Tumor protein p63-regulated gene 1 protein

Overview
NameTumor protein p63-regulated gene 1 protein
Smed IDSMED30019715
Length (bp)1105
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tumor protein p63-regulated gene 1 protein (SMED30019715) t-SNE clustered cells

Violin plots show distribution of expression levels for Tumor protein p63-regulated gene 1 protein (SMED30019715) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tumor protein p63-regulated gene 1 protein (SMED30019715) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tumor protein p63-regulated gene 1 protein (SMED30019715) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019715

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30019715h1SMcG0006508 Contig1GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30019715h1SMcG0006508 Contig1GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30019715h1SMcG0006508 Contig1GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30019715h1SMcG0006508 Contig1GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
central nervous systemSMED30019715h1SMcG0006508 Contig1GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
nervous systemSMED30019715h1SMcG0006508 dd_Smed_v4_2044_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Human
Match: TPRG1 (tumor protein p63 regulated 1 [Source:HGNC Symbol;Acc:HGNC:24759])

HSP 1 Score: 51.9878 bits (123), Expect = 4.340e-13
Identity = 35/131 (26.72%), Postives = 57/131 (43.51%), Query Frame = 2
Query:  338 GTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPLVIERENFSTENLRFTLENVISDATK--------FKNENIIVNSYGNVASLIFNQSALGFNKDRHGVSF 706
            G  TFP  SL   R   G+ I WG   + +   RWNP    +P      HP+ Y+    +K L I + +     L   ++N   ++T            E I++ +Y  + S I N++ LG++  R  + F
Sbjct:  149 GKFTFPGMSL-DKRQGEGLRIYWGSPEEQSLLSRWNPWSTEVPYATFTEHPMKYTS---EKFLEICKLSGFMSKLVPAIQNAHKNSTGSGRGKKLMVLTEPILIETYTGLMSFIGNRNKLGYSLARGSIGF 275          

HSP 2 Score: 42.3578 bits (98), Expect = 4.340e-13
Identity = 24/71 (33.80%), Postives = 35/71 (49.30%), Query Frame = 1
Query:   55 NPITNTLITTSKGDYFSGKEN-LNAIKEDLLKEVKSEDGE-VQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            NP     I+     YF+ +   +    EDL   V    GE +QG W+LT +DHWNN  E+ +L    ++ I
Sbjct:   55 NPYHQPYISR---KYFATRPGAIETAMEDLKGHVAETSGETIQGFWLLTKIDHWNNEKERILLVTDKTLLI 122          
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Human
Match: TPRG1 (tumor protein p63 regulated 1 [Source:HGNC Symbol;Acc:HGNC:24759])

HSP 1 Score: 51.9878 bits (123), Expect = 4.340e-13
Identity = 35/131 (26.72%), Postives = 57/131 (43.51%), Query Frame = 2
Query:  338 GTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPLVIERENFSTENLRFTLENVISDATK--------FKNENIIVNSYGNVASLIFNQSALGFNKDRHGVSF 706
            G  TFP  SL   R   G+ I WG   + +   RWNP    +P      HP+ Y+    +K L I + +     L   ++N   ++T            E I++ +Y  + S I N++ LG++  R  + F
Sbjct:  149 GKFTFPGMSL-DKRQGEGLRIYWGSPEEQSLLSRWNPWSTEVPYATFTEHPMKYTS---EKFLEICKLSGFMSKLVPAIQNAHKNSTGSGRGKKLMVLTEPILIETYTGLMSFIGNRNKLGYSLARGSIGF 275          

HSP 2 Score: 42.3578 bits (98), Expect = 4.340e-13
Identity = 24/71 (33.80%), Postives = 35/71 (49.30%), Query Frame = 1
Query:   55 NPITNTLITTSKGDYFSGKEN-LNAIKEDLLKEVKSEDGE-VQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            NP     I+     YF+ +   +    EDL   V    GE +QG W+LT +DHWNN  E+ +L    ++ I
Sbjct:   55 NPYHQPYISR---KYFATRPGAIETAMEDLKGHVAETSGETIQGFWLLTKIDHWNNEKERILLVTDKTLLI 122          
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Human
Match: TPRG1L (tumor protein p63 regulated 1 like [Source:HGNC Symbol;Acc:HGNC:27007])

HSP 1 Score: 48.521 bits (114), Expect = 3.002e-12
Identity = 20/34 (58.82%), Postives = 25/34 (73.53%), Query Frame = 1
Query:  160 EDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            EDGE+QG+W+LT VDHWNN  E+ VL    S+ I
Sbjct:   86 EDGEIQGVWLLTEVDHWNNEKERLVLVTEQSLLI 119          

HSP 2 Score: 42.743 bits (99), Expect = 3.002e-12
Identity = 33/135 (24.44%), Postives = 55/135 (40.74%), Query Frame = 2
Query:  338 GTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPLVIERENFSTENLRFTLENVISDATK------------FKNENIIVNSYGNVASLIFNQSALGFNKDRHGVSF 706
            G   FP KSL   R   GI I W   S+ ++  RWNP   ++P      HP+  +   E    + + E+F     +  L   +  A K                 +++ +Y  + S I N++ LG++  R  + F
Sbjct:  146 GEFQFPPKSLN-KREGFGIRIQWDKQSRPSFINRWNPWSTNVPYATFTEHPM--AGADEKTASLCQLESF-----KALLIQAVKKAQKESPLPGQANGVLILERPLLIETYVGLMSFINNEAKLGYSMTRGKIGF 272          
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Human
Match: TPRG1 (tumor protein p63 regulated 1 [Source:HGNC Symbol;Acc:HGNC:24759])

HSP 1 Score: 41.9726 bits (97), Expect = 9.590e-10
Identity = 19/55 (34.55%), Postives = 25/55 (45.45%), Query Frame = 2
Query:  338 GTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYS 502
            G  TFP  SL   R   G+ I WG   + +   RWNP    +P      HP+ Y+
Sbjct:   77 GKFTFPGMSL-DKRQGEGLRIYWGSPEEQSLLSRWNPWSTEVPYATFTEHPMKYT 130          

