (100.00%), Postives = 370/370 (100.00%), Query Frame = 3
Query:   45 MRLIGXXXXXXXXXXXXXXDFRVGANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMKKPKFFCKNRNKLLNIVNNQFKPNENLIQKSETKTENNQPEYSIYSNPFIYKNDLKKFSDK 1154
            MRLIGSLLVLLVLVSLFSVDFRVGANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMKKPKFFCKNRNKLLNIVNNQFKPNENLIQKSETKTENNQPEYSIYSNPFIYKNDLKKFSDK
Sbjct:    1 MRLIGSLLVLLVLVSLFSVDFRVGANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMKKPKFFCKNRNKLLNIVNNQFKPNENLIQKSETKTENNQPEYSIYSNPFIYKNDLKKFSDK 370          
BLAST of secreted frizzled related protein 3 vs. TrEMBL
Match: D3J1K3 (Secreted frizzled-related protein (Fragment) OS=Schmidtea polychroa OX=50054 GN=sFRP PE=2 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 2.643e-43
Identity = 91/301 (30.23%), Postives = 149/301 (49.50%), Query Frame = 3
Query:  102 DFRVGANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENG-QFIVKFLTKWQRKRKKFRSLFRQLMKKPKFFCKNR 1001
            D++   +   ++QCY    N TLC   G +  +      +++     +   S +W+ L++T+CH D++KF+C++YAP+C+   R  +V PC ELC +VKE CLP +K+YGF+WP+I+ C KFP    + CI  T   G                               K C +C +    E++   FC   +VIRAKI  I      AI I LQ KS  +        S   L  E++C C+ L+  +   KG+W++   I+ G + +V F++KW+RK+ +F+   + +       CK++
Sbjct:    2 DWQAFQSGYTIDQCYQIPDNFTLCSNVGYMRMV--LPNYIQHESIEEAAQHSKVWMGLVNTQCHADIKKFICSLYAPVCISNQRIQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPG-------------------------------KKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTNGNAIQIILQKKSKFL--KFQANFSQNALELELKCNCTNLKFKQRALKGRWIIMAQIDRGNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSK 267          
BLAST of secreted frizzled related protein 3 vs. TrEMBL
Match: D0VYP5 (Secreted frizzled-related protein A (Fragment) OS=Dugesia japonica OX=6161 GN=DjsFRP-A PE=2 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 4.472e-42
Identity = 90/290 (31.03%), Postives = 144/290 (49.66%), Query Frame = 3
Query:  132 LNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMKKPKFFCKNR 1001
            +NQCY    N +LC   G  N M      +++     +   S +WI L++T+CH+D+ KF+C +YAP+C+   R  +V PC ELC +VKE CLP +K+YGF+WP+I+ C KFP    + CI  T                                + +KNC +C +    E++   FC   +VIRAKI  I       + I LQ KS  +  S     S  +L   ++C C+ L+  +   KG+W++   +   + +V F+TKW+RK+ +F+   + +       CK++
Sbjct:   19 INQCYRIPNNFSLCRDVG-YNRM-VLPNYIQHESIEEAAQHSRVWIGLVNTQCHIDIRKFICCLYAPVCISNQRIQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFQNSLCIPRT-------------------------------IVPEKNCDLCIKNPSYEVIANRFCLSPIVIRAKIKRIIPIGSKEMQIILQKKSKFLKFSA--NFSQNDLNLRLKCNCTNLKFKQRALKGRWIIMAKLNKNEAVVNFITKWKRKKAEFKHSMKIIQNFGHIVCKSK 273          
BLAST of secreted frizzled related protein 3 vs. TrEMBL
Match: B0LMG1 (Secreted frizzled-related protein 1 OS=Schmidtea mediterranea OX=79327 GN=sfrp1 PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 9.055e-42
Identity = 90/301 (29.90%), Postives = 148/301 (49.17%), Query Frame = 3
Query:  102 DFRVGANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIE-NGQFIVKFLTKWQRKRKKFRSLFRQLMKKPKFFCKNR 1001
            D++   +   ++QCY    N TLC   G    +      +++     +   S +W+ L++T+CHVD++KF+C++YAP+C+   R  +V PC ELC +VKE CLP +K+YGF+WP+I+ C KFP    + CI  T   G                               K C +C +    E++   FC   +VIRAKI  I      AI I LQ KS  +        S   L   ++C C+ L+  +   KG+W++   I+ + + +V F++KW+RK+ +F+   + +       CK++
Sbjct:   24 DWQAFQSGYTIDQCYQIPDNFTLCSNVGY--RLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPG-------------------------------KKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFL--KFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSK 289          
BLAST of secreted frizzled related protein 3 vs. TrEMBL
Match: B1NWW1 (Secreted frizzled protein-like protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=SFRP-a PE=2 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 3.285e-41
Identity = 89/301 (29.57%), Postives = 147/301 (48.84%), Query Frame = 3
Query:  102 DFRVGANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIE-NGQFIVKFLTKWQRKRKKFRSLFRQLMKKPKFFCKNR 1001
            D++   +   ++QCY    N TLC   G    +      +++     +   S +W+ L++T+CHVD++KF+C++YAP+C+   R  +  PC ELC +VKE CLP +K+YGF+WP+I+ C KFP    + CI  T   G                               K C +C +    E++   FC   +VIRAKI  I      AI I LQ KS  +        S   L   ++C C+ L+  +   KG+W++   I+ + + +V F++KW+RK+ +F+   + +       CK++
Sbjct:    2 DWQAFQSGYTIDQCYQIPDNFTLCSNVGY--RLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKAPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPG-------------------------------KKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFL--KFQANFSQNALGLNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSK 267          
BLAST of secreted frizzled related protein 3 vs. Ensembl Cavefish
Match: sfrp5 (secreted frizzled related protein 5 [Source:NCBI gene;Acc:103037681])

HSP 1 Score: 106.686 bits (265), Expect = 1.058e-25
Identity = 74/293 (25.26%), Postives = 128/293 (43.69%), Query Frame = 3
Query:  102 DFRVGANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQ----CKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQL 968
            +F  G    +  QC     +  LC   G    M+    LL +      + Q+  W+ LL  +CH D + FLC+++AP+CL       ++PC  LC +V++ C P ++ YGF WP ++ C KFP +N   CI +                       Q  ++   QT   K CP C+ ++  E + ++FC    V++ KI  + ++      I  Q K  ++      +  L  L   ++    C CS L N  S     +L+ G   + Q ++  + KW +K K+ +   + +
Sbjct:   42 NFHNGRFYAKQPQCVDIPVDLRLCYTVGY-KKMR-LPNLLDHETMPEVLQQAGSWVPLLAKRCHADTQVFLCSLFAPVCLD----RPIYPCRSLCEAVRDSCAPVMETYGFPWPEMLQCDKFPYDNDL-CITM-----------------------QFSMNHATQTPVSKACPPCDNELKSETVMEHFCASDFVLKMKIKEVKKEKGDRKLIAAQKKKKVLKMGILRKKDLKKLTLYLKNGANCPCSQLDNLGS----NFLIMGRKVDQQLLLMSIHKWDKKSKELKYAIKYM 300          
BLAST of secreted frizzled related protein 3 vs. Ensembl Cavefish
Match: sfrp5 (secreted frizzled related protein 5 [Source:NCBI gene;Acc:103037681])

HSP 1 Score: 102.064 bits (253), Expect = 5.392e-24
Identity = 73/294 (24.83%), Postives = 128/294 (43.54%), Query Frame = 3
Query:  102 DFRVGANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKK-NCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQ----CKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQL 968
            +F  G    +  QC     +  LC   G    M+    LL +      + Q+  W+ LL  +CH D + FLC+++AP+CL       ++PC  LC +V++ C P ++ YGF WP ++ C KFP +N   CI +                       Q  ++   QT  +   CP C+ ++  E + ++FC    V++ KI  + ++      I  Q K  ++      +  L  L   ++    C CS L N  S     +L+ G   + Q ++  + KW +K K+ +   + +
Sbjct:   38 NFHNGRFYAKQPQCVDIPVDLRLCYTVGY-KKMR-LPNLLDHETMPEVLQQAGSWVPLLAKRCHADTQVFLCSLFAPVCLD----RPIYPCRSLCEAVRDSCAPVMETYGFPWPEMLQCDKFPYDNDL-CITM-----------------------QFSMNHATQTPGRTFTCPPCDNELKSETVMEHFCASDFVLKMKIKEVKKEKGDRKLIAAQKKKKVLKMGILRKKDLKKLTLYLKNGANCPCSQLDNLGS----NFLIMGRKVDQQLLLMSIHKWDKKSKELKYAIKYM 297          
BLAST of secreted frizzled related protein 3 vs. Ensembl Cavefish
Match: ENSAMXT00000011888.2 (secreted frizzled-related protein 2-like [Source:NCBI gene;Acc:103024223])

HSP 1 Score: 98.5969 bits (244), Expect = 9.273e-23
Identity = 77/287 (26.83%), Postives = 121/287 (42.16%), Query Frame = 3
Query:  141 CYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEI-LTKNFCKYSLVIRAKI-------ANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMKK 977
            C P  +   LC G G   SM+    LL +     +  Q+  W+ LL  +CH D  KFLC+++AP CL       V PC  LC +V++ CLP +  +GF WP   +C +FP                  K+ L     ED     T  +D+   L    C  C+     E  + KNFC      + +I       +++   P+G   + L+ + +       +  S   L     C C  L+  K V  G  L  G++  G+ ++  L KW R  K+ +   R+L ++
Sbjct:   52 CKPLPSTMGLCHGIG-YESMR-LPNLLGHDTVKEAQQQAGAWVPLLTKRCHSDTRKFLCSLFAPACLV-ELTVAVPPCRSLCVAVRDGCLPVMSAFGFPWPEAFNCSRFP-----------------HKEELCIPGAEDAGHVDTSETDKGTVL----CDACSLASEAESEIQKNFCSSQFAFKLQIGSSSLEGSDLRVVPQGRSRV-LRWEGSEQEQQAAMEQSALWLPEAANCSCQALEG-KPV--GSMLALGNMYKGRMVLARLVKWSRSEKELKKFIRKLTRQ 310          
BLAST of secreted frizzled related protein 3 vs. Ensembl Cavefish
Match: sfrp2 (secreted frizzled related protein 2 [Source:NCBI gene;Acc:103033411])

HSP 1 Score: 97.0561 bits (240), Expect = 2.408e-22
Identity = 63/262 (24.05%), Postives = 115/262 (43.89%), Query Frame = 3
Query:  207 FSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEI-LTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIH-----SSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMK 974
               LL +      + Q+  W+ L+  +CH D  KFLC+++AP+CL       + PC  LC +V+  C P +  +GF WP ++ C +FP ++   CI   D                  + N+T+          K C  C  K+  +  +  + CK    ++ K+  I     G   I  + KS  I+     +   +R +   L   +QC C  + +  S     +L+ G  ++G  ++  L +WQ+ +++F+ + R + K
Sbjct:   58 LPNLLGHEAMSEVLQQAASWVPLVQKRCHPDTRKFLCSLFAPVCLPDVD-EPIRPCRSLCEAVRHGCAPVMAAFGFPWPEMLRCSRFPPDDDL-CIPAGDNG------------ERATAANETV---------PKVCDACKEKIEDDSEMVDSLCKNDFALKIKVKEITYM-NGDTKIIPETKSKTIYKLNGVTERDLRKTALLLKDGLQCSCEEMNDINSA----YLVMGQKQDGNLVITSLKRWQKGQREFKRISRSIRK 291          
BLAST of secreted frizzled related protein 3 vs. Ensembl Cavefish
Match: sfrp1a (secreted frizzled related protein 1 [Source:NCBI gene;Acc:103030300])