HSP 2 Score: 40.817 bits (94), Expect = 9.590e-10
Identity = 19/44 (43.18%), Postives = 26/44 (59.09%), Query Frame = 1
Query:  133 EDLLKEVKSEDGE-VQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            EDL   V    GE +QG W+LT +DHWNN  E+ +L    ++ I
Sbjct:    7 EDLKGHVAETSGETIQGFWLLTKIDHWNNEKERILLVTDKTLLI 50          
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Zebrafish
Match: tprg1 (tumor protein p63 regulated 1 [Source:ZFIN;Acc:ZDB-GENE-070410-113])

HSP 1 Score: 48.1358 bits (113), Expect = 1.006e-12
Identity = 31/128 (24.22%), Postives = 58/128 (45.31%), Query Frame = 2
Query:  338 GTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPLVIE--RENFSTENLRFTLENVI---SDATKFKNENIIVNSYGNVASLIFNQSALGFNKDRHGVSF 706
            G  +FP +SL+  R   G+ + W  + + +++ RWNP     P      HP   +     +   IE  RE  +    +   +N I   ++     N+ +++ +Y  + S+I NQ+ LG+   R  + F
Sbjct:  157 GAFSFPPRSLL-KREGEGVRVFWDKLREPSFSSRWNPFSVDYPFTTFTYHPAKSANEQLGRLCEIESFREQLTLAAQKAHNKNPIPGKANGVLVLNQPLLIEAYVGLMSVIANQNKLGYCLARGNIGF 283          

HSP 2 Score: 44.2838 bits (103), Expect = 1.006e-12
Identity = 16/35 (45.71%), Postives = 25/35 (71.43%), Query Frame = 1
Query:  157 SEDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            ++DG +QG+W++  VDHWNN  E+ VL   N++ I
Sbjct:   96 TDDGAIQGIWLMAEVDHWNNEKERLVLITENTLLI 130          
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Zebrafish
Match: tprg1 (tumor protein p63 regulated 1 [Source:ZFIN;Acc:ZDB-GENE-070410-113])

HSP 1 Score: 48.1358 bits (113), Expect = 1.006e-12
Identity = 31/128 (24.22%), Postives = 58/128 (45.31%), Query Frame = 2
Query:  338 GTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPLVIE--RENFSTENLRFTLENVI---SDATKFKNENIIVNSYGNVASLIFNQSALGFNKDRHGVSF 706
            G  +FP +SL+  R   G+ + W  + + +++ RWNP     P      HP   +     +   IE  RE  +    +   +N I   ++     N+ +++ +Y  + S+I NQ+ LG+   R  + F
Sbjct:  157 GAFSFPPRSLL-KREGEGVRVFWDKLREPSFSSRWNPFSVDYPFTTFTYHPAKSANEQLGRLCEIESFREQLTLAAQKAHNKNPIPGKANGVLVLNQPLLIEAYVGLMSVIANQNKLGYCLARGNIGF 283          

HSP 2 Score: 44.2838 bits (103), Expect = 1.006e-12
Identity = 16/35 (45.71%), Postives = 25/35 (71.43%), Query Frame = 1
Query:  157 SEDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            ++DG +QG+W++  VDHWNN  E+ VL   N++ I
Sbjct:   96 TDDGAIQGIWLMAEVDHWNNEKERLVLITENTLLI 130          
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Zebrafish
Match: tprg1l (tumor protein p63 regulated 1-like [Source:ZFIN;Acc:ZDB-GENE-070531-2])

HSP 1 Score: 47.3654 bits (111), Expect = 2.572e-12
Identity = 34/135 (25.19%), Postives = 54/135 (40.00%), Query Frame = 2
Query:  338 GTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPLVIERENFSTENLRFTLENVISDATK------------FKNENIIVNSYGNVASLIFNQSALGFNKDRHGVSF 706
            G   FP KSL   R   GI + W    + ++  RWNP    IP      HP+ ++   E    + + ENF T+     L   +  A K                 +++ +Y  + S I N++ LG+   R  + F
Sbjct:  149 GEFEFPPKSLN-KREGTGIRVQWDKRPRASFMNRWNPWSTDIPYATFTEHPMAHA--DEKVASLCQLENFKTQ-----LIQAVKKAHKEYPIPGRANGVLILERPLLIETYLGIMSFINNEAKLGYAMTRGKIGF 275          

HSP 2 Score: 43.5134 bits (101), Expect = 2.572e-12
Identity = 23/69 (33.33%), Postives = 34/69 (49.28%), Query Frame = 1
Query:   61 ITNTLITTSKGDYFSGKENL--NAIKEDLLKEVKSEDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            + N  +     DYF  +      A+ +     + SEDGEV  +W+L  VDHWNN  E+ VL    S+ +
Sbjct:   54 VHNPTMRAKVKDYFVFRPGTIEQAVNDIRTVALPSEDGEVLSVWLLAEVDHWNNEKERLVLITERSLLV 122          
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Xenopus
Match: ttc5 (tetratricopeptide repeat domain 5 [Source:Xenbase;Acc:XB-GENE-1001730])

HSP 1 Score: 51.9878 bits (123), Expect = 5.570e-12
Identity = 36/131 (27.48%), Postives = 62/131 (47.33%), Query Frame = 2
Query:  338 GTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPLVIERENFSTENLRFTLENV--------ISDATKFKNENIIVNSYGNVASLIFNQSALGFNKDRHGVSF 706
            G  TFP++SL   R   G+ + W  + + T+  RWNP  + +P    I+HPL   K S +K  VI + +   ++L   +E           ++      + I + +Y  + S I N++ LG++  R  V F
Sbjct:  135 GPFTFPERSL-DKREGEGLRVHWDKLREPTFANRWNPFSEVLPYTTFIDHPL---KSSSEKFSVICQISGFADSLIHAVEEAHKENPVPGRANGALVLKQPIAIETYVGLMSFIGNRNKLGYSLARGSVGF 261          

HSP 2 Score: 38.5058 bits (88), Expect = 5.570e-12
Identity = 18/44 (40.91%), Postives = 27/44 (61.36%), Query Frame = 1
Query:  133 EDLLKEVKSEDGE-VQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            EDL  ++ +++ E V   W+L  VDHWNN  E+ VL    S++I
Sbjct:   65 EDLRNQILTKENETVNSAWLLAEVDHWNNEKERLVLITDKSLFI 108          
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Xenopus
Match: tprg1l (tumor protein p63 regulated 1-like [Source:NCBI gene;Acc:496974])