HSP 1 Score: 88.1965 bits (217), Expect = 3.983e-19
Identity = 66/280 (23.57%), Postives = 116/280 (41.43%), Query Frame = 3
Query:  138 QCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSS---HPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQL 968
            QC     +  LC G G  N M+    LL +        Q+  W+ L+H  CH   + FLC+++ P+CL       ++PC  LC  V++ C P ++ +GF WP ++ C KFP      C+   + + + L   +                          CP C+ +V  + +  + C    VI+ KI  + ++      I  + K  +   +     ++  +  L     C CS L N  +     +L+ G   + Q I+  + KW +  K+FR   +Q+
Sbjct:   51 QCLEIPDDLRLCHGVG-YNQMR-LPNLLEHETMAEVKQQAGSWVPLVHKNCHPSTQVFLCSLFTPVCLD----QPIYPCRWLCEDVRDACTPIMQAFGFPWPEMLTCNKFP--EGDVCLSAPNASESALPNGV-----------------------SPICPPCDHEV--DAILDHICASEFVIKTKIKEVKRENNDRKVILQKKKKTLKQGTLKKKDMKKLILYLKNGADCPCSQLDNLNN----NYLIMGRKVDKQHIITGIHKWDKSSKEFRQTMKQM 293          
BLAST of secreted frizzled related protein 3 vs. Ensembl Sea Lamprey
Match: frzb (frizzled related protein [Source:ZFIN;Acc:ZDB-GENE-990715-1])

HSP 1 Score: 70.4774 bits (171), Expect = 6.780e-14
Identity = 57/234 (24.36%), Postives = 97/234 (41.45%), Query Frame = 3
Query:  273 LLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQ-----LTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKCS--------ILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRK 935
            LL T+C   L  FLC +YAPIC    +   + PC+ +C + ++ C P ++ Y  +WP  + C + P+  +A CI           G   + + V+   ++R L     S   Q  +        RK+     T     Y+ VIRA++ ++ +     I   ++ K  I  S   I     +L T   C C         I+   +   + + LLF    +G    K+  +W +K
Sbjct:   66 LLDTQCSAVLRFFLCAMYAPICTIEFQTDPIKPCKAVCEAARDACRPVMRQYNHDWPESMACDELPVYERAVCISPEAIVTVMPEGELTRSATVEMVNKERHLYLICASISPQRCK-------CRKIKANQKTYTAKNYNYVIRARVKDVHRSGCSEIQTTVEVKDVIKSSGVSISRGDVHLYTNSSCLCPELLTADEYIIMGYEDRMRTRLLLF----DGCVAEKWKERWGKK 288          
BLAST of secreted frizzled related protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011009.1 (pep scaffold:Pmarinus_7.0:GL485859:2701:4509:1 gene:ENSPMAG00000009982.1 transcript:ENSPMAT00000011009.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 3.074e-10
Identity = 28/81 (34.57%), Postives = 46/81 (56.79%), Query Frame = 3
Query:  231 KSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPL 473
            ++G  ++Q   W  L+  KC  DL  FLC++Y PICL+ ++   + PC  +C   +  C P ++ YGF WP  + C + P+
Sbjct:   38 EAGLEVHQ--FWP-LVEIKCSPDLRFFLCSMYTPICLEDYK-QPLPPCRSVCERARAGCAPLMRQYGFAWPDRMRCDRLPV 114          
BLAST of secreted frizzled related protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007205.1 (pep scaffold:Pmarinus_7.0:GL478722:26071:28329:-1 gene:ENSPMAG00000006510.1 transcript:ENSPMAT00000007205.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 7.093e-9
Identity = 36/123 (29.27%), Postives = 58/123 (47.15%), Query Frame = 3
Query:  111 VGANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLEN 479
            VGA R     C P  A   LC G G  N+ +  + L   S++   + Q   +  L+   C   L+ FLC ++ P+C +      + PC  +C +V+ +C P L  + + WP  + C +FP  N
Sbjct:   32 VGARR-----CEPIRA--ALCQGLG-YNATRVPNPLGHESQADAEL-QLQTFTPLVQYGCSAQLQFFLCAVHFPLCAEAVP-EPIGPCAGMCRAVRRRCEPVLVDFQYAWPPALACDRFPTHN 144          
BLAST of secreted frizzled related protein 3 vs. Ensembl Sea Lamprey
Match: fzd2 (frizzled class receptor 2 [Source:ZFIN;Acc:ZDB-GENE-990415-224])

HSP 1 Score: 54.299 bits (129), Expect = 2.877e-8
Identity = 27/95 (28.42%), Postives = 47/95 (49.47%), Query Frame = 3
Query:  198 MKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENK 482
            M    G      +G  ++Q   +  L+  +C  DL+ FLC++YAP+C    +   + PC  LC   ++ C   +  +GF+WP  + C  FP++  
Sbjct:   31 MPNLLGHTNQEDAGLEVHQ---FYPLVKVQCSPDLKFFLCSMYAPVCTVLEK--AIPPCRSLCDRARQGCEALMNKFGFQWPERLRCENFPVQGS 120          
BLAST of secreted frizzled related protein 3 vs. Ensembl Sea Lamprey
Match: fzd7a (frizzled class receptor 7a [Source:ZFIN;Acc:ZDB-GENE-990415-223])