HSP 1 Score: 45.4394 bits (106), Expect = 9.925e-12
Identity = 18/37 (48.65%), Postives = 26/37 (70.27%), Query Frame = 1
Query:  151 VKSEDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            + +EDGE+Q +W+LT VDHWNN  E+ VL    ++ I
Sbjct:   80 LPTEDGEIQSVWLLTEVDHWNNEKERLVLITERTLLI 116          

HSP 2 Score: 44.2838 bits (103), Expect = 9.925e-12
Identity = 33/131 (25.19%), Postives = 62/131 (47.33%), Query Frame = 2
Query:  338 GTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPL-VIERENFSTENLRFTLENVISDATKFKNENIIV-------NSYGNVASLIFNQSALGFNKDRHGVSF 706
            G   FP  SL     I GI I+W    + ++  +WNP   ++P    I HP+ +   ++DK + + + E+F T+ ++   +    +  + K   ++V        +Y  + SLI N++ LG+   R  + F
Sbjct:  143 GEFEFPPMSLNRREGI-GIRILWS-TRRFSFINKWNPWTTNMPYATFIEHPMAH---ADDKVMPLCKLEDFKTQLIQAVKKAHKQNPVQGKPNGVLVLERPLMIETYLGLMSLINNEAKLGYAMSRGKIGF 268          
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Xenopus
Match: ttc5 (tetratricopeptide repeat domain 5 [Source:Xenbase;Acc:XB-GENE-1001730])

HSP 1 Score: 43.8986 bits (102), Expect = 1.694e-9
Identity = 19/52 (36.54%), Postives = 29/52 (55.77%), Query Frame = 2
Query:  338 GTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPL 493
            G  TFP++SL   R   G+ + W  + + T+  RWNP  + +P    I+HPL
Sbjct:  135 GPFTFPERSLD-KREGEGLRVHWDKLREPTFANRWNPFSEVLPYTTFIDHPL 185          

HSP 2 Score: 38.5058 bits (88), Expect = 1.694e-9
Identity = 18/44 (40.91%), Postives = 27/44 (61.36%), Query Frame = 1
Query:  133 EDLLKEVKSEDGE-VQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            EDL  ++ +++ E V   W+L  VDHWNN  E+ VL    S++I
Sbjct:   65 EDLRNQILTKENETVNSAWLLAEVDHWNNEKERLVLITDKSLFI 108          
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Mouse
Match: Tprgl (transformation related protein 63 regulated like [Source:MGI Symbol;Acc:MGI:1915058])

HSP 1 Score: 48.9062 bits (115), Expect = 7.987e-13
Identity = 22/48 (45.83%), Postives = 32/48 (66.67%), Query Frame = 1
Query:  133 EDLLKEVKS-----EDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            E  ++E+++     EDGE+QG+W+LT VDHWNN  E+ VL    S+ I
Sbjct:   66 EQAVEEIRAVVRPVEDGEIQGVWLLTEVDHWNNEKERLVLVTDQSLLI 113          

HSP 2 Score: 43.8986 bits (102), Expect = 7.987e-13
Identity = 33/135 (24.44%), Postives = 56/135 (41.48%), Query Frame = 2
Query:  338 GTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPLVIERENFSTENLRFTLENVISDATK------------FKNENIIVNSYGNVASLIFNQSALGFNKDRHGVSF 706
            G   FP KSL   R   G+ I W   S+ ++  RWNP   ++P    I HP+  + + E    +   E+F     +  L   +  A K                 +++ +Y  + S I N++ LG++  R  + F
Sbjct:  140 GEFQFPPKSLN-KREGFGVRIQWDKQSRPSFINRWNPWSTNMPYATFIEHPM--AGMDEKTASLCHLESF-----KALLIQAVKKAQKESPLPGQANTVLVLERPLLIETYVGLMSFINNEAKLGYSMTRGKIGF 266          
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Mouse
Match: Tprg (transformation related protein 63 regulated [Source:MGI Symbol;Acc:MGI:1918588])

HSP 1 Score: 47.7506 bits (112), Expect = 3.546e-12
Identity = 34/131 (25.95%), Postives = 57/131 (43.51%), Query Frame = 2
Query:  338 GTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPLVIERENFSTENLRFTLENVISDATKFKN--------ENIIVNSYGNVASLIFNQSALGFNKDRHGVSF 706
            G   FP  SL   R  +G+ I WG     +   RWNP    +P      HP+   K + +K L I + +  T  L   +EN   ++    +        + I++ +Y  + S I N++ LG++  R  + F
Sbjct:  153 GKFVFPGMSL-DKRPGDGLRIFWGSTEGWSLLSRWNPWSTEVPYATFTEHPM---KQTSEKFLEICKLSEFTSKLVPAIENAHKNSAGSGSGKELVVLTQPILIETYTGLMSFIGNRNKLGYSLARGSIGF 279          

HSP 2 Score: 42.743 bits (99), Expect = 3.546e-12
Identity = 20/44 (45.45%), Postives = 26/44 (59.09%), Query Frame = 1
Query:  133 EDLLKEVKSEDGE-VQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            EDL   +    GE VQG W+LT +DHWNN  EK +L    ++ I
Sbjct:   83 EDLKGHIAQTSGETVQGFWLLTEIDHWNNEKEKILLLTDKTLLI 126          
BLAST of Tumor protein p63-regulated gene 1 protein vs. UniProt/SwissProt
Match: sp|Q6ZUI0|TPRG1_HUMAN (Tumor protein p63-regulated gene 1 protein OS=Homo sapiens OX=9606 GN=TPRG1 PE=1 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 1.886e-12
Identity = 35/131 (26.72%), Postives = 57/131 (43.51%), Query Frame = 2
Query:  338 GTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPLVIERENFSTENLRFTLENVISDATK--------FKNENIIVNSYGNVASLIFNQSALGFNKDRHGVSF 706
            G  TFP  SL   R   G+ I WG   + +   RWNP    +P      HP+ Y+    +K L I + +     L   ++N   ++T            E I++ +Y  + S I N++ LG++  R  + F
Sbjct:  149 GKFTFPGMSL-DKRQGEGLRIYWGSPEEQSLLSRWNPWSTEVPYATFTEHPMKYTS---EKFLEICKLSGFMSKLVPAIQNAHKNSTGSGRGKKLMVLTEPILIETYTGLMSFIGNRNKLGYSLARGSIGF 275          