HSP 1 Score: 53.9138 bits (128), Expect = 4.144e-8
Identity = 27/95 (28.42%), Postives = 46/95 (48.42%), Query Frame = 3
Query:  198 MKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENK 482
            M    G      +G  ++Q   +  L+  +C  DL+ FLC++YAP+C        + PC  LC   ++ C   +  +GF+WP  + C  FP++  
Sbjct:   75 MPNLLGHTNQEDAGLEVHQ---FYPLVKVQCSPDLKFFLCSMYAPVCTVLEE--AIPPCRSLCERARQGCETLMNKFGFQWPERLRCENFPVQGS 164          
BLAST of secreted frizzled related protein 3 vs. Ensembl Nematostella
Match: EDO46557 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPS6])

HSP 1 Score: 68.1662 bits (165), Expect = 6.915e-13
Identity = 56/240 (23.33%), Postives = 105/240 (43.75%), Query Frame = 3
Query:  264 WIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQK-PKG------AISIRLQHKSNIIHSSHPIRISL---ANLITEIQCKCSILQNAKS-VSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFR 950
            W  L+ + C   L+ FLC+++ P+C++   +  V PC  LC SV++ C P +KI+ + WP++ DC K+ L++   C+ L +        +      +D  +N+    D+ +                      +C  +  I+A++    ++ PKG       + +    K ++  S  P+R+ L   AN        C I+  A   + K   L+ G  +  +  + FL KW +K+   R
Sbjct:   70 WAPLVGSGCSPHLKVFLCSVFMPVCVQQISYP-VPPCHSLCTSVRDSCEPVMKIHNYSWPAMFDCSKY-LKDDMMCVPLPETPNPTTPSTPSVCGGDDDKVNE----DEARI--------------------KYCNGNFAIKARLQEHPKRAPKGNNLTVLKVKVLKVLKGDVTKSRKPLRLRLPFDAN-------SCDIISKANGKIMKKPLLIIGSKKGKRLNISFLLKWPKKKATRR 276          
BLAST of secreted frizzled related protein 3 vs. Ensembl Nematostella
Match: EDO32500 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUU2])

HSP 1 Score: 62.3882 bits (150), Expect = 3.175e-12
Identity = 29/88 (32.95%), Postives = 50/88 (56.82%), Query Frame = 3
Query:  231 KSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCI 494
            ++G  ++Q   ++ L+   C   L +FLC  YAP C    +   V PC  +C +V+  C   +K +GF+WP  ++C KFP E+++ C+
Sbjct:   32 EAGLIVHQ---FVPLVKVNCSEMLSRFLCFTYAPFCTVLMK--PVLPCRSMCRAVRRGCETLMKRFGFDWPETLNCKKFPRESRSICV 114          
BLAST of secreted frizzled related protein 3 vs. Ensembl Nematostella
Match: EDO35751 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKM6])

HSP 1 Score: 63.929 bits (154), Expect = 4.029e-11
Identity = 43/170 (25.29%), Postives = 74/170 (43.53%), Query Frame = 3
Query:  132 LNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVP 641
            L +C P      LC   G+  +M  F   L++     +  + + +  L+   C  DL  FLC++YAP+C      T + PC  LC +V+  C   +K +GF WP  + C +FP      C+          + +      +D  +N     D + +  +  CP  ++K+P
Sbjct:   26 LKRCEP--VTIPLC--TGLQYNMTIFPNTLKHRTQEEAALEVHQFFPLVKVDCSKDLAFFLCSVYAPVCTVLE--TPLPPCRSLCLTVRSGCEGLMKRFGFTWPDSLSCERFPKLGDEICVG---------ENTTTPTSDQDGGINNNTYPDVDMSTMRYRCPE-SQKIP 179          
BLAST of secreted frizzled related protein 3 vs. Ensembl Nematostella
Match: EDO42932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S003])

HSP 1 Score: 59.3066 bits (142), Expect = 1.293e-9
Identity = 26/66 (39.39%), Postives = 37/66 (56.06%), Query Frame = 3
Query:  273 LLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFP 470
            L+  +C  DL  FLC++YAP+C K H    + PC  +C   +  C P ++ YGF WP  + C  FP
Sbjct:   69 LVEIQCSPDLRFFLCSMYAPLCEK-HYDKDLPPCRSVCERARTGCAPLMRKYGFSWPERMKCENFP 133          
BLAST of secreted frizzled related protein 3 vs. Ensembl Nematostella
Match: EDO38567 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCF4])

HSP 1 Score: 55.4546 bits (132), Expect = 2.260e-8
Identity = 21/66 (31.82%), Postives = 36/66 (54.55%), Query Frame = 3
Query:  273 LLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFP 470
            L+   C   L  FLC+++ P+C K      ++ C  +C S ++ C P ++ +GF WP  +DC + P
Sbjct:   72 LIAVNCAPLLRFFLCSVFVPMCTKEVN-VPIYACRSMCESARDGCSPMMQRFGFNWPDTLDCDRLP 136          
BLAST of secreted frizzled related protein 3 vs. Ensembl Medaka
Match: sfrp1 (secreted frizzled related protein 1 [Source:NCBI gene;Acc:100049476])

HSP 1 Score: 101.293 bits (251), Expect = 8.625e-24
Identity = 68/292 (23.29%), Postives = 130/292 (44.52%), Query Frame = 3
Query:  105 FRVGANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQ----CKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQL 968
            +  G    +  QC     +  LC   G    +     LL +        Q++ W+ L+H  CH D + FLC ++AP+C++      ++PC  LC +V++ C P ++ +GF WP ++ C KFP +    CI +T                +  +   T  S          CP C+ ++  + + +N C     ++AKI  + Q+      I LQ +  ++   +  +  L  L   ++    C C  L+N ++    ++L+ G   + QF++  + KW +  K+F+ + ++L
Sbjct:   36 YNGGRGYGKAPQCVDIPDDLRLCHTVGYTQML--LPNLLEHETMAEVKQQASSWVPLVHKNCHKDTQVFLCALFAPVCME----RPIYPCRWLCETVRDGCSPIMEAFGFPWPEMLTCDKFPQD--GVCIAVT----------------QPNATEATWPSGHSPA-----CPPCDNEIKNDAMLENICASEFALKAKIKEVKQENMDRKVI-LQRRKRMVKQGNLKKRDLKKLTLYLKNGANCPCQQLENLEN----QYLIMGRKVDKQFLLTGIHKWDKSSKEFKKIMKKL 293          
BLAST of secreted frizzled related protein 3 vs. Ensembl Medaka
Match: ENSORLT00000011365.2 (pep primary_assembly:ASM223467v1:7:14585088:14586426:-1 gene:ENSORLG00000009063.2 transcript:ENSORLT00000011365.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.0485 bits (227), Expect = 7.767e-21
Identity = 67/280 (23.93%), Postives = 120/280 (42.86%), Query Frame = 3
Query:  135 NQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLIT---EIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQ 965
            ++C P  ++  LC   G  ++M+    LL +     ++ QS  W+ LL  +CH D   FLC+++APICL       + PC  LC SV++ C P +  YG+ WP I+ C ++P E+      +T+ T N         QR   S               ++C +     P + L ++FCK   V + ++  +   P       L  K +++     +   + + I    E    C      +    G +L+ G ++  + +V     WQR+ +   +  R+
Sbjct:    9 SRCVPIPSDMALCQNIGY-DTMR-MPNLLGHESLAEAVQQSTSWLPLLARECHPDARSFLCSLFAPICLDF-----ISPCRSLCESVRDSCAPIMSCYGYPWPEILRCDQYPAEHLVCISSITNATVN------TDGQRPQASC--------------RDCELEKPSSPKDTL-ESFCKSDFV-KLRLTRLKYSPASLSQFSLTTKLDVLKQGPLVGGQIRSRIELWLERDATCVRNMTRQHPRGGTFLVTGTVQGERLVVNKAYAWQRQNRNLMAAARK 259          
BLAST of secreted frizzled related protein 3 vs. Ensembl Medaka
Match: sfrp2 (secreted frizzled related protein 2 [Source:NCBI gene;Acc:101159245])

HSP 1 Score: 89.3521 bits (220), Expect = 1.056e-19
Identity = 67/261 (25.67%), Postives = 117/261 (44.83%), Query Frame = 3
Query:  207 FSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIH-----SSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMK 974
               LL +      + Q+  WI L+  +CH D  KFLC+++AP+CL       + PC  LC SVK  C P +  +GF WP ++DC +FP ++   CI   D       ++LV    E       +    ++T +K N          EI+  + CK    ++ K+ +I    +    I  + KS II+     +   +R     L   +QC C  + +  +     +L+ G       ++  L +WQ+ +++F+ + R + K
Sbjct:   55 LPNLLGHETMTEVLQQAASWIPLVQKQCHPDTRKFLCSLFAPVCLDDLD-EPIQPCRSLCESVKRGCAPVMSAFGFPWPKMLDCERFPPDDDL-CIPPVDS------ENLVPVTEE----APRVCDACKETDEKDN----------EIV-DSLCKNDFAMKIKVKDISYINRDT-KIVPETKSKIIYMVNGVTERDLRKMPLLLRDGMQCICEEMNDINTA----YLVMGQKTESHLVITSLKRWQKGQREFKRISRSVRK 287          
BLAST of secreted frizzled related protein 3 vs. Ensembl Medaka
Match: sfrp5 (secreted frizzled related protein 5 [Source:NCBI gene;Acc:101162946])

HSP 1 Score: 89.7373 bits (221), Expect = 1.148e-19
Identity = 59/237 (24.89%), Postives = 107/237 (45.15%), Query Frame = 3
Query:  252 QSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQ----CKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFR 950
            Q+  W+ LL  +CH D + FLC+++AP+CL       ++PC  LC +V+  C P ++ YGF WP ++ C KFP++N   CI +    GN+   +L    +     +  + +D                     + +++C    V++ KI  + ++      I  Q K  ++      +  L  L   I+    C CS L +  S     +L+ G   + Q ++  + KW +K K+ +
Sbjct:   96 QAGSWVPLLAKRCHADTQVFLCSLFAPVCLD----RPIYPCRSLCEAVRNSCAPVMETYGFPWPDMLTCDKFPIDNDL-CIPMQ-FAGNH--ATLPPVPKVCPPCDNELKTDN--------------------IMEHYCASDFVLKMKIKEVKKEKADRKLIAAQKKKKVLKQGVLRKKDLKKLTLYIKNGANCPCSQLDSLGS----HFLVMGRKVDQQLLLMSIHKWDKKSKELK 300          
BLAST of secreted frizzled related protein 3 vs. Ensembl Medaka
Match: ENSORLT00000013981.2 (secreted frizzled-related protein 2 [Source:NCBI gene;Acc:101171428])

HSP 1 Score: 88.9669 bits (219), Expect = 2.996e-19
Identity = 69/279 (24.73%), Postives = 117/279 (41.94%), Query Frame = 3
Query:  252 QSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEI-LTKNFC--KYSLVIRAKIANIFQKPK--------------GAISIRLQH-KSNIIHSS--------------HPIRISLANLITEIQCKCSILQNAKSVSK---GKWLL-FGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMKKP 980
            QS  W+ L+   CH D +KFLC+++AP+CL       V PC  LC +V++ C+P +  +GF WP + +C +FP      CI  T       ++ +    R + +L  +I+           C +C+  V  E  + +NFC   Y+L +R    +   + +              G  + R+Q   S +++ +                 R+       E Q      ++   V K   G W L     E G+ ++  L +W R  ++ R   R L+KKP
Sbjct:   72 QSAAWLPLVSKLCHGDTKKFLCSLFAPVCLP-ELSGPVSPCRGLCEAVRDGCVPVMSAFGFPWPEMFNCSRFP-HGTELCIPATGAREGRTEEEV----RHEEALKGSII-----------CDVCSLAVEGESEIQENFCHSPYALKMRLDSVSTVGRDRQLVPHARSRILRWAGGGAERVQEFGSAMVYGALWLQEGGSCICPGLDAARVKEDAESAEGQVDGKQSKDGGKVEKAASGGWFLSLAQAEEGRLVLTRLLRWTRGERELRKFIRSLIKKP 333          
BLAST of secreted frizzled related protein 3 vs. Planmine SMEST
Match: SMESG000058717.1 (SMESG000058717.1)