HSP 2 Score: 42.3578 bits (98), Expect = 1.886e-12
Identity = 24/71 (33.80%), Postives = 35/71 (49.30%), Query Frame = 1
Query:   55 NPITNTLITTSKGDYFSGKEN-LNAIKEDLLKEVKSEDGE-VQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            NP     I+     YF+ +   +    EDL   V    GE +QG W+LT +DHWNN  E+ +L    ++ I
Sbjct:   55 NPYHQPYISR---KYFATRPGAIETAMEDLKGHVAETSGETIQGFWLLTKIDHWNNEKERILLVTDKTLLI 122          
BLAST of Tumor protein p63-regulated gene 1 protein vs. UniProt/SwissProt
Match: sp|A8WCF8|TPRGL_RAT (Tumor protein p63-regulated gene 1-like protein OS=Rattus norvegicus OX=10116 GN=Tprg1l PE=1 SV=1)

HSP 1 Score: 48.521 bits (114), Expect = 2.771e-12
Identity = 22/48 (45.83%), Postives = 32/48 (66.67%), Query Frame = 1
Query:  133 EDLLKEVKS-----EDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            E  ++E+++     EDGE+QG+W+LT VDHWNN  E+ VL    S+ I
Sbjct:   66 EQAVEEIRAVVRPVEDGEIQGVWLLTEVDHWNNEKERLVLVTDQSLLI 113          

HSP 2 Score: 45.0542 bits (105), Expect = 2.771e-12
Identity = 32/130 (24.62%), Postives = 56/130 (43.08%), Query Frame = 2
Query:  338 GTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPLVIERENFSTENLRFTLENVISDATKFKNENIIV-------NSYGNVASLIFNQSALGFNKDRHGVSF 706
            G   FP KSL   R   G+ I W   S+ ++  RWNP   ++P    I HP+  + + E    +   E+F    ++   +         +  N++V        +Y  + S I N++ LG++  R  + F
Sbjct:  140 GEFQFPPKSLN-KREGFGVRIQWDKQSRPSFINRWNPWSTNMPYATFIEHPM--AGMDEKTASLCHLESFKALLIQAVKKAQKESPLPGQANNVLVLDRPLLIETYVGLMSFINNEAKLGYSMTRGKIGF 266          
BLAST of Tumor protein p63-regulated gene 1 protein vs. UniProt/SwissProt
Match: sp|Q9DBS2|TPRGL_MOUSE (Tumor protein p63-regulated gene 1-like protein OS=Mus musculus OX=10090 GN=Tprg1l PE=1 SV=1)

HSP 1 Score: 48.9062 bits (115), Expect = 4.788e-12
Identity = 22/48 (45.83%), Postives = 32/48 (66.67%), Query Frame = 1
Query:  133 EDLLKEVKS-----EDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            E  ++E+++     EDGE+QG+W+LT VDHWNN  E+ VL    S+ I
Sbjct:   66 EQAVEEIRAVVRPVEDGEIQGVWLLTEVDHWNNEKERLVLVTDQSLLI 113          

HSP 2 Score: 43.8986 bits (102), Expect = 4.788e-12
Identity = 33/135 (24.44%), Postives = 56/135 (41.48%), Query Frame = 2
Query:  338 GTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPLVIERENFSTENLRFTLENVISDATK------------FKNENIIVNSYGNVASLIFNQSALGFNKDRHGVSF 706
            G   FP KSL   R   G+ I W   S+ ++  RWNP   ++P    I HP+  + + E    +   E+F     +  L   +  A K                 +++ +Y  + S I N++ LG++  R  + F
Sbjct:  140 GEFQFPPKSLN-KREGFGVRIQWDKQSRPSFINRWNPWSTNMPYATFIEHPM--AGMDEKTASLCHLESF-----KALLIQAVKKAQKESPLPGQANTVLVLERPLLIETYVGLMSFINNEAKLGYSMTRGKIGF 266          
BLAST of Tumor protein p63-regulated gene 1 protein vs. UniProt/SwissProt
Match: sp|Q5T0D9|TPRGL_HUMAN (Tumor protein p63-regulated gene 1-like protein OS=Homo sapiens OX=9606 GN=TPRG1L PE=1 SV=1)

HSP 1 Score: 48.521 bits (114), Expect = 1.305e-11
Identity = 20/34 (58.82%), Postives = 25/34 (73.53%), Query Frame = 1
Query:  160 EDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            EDGE+QG+W+LT VDHWNN  E+ VL    S+ I
Sbjct:   86 EDGEIQGVWLLTEVDHWNNEKERLVLVTEQSLLI 119          

HSP 2 Score: 42.743 bits (99), Expect = 1.305e-11
Identity = 33/135 (24.44%), Postives = 55/135 (40.74%), Query Frame = 2
Query:  338 GTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPLVIERENFSTENLRFTLENVISDATK------------FKNENIIVNSYGNVASLIFNQSALGFNKDRHGVSF 706
            G   FP KSL   R   GI I W   S+ ++  RWNP   ++P      HP+  +   E    + + E+F     +  L   +  A K                 +++ +Y  + S I N++ LG++  R  + F
Sbjct:  146 GEFQFPPKSLN-KREGFGIRIQWDKQSRPSFINRWNPWSTNVPYATFTEHPM--AGADEKTASLCQLESF-----KALLIQAVKKAQKESPLPGQANGVLILERPLLIETYVGLMSFINNEAKLGYSMTRGKIGF 272          
BLAST of Tumor protein p63-regulated gene 1 protein vs. UniProt/SwissProt
Match: sp|Q32LJ4|TPRGL_BOVIN (Tumor protein p63-regulated gene 1-like protein OS=Bos taurus OX=9913 GN=TPRG1L PE=2 SV=2)

HSP 1 Score: 46.2098 bits (108), Expect = 1.977e-11
Identity = 18/34 (52.94%), Postives = 25/34 (73.53%), Query Frame = 1
Query:  160 EDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            EDG++QG+W+LT VDHWNN  E+ VL    ++ I
Sbjct:   89 EDGDIQGVWLLTEVDHWNNEKERLVLITDQALLI 122          

HSP 2 Score: 44.2838 bits (103), Expect = 1.977e-11
Identity = 34/138 (24.64%), Postives = 57/138 (41.30%), Query Frame = 2
Query:  338 GTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPLVIERENFSTENLRFTLENVISDATKFKNEN---------------IIVNSYGNVASLIFNQSALGFNKDRHGVSF 706
            G   FP KSL   R   GI I W   S+ ++  RWNP   S+P    I HP+  + + E    + + + F           +I    K + E+               +++ +Y  + S I N++ LG++  R  + F
Sbjct:  149 GEFQFPPKSLN-KREGFGIRIQWDKQSRPSFISRWNPWSTSVPYTTFIEHPM--AGVDEKTASLCQLDGFKA--------LLIQAVKKAQKESPLPGQEGGVLVLECPLLIETYVGLMSFINNEAKLGYSMTRGKIGF 275          
BLAST of Tumor protein p63-regulated gene 1 protein vs. TrEMBL
Match: A0A564YDG3 (HSac2 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS4941 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.737e-27
Identity = 64/167 (38.32%), Postives = 96/167 (57.49%), Query Frame = 2
Query:  251 LYIFRYXXXXXXXXXXXXXXXXXXXXXXXGTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPLVIEREN-----FSTENLRFTLENV------ISDA-----TKFKNENIIVNSYGNVASLIFNQSALGFNKDRHGVS 703
             YI RYDF+   V+D K V +  +V +  G L FP KSLMP+R   G+++VWGD+  VT  Q+WNPLC+++P  +L +HPL    L +   L   + N     +  +    TL +V      I DA      +FK  +II+ SYGN+ S++FNQ++LGF + +  V+
Sbjct:   89 FYIIRYDFLSGNVRDSKRVGLGQLVSVTTGPLVFPTKSLMPTRTSPGVQLVWGDLGTVTAAQKWNPLCRNMPYVVLTHHPL----LVKQNQLPSGQSNANGAGYGHDTNAGTLYDVNNFLQAIRDACSASNVEFKTGDIIIESYGNIGSVVFNQTSLGFARSKVSVA 251          

HSP 2 Score: 54.6842 bits (130), Expect = 2.737e-27
Identity = 32/80 (40.00%), Postives = 42/80 (52.50%), Query Frame = 1
Query:   46 PQINPITNTLITTSKGDYFSGKENLNAIKEDLLKEV--------KSEDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            PQIN + N  +     D  SGK  LN  KED+ + +         +EDG    LWILT++DHWNN  E+ V+    S YI
Sbjct:   13 PQIN-LPNVQLPAFGKDSNSGKAPLNMTKEDMEQLITTLQHTILATEDGAFVALWILTLIDHWNNEHERIVVLTERSFYI 91          
BLAST of Tumor protein p63-regulated gene 1 protein vs. TrEMBL
Match: W6U9Z3 (Tumor protein p63-regulated gene 1-like protein OS=Echinococcus granulosus OX=6210 GN=EGR_07795 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 2.975e-27
Identity = 58/160 (36.25%), Postives = 92/160 (57.50%), Query Frame = 2
Query:  251 LYIFRYXXXXXXXXXXXXXXXXXXXXXXXGTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLF--YSKLSEDKPLVIERENFSTENLRFTLENV------ISDA-----TKFKNENIIVNSYGNVASLIFNQSALGFNKDR 691
             YI RYDF+   +++ K V +  ++ +  G L FP KSLMP+R   G+++VWGD+  VT  Q+WNPLC+++P  +L +HPL    +KL   +        +  +    TL +V      I DA      +FK  +I + SYGN+ S++FNQ++LGF + +
Sbjct:  173 FYIIRYDFLSGHIRESKRVGLGQLISVTTGPLVFPTKSLMPTRTSPGVQLVWGDLGSVTAAQKWNPLCRNMPYVVLTHHPLLVKQNKLPSGQANA-NGAGYGHDTNAGTLYDVNNFLQAIRDACSASNVEFKTGDITIESYGNIGSVVFNQTSLGFTRSK 331          

HSP 2 Score: 54.6842 bits (130), Expect = 2.975e-27
Identity = 32/81 (39.51%), Postives = 43/81 (53.09%), Query Frame = 1
Query:   43 VPQINPITNTLITTSKGDYFSGKENLNAIKEDLLK--------EVKSEDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
             PQIN + N  + T   D  +GK  LN  KED+ +         + +EDG    LWILT++DHWNN  E+ V+    S YI
Sbjct:   96 TPQIN-LPNVQLPTFGKDANNGKAPLNMTKEDMEQLITTIQHTTLATEDGAFVALWILTLIDHWNNEHERIVVLTERSFYI 175          
BLAST of Tumor protein p63-regulated gene 1 protein vs. TrEMBL
Match: A0A068XZQ1 (Protein fam79a OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000499000 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 9.962e-27
Identity = 58/160 (36.25%), Postives = 92/160 (57.50%), Query Frame = 2
Query:  251 LYIFRYXXXXXXXXXXXXXXXXXXXXXXXGTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLF--YSKLSEDKPLVIERENFSTENLRFTLENV------ISDA-----TKFKNENIIVNSYGNVASLIFNQSALGFNKDR 691
             YI RYDF+   +++ K V +  ++ +  G L FP KSLMP+R   G+++VWGD+  VT  Q+WNPLC+++P  +L +HPL    +KL   +        +  +    TL +V      I DA      +FK  +I + SYGN+ S++FNQ++LGF + +
Sbjct:  163 FYIIRYDFLSGHIRESKRVGLGQLISVTTGPLVFPTKSLMPTRTSPGVQLVWGDLGSVTAAQKWNPLCRNMPYVVLTHHPLLVKQNKLPSGQANA-NGAGYGHDTNAGTLYDVNNFLKAIRDACSASNVEFKTGDITIESYGNIGSVVFNQTSLGFTRSK 321          