HSP 1 Score: 718.768 bits (1854), Expect = 0.000e+0
Identity = 368/370 (99.46%), Postives = 369/370 (99.73%), Query Frame = 3
Query:   45 MRLIGXXXXXXXXXXXXXXDFRVGANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMKKPKFFCKNRNKLLNIVNNQFKPNENLIQKSETKTENNQPEYSIYSNPFIYKNDLKKFSDK 1154
            MRLIGSLLV+LVLVSLFSVDFRVGANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMKKPKFFCKNRNKLLNIVNNQFKPNE LIQKSETKTENNQPEYSIYSNPFIYKNDLKKFSDK
Sbjct:    1 MRLIGSLLVILVLVSLFSVDFRVGANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMKKPKFFCKNRNKLLNIVNNQFKPNEKLIQKSETKTENNQPEYSIYSNPFIYKNDLKKFSDK 370          
BLAST of secreted frizzled related protein 3 vs. Planmine SMEST
Match: SMESG000075831.1 (SMESG000075831.1)

HSP 1 Score: 160.614 bits (405), Expect = 1.524e-45
Identity = 90/301 (29.90%), Postives = 148/301 (49.17%), Query Frame = 3
Query:  102 DFRVGANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIE-NGQFIVKFLTKWQRKRKKFRSLFRQLMKKPKFFCKNR 1001
            D++   +   ++QCY    N TLC   G    +      +++     +   S +W+ L++T+CHVD++KF+C++YAP+C+   R  +V PC ELC +VKE CLP +K+YGF+WP+I+ C KFP    + CI  T   G                               K C +C +    E++   FC   +VIRAKI  I      AI I LQ KS  +        S   L   ++C C+ L+  +   KG+W++   I+ + + +V F++KW+RK+ +F+   + +       CK++
Sbjct:   24 DWQAFQSGYTIDQCYQIPDNFTLCSNVGY--RLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPG-------------------------------KKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSDNAIQIILQKKSKFL--KFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSK 289          
BLAST of secreted frizzled related protein 3 vs. Planmine SMEST
Match: SMESG000029446.1 (SMESG000029446.1)

HSP 1 Score: 160.614 bits (405), Expect = 1.524e-45
Identity = 90/301 (29.90%), Postives = 148/301 (49.17%), Query Frame = 3
Query:  102 DFRVGANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIE-NGQFIVKFLTKWQRKRKKFRSLFRQLMKKPKFFCKNR 1001
            D++   +   ++QCY    N TLC   G    +      +++     +   S +W+ L++T+CHVD++KF+C++YAP+C+   R  +V PC ELC +VKE CLP +K+YGF+WP+I+ C KFP    + CI  T   G                               K C +C +    E++   FC   +VIRAKI  I      AI I LQ KS  +        S   L   ++C C+ L+  +   KG+W++   I+ + + +V F++KW+RK+ +F+   + +       CK++
Sbjct:   24 DWQAFQSGYTIDQCYQIPDNFTLCSNVGY--RLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPG-------------------------------KKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSDNAIQIILQKKSKFL--KFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSK 289          
BLAST of secreted frizzled related protein 3 vs. Planmine SMEST
Match: SMESG000029446.1 (SMESG000029446.1)

HSP 1 Score: 160.614 bits (405), Expect = 1.563e-45
Identity = 90/301 (29.90%), Postives = 148/301 (49.17%), Query Frame = 3
Query:  102 DFRVGANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIE-NGQFIVKFLTKWQRKRKKFRSLFRQLMKKPKFFCKNR 1001
            D++   +   ++QCY    N TLC   G    +      +++     +   S +W+ L++T+CHVD++KF+C++YAP+C+   R  +V PC ELC +VKE CLP +K+YGF+WP+I+ C KFP    + CI  T   G                               K C +C +    E++   FC   +VIRAKI  I      AI I LQ KS  +        S   L   ++C C+ L+  +   KG+W++   I+ + + +V F++KW+RK+ +F+   + +       CK++
Sbjct:   22 DWQAFQSGYTIDQCYQIPDNFTLCSNVGY--RLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPG-------------------------------KKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSDNAIQIILQKKSKFL--KFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSK 287          
BLAST of secreted frizzled related protein 3 vs. Planmine SMEST
Match: SMESG000075831.1 (SMESG000075831.1)