HSP 2 Score: 55.0694 bits (131), Expect = 9.962e-27
Identity = 32/81 (39.51%), Postives = 43/81 (53.09%), Query Frame = 1
Query:   43 VPQINPITNTLITTSKGDYFSGKENLNAIKEDLLK--------EVKSEDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
             PQIN + N  + T   D  +GK  LN  KED+ +         + +EDG    LWILT++DHWNN  E+ V+    S YI
Sbjct:   86 TPQIN-LPNVQLPTFGKDANNGKAPLNMTKEDMEQLITTIQHTTLAAEDGAFVALWILTLIDHWNNEHERIVVLTERSFYI 165          
BLAST of Tumor protein p63-regulated gene 1 protein vs. TrEMBL
Match: A0A068WMD5 (Protein fam79a OS=Echinococcus granulosus OX=6210 GN=EgrG_000499000 PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.674e-26
Identity = 58/160 (36.25%), Postives = 92/160 (57.50%), Query Frame = 2
Query:  251 LYIFRYXXXXXXXXXXXXXXXXXXXXXXXGTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLF--YSKLSEDKPLVIERENFSTENLRFTLENV------ISDA-----TKFKNENIIVNSYGNVASLIFNQSALGFNKDR 691
             YI RYDF+   +++ K V +  ++ +  G L FP KSLMP+R   G+++VWGD+  VT  Q+WNPLC+++P  +L +HPL    +KL   +        +  +    TL +V      I DA      +FK  +I + SYGN+ S++FNQ++LGF + +
Sbjct:  163 FYIIRYDFLSGHIRESKRVGLGQLISVTTGPLVFPTKSLMPTRTSPGVQLVWGDLGSVTAAQKWNPLCRNMPYVVLTHHPLLVKQNKLPSGQANA-NGAGYGHDTNAGTLYDVNNFLQAIRDACSASNVEFKTGDITIESYGNIGSVVFNQTSLGFTRSK 321          

HSP 2 Score: 54.6842 bits (130), Expect = 1.674e-26
Identity = 32/81 (39.51%), Postives = 43/81 (53.09%), Query Frame = 1
Query:   43 VPQINPITNTLITTSKGDYFSGKENLNAIKEDLLK--------EVKSEDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
             PQIN + N  + T   D  +GK  LN  KED+ +         + +EDG    LWILT++DHWNN  E+ V+    S YI
Sbjct:   86 TPQIN-LPNVQLPTFGKDANNGKAPLNMTKEDMEQLITTIQHTTLATEDGAFVALWILTLIDHWNNEHERIVVLTERSFYI 165          
BLAST of Tumor protein p63-regulated gene 1 protein vs. TrEMBL
Match: A0A0R3X3T3 (HSac2 domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS8009 PE=4 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 9.255e-26
Identity = 59/164 (35.98%), Postives = 94/164 (57.32%), Query Frame = 2
Query:  251 LYIFRYXXXXXXXXXXXXXXXXXXXXXXXGTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFY--SKLSEDKPLVIERENFSTENLRFTLENV------ISDA-----TKFKNENIIVNSYGNVASLIFNQSALGFNKDRHGVS 703
             YI RYDF+   +++ + V +  +V +  G L FP KSLMP+R   G+++VWGD+  VT  Q+WNPLC+++P  +L +HPL    +KL   +        +  +    TL +V      I DA      +FK  +I + SYGN+ S++FNQ++LGF + +  V+
Sbjct:   89 FYIIRYDFLSGHIRESRRVGLGQLVSVTTGPLVFPTKSLMPTRTSPGVQLVWGDLGSVTAAQKWNPLCRNMPYVVLTHHPLLVKQNKLPSGQANA-NGAGYGHDTNAGTLYDVNNFLQAIRDACSASNVEFKMGDITIESYGNIGSVVFNQTSLGFTRSKVSVA 251          

HSP 2 Score: 50.447 bits (119), Expect = 9.255e-26
Identity = 31/80 (38.75%), Postives = 42/80 (52.50%), Query Frame = 1
Query:   46 PQINPITNTLITTSKGDYFSGKENLNAIKEDLLK--------EVKSEDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            PQIN  +  L T  K +   GK  LN  +ED+ +         + +EDG    LWILT++DHWNN  E+ V+    S YI
Sbjct:   13 PQINLPSVQLPTFGK-EANVGKAPLNMTREDMEQLITTIQHTTLATEDGAFVALWILTLIDHWNNEHERIVVLTERSFYI 91          
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Cavefish
Match: tprg1 (tumor protein p63-regulated gene 1-like protein [Source:NCBI gene;Acc:103031855])

HSP 1 Score: 52.7582 bits (125), Expect = 5.343e-15
Identity = 34/130 (26.15%), Postives = 59/130 (45.38%), Query Frame = 2
Query:  338 GTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPLVIE----RENFSTENLRFTLENVI---SDATKFKNENIIVNSYGNVASLIFNQSALGFNKDRHGVSF 706
            G  TFP +SL+  R  +G+ + W  + + ++T RWNP     P   L  HP+     SE    + E    RE  +    +   +N +   ++      + I++ +Y  + S + NQ+ LG+   R  V F
Sbjct:  172 GVFTFPPRSLL-KREGHGLRVFWDRLREPSFTSRWNPFAVDYPYTTLTYHPV--RNASEKLSTICEINSFREQLTAAAQKAHAQNPVPGKANGVLVLTQPIVIEAYVGLTSALGNQNKLGYCLARGNVGF 298          

HSP 2 Score: 47.3654 bits (111), Expect = 5.343e-15
Identity = 23/49 (46.94%), Postives = 32/49 (65.31%), Query Frame = 1
Query:  118 LNAIKEDLLKEV-KSEDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            L+   EDL + V + +DG VQ +W+LT +DHWNN  E+ VL   NS+ I
Sbjct:   97 LDHAVEDLKRLVNQKDDGAVQSVWLLTEIDHWNNEKERLVLITENSLLI 145          
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Cavefish
Match: tprg1l (tumor protein p63 regulated 1 like [Source:NCBI gene;Acc:103025474])

HSP 1 Score: 46.595 bits (109), Expect = 3.252e-12
Identity = 33/135 (24.44%), Postives = 56/135 (41.48%), Query Frame = 2
Query:  338 GTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPLVIERENFSTENLRFTLENVISDATK------------FKNENIIVNSYGNVASLIFNQSALGFNKDRHGVSF 706
            G   FP KSL   R  +GI + W    + ++  RWNP    +P      HP+ ++   E    + + ENF T+     L   +  A K                 +++ +Y  + S I N++ LG++  R  + F
Sbjct:  156 GDFEFPPKSLN-KREGSGIRVQWDKRPRPSFLNRWNPWSTDMPYATFTEHPMAHA--DEKVASLCQLENFKTQ-----LIQAVKKAHKEFPIPGRANGVLLLERPLLIETYLGIMSFINNEAKLGYSMTRGKIGF 282          

HSP 2 Score: 43.8986 bits (102), Expect = 3.252e-12
Identity = 23/69 (33.33%), Postives = 34/69 (49.28%), Query Frame = 1
Query:   61 ITNTLITTSKGDYFSGKENL--NAIKEDLLKEVKSEDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            + N  +     DYF  +      A+ +     + SEDGEV  +W+L  VDHWNN  E+ VL    S+ +
Sbjct:   61 VHNPTMQAKVKDYFVFRPGTIEQAVNDIRTVALPSEDGEVLSVWLLAEVDHWNNEKERLVLITERSLLV 129          
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009815.1 (pep scaffold:Pmarinus_7.0:GL479354:40778:44882:1 gene:ENSPMAG00000008867.1 transcript:ENSPMAT00000009815.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 43.5134 bits (101), Expect = 2.599e-11
Identity = 21/51 (41.18%), Postives = 31/51 (60.78%), Query Frame = 1
Query:  109 KENLNAIKEDLLKEVKSEDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            ++ +N IK  +L  V  +DGE+Q +W+L  VDHWNN  E+ V     S+ I
Sbjct:   10 EQAVNDIKVSVLHTV--DDGEIQSVWLLAEVDHWNNERERIVCLSERSLLI 58          

HSP 2 Score: 41.5874 bits (96), Expect = 2.599e-11
Identity = 32/128 (25.00%), Postives = 55/128 (42.97%), Query Frame = 2
Query:  338 GTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPLVIE--RENFSTENLRFTLENVI---SDATKFKNENIIVNSYGNVASLIFNQSALGFNKDRHGVSF 706
            G   FP KSL+ +R  +G+ + W  + + T+  RWNP    +P     +H +  +  +      +E  RE       R    N I   ++      + +++ +   + S I NQS LG+   R  V F
Sbjct:   85 GEFAFPPKSLL-NREGHGLRVHWDKLREPTFLSRWNPWSTELPYTTFTHHIMANADPNMAPVCQLEKFREALIEATKRAHTANPIPGRANGVLVLEKPVLIEAVVGLMSTINNQSRLGYCLARGSVGF 211          
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004130.1 (pep scaffold:Pmarinus_7.0:GL487498:1683:4338:-1 gene:ENSPMAG00000003775.1 transcript:ENSPMAT00000004130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 43.5134 bits (101), Expect = 8.863e-10
Identity = 17/34 (50.00%), Postives = 23/34 (67.65%), Query Frame = 1
Query:  160 EDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            EDGE+Q +W+LT VDHWN   E+ VL    S+ +
Sbjct:   49 EDGEMQSVWLLTEVDHWNTERERLVLLAERSMLV 82          

HSP 2 Score: 36.1946 bits (82), Expect = 8.863e-10
Identity = 16/52 (30.77%), Postives = 24/52 (46.15%), Query Frame = 2
Query:  338 GTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPL 493
            G   FP KSL   R   G+ + W  V+   +  +WNP  + +P      HP+
Sbjct:  109 GAFLFPHKSL-SKREGLGVRVEWDRVAHAPFWTQWNPFSEELPYTTFTQHPM 159          
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Nematostella
Match: EDO34029 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQI5])

HSP 1 Score: 41.9726 bits (97), Expect = 1.049e-6
Identity = 29/131 (22.14%), Postives = 53/131 (40.46%), Query Frame = 2
Query:  338 GTLTFPDKSLMPSRNIN-GIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPLVIERENFSTENLRFTLE-------NVISDATKFKNENIIVNSYGNVASLIFNQSALGFNKDRHGVSF 706
            G   +P  ++M  R+   G+ I  G    ++  Q WNP  K++P      H    S+L +  P  +E   F  E L                ++ +F ++ I++  Y   + +  N   LG+ +DR    +
Sbjct:   84 GRFVYPKNTMMIPRHFQVGLRIYAGKNETLSTLQNWNPWFKALPHVTFGRHK--GSELMDRIPRYMELNYFEQEVLSAIKAAQNELHPGAAENSLEFSSDPILIEVYCGASPMFHNWGLLGYRRDRGSFGY 212          

HSP 2 Score: 28.1054 bits (61), Expect = 1.049e-6
Identity = 14/48 (29.17%), Postives = 26/48 (54.17%), Query Frame = 1
Query:  133 EDLLKEVKS-----EDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            E  L+E K      +DG++   ++LT +DHW++  E+ V+     + I
Sbjct:   10 ESALEECKKILHPEKDGKIINGYLLTEIDHWDHEKERVVIITEKQLVI 57          
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Medaka
Match: tprg1 (tumor protein p63-regulated gene 1-like protein [Source:NCBI gene;Acc:101164881])

HSP 1 Score: 49.6766 bits (117), Expect = 1.303e-12
Identity = 33/131 (25.19%), Postives = 58/131 (44.27%), Query Frame = 2
Query:  338 GTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPLVIERENFSTENLRFTLENV--------ISDATKFKNENIIVNSYGNVASLIFNQSALGFNKDRHGVSF 706
            G   FP  SL+  R   G+ I W  +   ++T +WNP     P   LI+HP+  S +++    + +   F  ++L+   E           ++     N+ I + +Y    S + NQ+ LG+   R G+ F
Sbjct:  145 GPFNFPKHSLL-KREGEGLRIYWDRMRDPSFTSKWNPFSVDFPYTTLISHPV--SSINDTFASLCDLHKFR-DHLKVVAEKAHARNPAPGKANGVTVLNQPITIEAYVGAMSFLGNQNKLGYAMARGGLGF 271          