HSP 1 Score: 151.369 bits (381), Expect = 1.591e-42
Identity = 81/251 (32.27%), Postives = 129/251 (51.39%), Query Frame = 3
Query:  252 QSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIE-NGQFIVKFLTKWQRKRKKFRSLFRQLMKKPKFFCKNR 1001
             S +W+ L++T+CHVD++KF+C++YAP+C+   R  +V PC ELC +VKE CLP +K+YGF+WP+I+ C KFP    + CI  T   G                               K C +C +    E++   FC   +VIRAKI  I      AI I LQ KS  +        S   L   ++C C+ L+  +   KG+W++   I+ + + +V F++KW+RK+ +F+   + +       CK++
Sbjct:   18 HSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPG-------------------------------KKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSDNAIQIILQKKSKFL--KFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSK 235          
The following BLAST results are available for this feature:
BLAST of secreted frizzled related protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SFRP21.565e-2426.06secreted frizzled related protein 2 [Source:HGNC S... [more]
SFRP51.016e-1823.89secreted frizzled related protein 5 [Source:HGNC S... [more]
SFRP11.183e-1823.89secreted frizzled related protein 1 [Source:HGNC S... [more]
SFRP41.107e-1127.27secreted frizzled related protein 4 [Source:HGNC S... [more]
FRZB4.786e-1024.20frizzled related protein [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of secreted frizzled related protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sfrp-12.164e-1724.23Secreted Frizzled-Related Protein [Source:UniProt... [more]
sfrp-12.732e-1723.47Secreted Frizzled-Related Protein [Source:UniProt... [more]
mig-14.328e-1346.38Transmembrane receptor [Source:UniProtKB/TrEMBL;A... [more]
mig-14.576e-1346.38Transmembrane receptor [Source:UniProtKB/TrEMBL;A... [more]
mom-52.166e-1240.45pep chromosome:WBcel235:I:9965580:9970037:1 gene:W... [more]
back to top
BLAST of secreted frizzled related protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fz41.173e-1142.03gene:FBgn0027342 transcript:FBtr0071017[more]
fz41.173e-1142.03gene:FBgn0027342 transcript:FBtr0071018[more]
fz21.221e-830.77gene:FBgn0016797 transcript:FBtr0112890[more]
fz21.221e-830.77gene:FBgn0016797 transcript:FBtr0075029[more]
fz21.221e-830.77gene:FBgn0016797 transcript:FBtr0332735[more]
back to top
BLAST of secreted frizzled related protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sfrp56.872e-2525.78secreted frizzled-related protein 5 [Source:ZFIN;A... [more]
sfrp21.569e-2325.17secreted frizzled-related protein 2 [Source:ZFIN;A... [more]
sfrp21.569e-2325.17secreted frizzled-related protein 2 [Source:ZFIN;A... [more]
sfrp1a5.416e-2122.65secreted frizzled-related protein 1a [Source:ZFIN;... [more]
sfrp2l8.479e-2023.40secreted frizzled-related protein 2 like [Source:Z... [more]
back to top
BLAST of secreted frizzled related protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frzb28.091e-2328.06frizzled related protein 2 [Source:NCBI gene;Acc:5... [more]
sfrpx1.450e-2223.61secreted frizzled-related protein [Source:NCBI gen... [more]
sfrp11.806e-2225.52Xenopus tropicalis secreted frizzled-related prote... [more]
sfrp27.822e-2124.13secreted frizzled-related protein 2 [Source:NCBI g... [more]
sfrp51.548e-1924.24secreted frizzled-related protein 5 [Source:NCBI g... [more]
back to top
BLAST of secreted frizzled related protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sfrp21.506e-2425.87secreted frizzled-related protein 2 [Source:MGI Sy... [more]
Sfrp53.959e-1924.23secreted frizzled-related sequence protein 5 [Sour... [more]
Sfrp16.394e-1925.82secreted frizzled-related protein 1 [Source:MGI Sy... [more]
Sfrp41.675e-1026.20secreted frizzled-related protein 4 [Source:MGI Sy... [more]
Frzb1.847e-1023.60frizzled-related protein [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of secreted frizzled related protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96HF1|SFRP2_HUMAN7.517e-2426.06Secreted frizzled-related protein 2 OS=Homo sapien... [more]
sp|P97299|SFRP2_MOUSE1.054e-2325.87Secreted frizzled-related protein 2 OS=Mus musculu... [more]
sp|Q863H1|SFRP2_CANLF2.454e-2325.87Secreted frizzled-related protein 2 OS=Canis lupus... [more]
sp|Q9IA96|SFRP2_CHICK1.665e-2226.22Secreted frizzled-related protein 2 OS=Gallus gall... [more]
sp|Q9XSC1|SFRP5_BOVIN8.573e-2024.23Secreted frizzled-related protein 5 OS=Bos taurus ... [more]
back to top
BLAST of secreted frizzled related protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E3UZJ50.000e+0100.00Secreted frizzled related protein 3 OS=Schmidtea m... [more]
D3J1K32.643e-4330.23Secreted frizzled-related protein (Fragment) OS=Sc... [more]
D0VYP54.472e-4231.03Secreted frizzled-related protein A (Fragment) OS=... [more]
B0LMG19.055e-4229.90Secreted frizzled-related protein 1 OS=Schmidtea m... [more]
B1NWW13.285e-4129.57Secreted frizzled protein-like protein (Fragment) ... [more]
back to top
BLAST of secreted frizzled related protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sfrp51.058e-2525.26secreted frizzled related protein 5 [Source:NCBI g... [more]
sfrp55.392e-2424.83secreted frizzled related protein 5 [Source:NCBI g... [more]
ENSAMXT00000011888.29.273e-2326.83secreted frizzled-related protein 2-like [Source:N... [more]
sfrp22.408e-2224.05secreted frizzled related protein 2 [Source:NCBI g... [more]
sfrp1a3.983e-1923.57secreted frizzled related protein 1 [Source:NCBI g... [more]
back to top
BLAST of secreted frizzled related protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frzb6.780e-1424.36frizzled related protein [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000011009.13.074e-1034.57pep scaffold:Pmarinus_7.0:GL485859:2701:4509:1 gen... [more]
ENSPMAT00000007205.17.093e-929.27pep scaffold:Pmarinus_7.0:GL478722:26071:28329:-1 ... [more]
fzd22.877e-828.42frizzled class receptor 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
fzd7a4.144e-828.42frizzled class receptor 7a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of secreted frizzled related protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of secreted frizzled related protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO465576.915e-1323.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325003.175e-1232.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357514.029e-1125.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429321.293e-939.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385672.260e-831.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of secreted frizzled related protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sfrp18.625e-2423.29secreted frizzled related protein 1 [Source:NCBI g... [more]
ENSORLT00000011365.27.767e-2123.93pep primary_assembly:ASM223467v1:7:14585088:145864... [more]
sfrp21.056e-1925.67secreted frizzled related protein 2 [Source:NCBI g... [more]
sfrp51.148e-1924.89secreted frizzled related protein 5 [Source:NCBI g... [more]
ENSORLT00000013981.22.996e-1924.73secreted frizzled-related protein 2 [Source:NCBI g... [more]
back to top
BLAST of secreted frizzled related protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058717.10.000e+099.46SMESG000058717.1[more]
SMESG000075831.11.524e-4529.90SMESG000075831.1[more]
SMESG000029446.11.524e-4529.90SMESG000029446.1[more]
SMESG000029446.11.563e-4529.90SMESG000029446.1[more]
SMESG000075831.11.591e-4232.27SMESG000075831.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30019722
GenBankADO51626.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019722 ID=SMED30019722|Name=secreted frizzled related protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1235bp
ATAAAACCTAAAATGTAGTTGTCGTATTTACTTTGATTTTCGAAATGCGT
CTTATTGGAAGTCTTTTGGTGTTATTGGTATTGGTCAGTCTCTTCTCAGT
CGATTTTAGAGTTGGCGCAAATCGGCAACGATTAAATCAGTGCTATCCCA
AGTTCGCAAATCACACCCTTTGCGGAGGAGCGGGCGTCTTAAACTCAATG
AAAACCTTTTCAGGTCTTCTTCGAAATTCGAAAAGTGGGTTTTCAATTTA
TCAATCGAACATCTGGATAATACTTTTGCATACGAAATGTCATGTTGATT
TGGAGAAATTTCTTTGTACAATTTATGCACCGATATGTTTGAAAGGCCAT
CGATTTACTCGTGTTTTTCCTTGTGAAGAATTGTGCGCTTCGGTTAAAGA
ACAATGTCTTCCAAGACTGAAAATATATGGATTCGAATGGCCGTCAATTG
TAGATTGCGGAAAGTTTCCATTGGAAAATAAAGCTTCTTGTATTCAGTTA
ACAGATGGAACAGGAAACTATTTAAAAAAAAGTCTTGTCAAAAAGCAAAG
AGAAGATCGATCGTTGAATCAGACCATTCTTTCAGATCAGGAACAAACTT
TACAAAAAAAAAATTGCCCTATATGCAATCGTAAAGTGCCTTTGGAAATT
CTTACGAAAAACTTCTGTAAATATTCTTTAGTAATCAGGGCTAAAATTGC
AAACATTTTCCAAAAGCCAAAAGGAGCCATTTCAATCCGTCTGCAACACA
AAAGCAACATCATTCACAGCTCTCATCCTATTCGAATATCTTTAGCAAAT
CTCATCACGGAAATACAGTGCAAATGTTCAATCCTACAAAATGCAAAGTC
CGTCAGTAAAGGAAAATGGCTACTCTTTGGTGACATTGAAAATGGACAGT
TTATAGTGAAATTTCTAACGAAATGGCAAAGGAAGCGAAAGAAATTTCGA
AGTCTATTTCGACAGCTTATGAAAAAACCAAAGTTCTTCTGCAAAAATAG
AAATAAACTGCTTAATATTGTCAACAATCAATTCAAACCCAATGAGAACC
TTATCCAGAAGTCAGAAACCAAGACAGAAAATAATCAACCAGAGTACTCT
ATTTACAGTAACCCTTTTATCTATAAAAACGACCTGAAGAAATTCAGCGA
CAAGTGACAGAGTTTAATAACAAATTACCTCTTCATTATATATAAATATA
ACTTTTTTAATTCGATTATCATCAGGATTATGTAT
back to top

protein sequence of SMED30019722-orf-1

>SMED30019722-orf-1 ID=SMED30019722-orf-1|Name=SMED30019722-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=371bp
MRLIGSLLVLLVLVSLFSVDFRVGANRQRLNQCYPKFANHTLCGGAGVLN
SMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLK
GHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCI
QLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPL
EILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISL
ANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKK
FRSLFRQLMKKPKFFCKNRNKLLNIVNNQFKPNENLIQKSETKTENNQPE
YSIYSNPFIYKNDLKKFSDK*
back to top
Aliases
The feature 'secreted frizzled related protein 3' has the following synonyms
Synonym
SFRP-3
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000101muscle cell
PLANA:0000136whole organism
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036790Frizzled_dom_sf
IPR015526Frizzled/SFRP
IPR020067Frizzled_dom
IPR001134Netrin_domain
IPR008993TIMP-like_OB-fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
GO:0016055Wnt signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020067Frizzled domainSMARTSM00063FRI_4coord: 32..154
e-value: 1.1E-13
score: 61.5
IPR020067Frizzled domainPFAMPF01392Fzcoord: 39..145
e-value: 1.3E-16
score: 61.2
IPR020067Frizzled domainPROSITEPS50038FZcoord: 28..152
score: 18.196
IPR036790Frizzled cysteine-rich domain superfamilyGENE3DG3DSA:1.10.2000.10coord: 30..154
e-value: 4.5E-23
score: 83.8
IPR036790Frizzled cysteine-rich domain superfamilySUPERFAMILYSSF63501Frizzled cysteine-rich domaincoord: 40..151
NoneNo IPR availablePANTHERPTHR11309:SF128coord: 29..311
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..25
score: 0.675
IPR015526Frizzled/secreted frizzled-related proteinPANTHERPTHR11309FRIZZLEDcoord: 29..311
IPR001134Netrin domainPROSITEPS50189NTRcoord: 191..316
score: 11.075
IPR008993Tissue inhibitor of metalloproteinases-like, OB-foldSUPERFAMILYSSF50242TIMP-likecoord: 187..307