HSP 2 Score: 42.3578 bits (98), Expect = 1.303e-12
Identity = 16/36 (44.44%), Postives = 24/36 (66.67%), Query Frame = 1
Query:  154 KSEDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            K EDG VQ +W++  VDHWNN  E+ V+   N++ +
Sbjct:   83 KEEDGNVQSVWLMAEVDHWNNEKERLVVITDNTLMV 118          
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Medaka
Match: tprg1 (tumor protein p63-regulated gene 1-like protein [Source:NCBI gene;Acc:101164881])

HSP 1 Score: 49.6766 bits (117), Expect = 1.303e-12
Identity = 33/131 (25.19%), Postives = 58/131 (44.27%), Query Frame = 2
Query:  338 GTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPLVIERENFSTENLRFTLENV--------ISDATKFKNENIIVNSYGNVASLIFNQSALGFNKDRHGVSF 706
            G   FP  SL+  R   G+ I W  +   ++T +WNP     P   LI+HP+  S +++    + +   F  ++L+   E           ++     N+ I + +Y    S + NQ+ LG+   R G+ F
Sbjct:  145 GPFNFPKHSLL-KREGEGLRIYWDRMRDPSFTSKWNPFSVDFPYTTLISHPV--SSINDTFASLCDLHKFR-DHLKVVAEKAHARNPAPGKANGVTVLNQPITIEAYVGAMSFLGNQNKLGYAMARGGLGF 271          

HSP 2 Score: 42.3578 bits (98), Expect = 1.303e-12
Identity = 16/36 (44.44%), Postives = 24/36 (66.67%), Query Frame = 1
Query:  154 KSEDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            K EDG VQ +W++  VDHWNN  E+ V+   N++ +
Sbjct:   83 KEEDGNVQSVWLMAEVDHWNNEKERLVVITDNTLMV 118          
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Medaka
Match: tprg1l (tumor protein p63 regulated 1 like [Source:NCBI gene;Acc:101155767])

HSP 1 Score: 44.669 bits (104), Expect = 9.984e-12
Identity = 30/130 (23.08%), Postives = 58/130 (44.62%), Query Frame = 2
Query:  338 GTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPLVIERENFSTENLRFT----LENVI---SDATKFKNENIIVNSYGNVASLIFNQSALGFNKDRHGVSF 706
            G   FP KSL   R   GI + W    + ++  RWNP    +P      HP+  ++  E    + + +NF T+ ++       E+ I   ++        +++ +Y  + S + N++ LG++  R  + F
Sbjct:  155 GEFEFPPKSLN-KREGYGIRVQWDKRPRASFLNRWNPWSTDMPYATFTEHPM--ARADEKVASLCQLDNFKTQLVQAVKKAHKEHPIPGRANGVLILERPLLIETYLGLMSFVNNEAKLGYSMTRGKIGF 281          

HSP 2 Score: 43.8986 bits (102), Expect = 9.984e-12
Identity = 23/69 (33.33%), Postives = 34/69 (49.28%), Query Frame = 1
Query:   61 ITNTLITTSKGDYFSGKENL--NAIKEDLLKEVKSEDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            + N  +     DYF  +      A+ +     + SEDGEV  +W+L  VDHWNN  E+ VL    S+ +
Sbjct:   60 VHNPTMQAKVKDYFVFRPGTIEQAVSDIRTVALPSEDGEVLSVWLLVEVDHWNNEKERLVLITERSLLV 128          
BLAST of Tumor protein p63-regulated gene 1 protein vs. Planmine SMEST
Match: SMESG000033840.1 (SMESG000033840.1)

HSP 1 Score: 258.07 bits (658), Expect = 1.406e-111
Identity = 151/152 (99.34%), Postives = 152/152 (100.00%), Query Frame = 2
Query:  251 LYIFRYXXXXXXXXXXXXXXXXXXXXXXXGTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPLVIERENFSTENLRFTLENVISDATKFKNENIIVNSYGNVASLIFNQSALGFNKDRHGVSF 706
            +YIFRYDFVLKKVKDVKVVKVADIVEIKIGTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPLVIERENFSTENLRFTLENVISDATKFKNENIIVNSYGNVASLIFNQSALGFNKDRHGVSF
Sbjct:   78 IYIFRYDFVLKKVKDVKVVKVADIVEIKIGTLTFPDKSLMPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSEDKPLVIERENFSTENLRFTLENVISDATKFKNENIIVNSYGNVASLIFNQSALGFNKDRHGVSF 229          

HSP 2 Score: 164.851 bits (416), Expect = 1.406e-111
Identity = 80/80 (100.00%), Postives = 80/80 (100.00%), Query Frame = 1
Query:   22 MEPTNEFVPQINPITNTLITTSKGDYFSGKENLNAIKEDLLKEVKSEDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI 261
            MEPTNEFVPQINPITNTLITTSKGDYFSGKENLNAIKEDLLKEVKSEDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI
Sbjct:    1 MEPTNEFVPQINPITNTLITTSKGDYFSGKENLNAIKEDLLKEVKSEDGEVQGLWILTMVDHWNNNIEKAVLFMTNSIYI 80          
The following BLAST results are available for this feature:
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
TPRG14.340e-1326.72tumor protein p63 regulated 1 [Source:HGNC Symbol;... [more]
TPRG14.340e-1326.72tumor protein p63 regulated 1 [Source:HGNC Symbol;... [more]
TPRG1L3.002e-1258.82tumor protein p63 regulated 1 like [Source:HGNC Sy... [more]
TPRG19.590e-1034.55tumor protein p63 regulated 1 [Source:HGNC Symbol;... [more]
back to top
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tprg11.006e-1224.22tumor protein p63 regulated 1 [Source:ZFIN;Acc:ZDB... [more]
tprg11.006e-1224.22tumor protein p63 regulated 1 [Source:ZFIN;Acc:ZDB... [more]
tprg1l2.572e-1225.19tumor protein p63 regulated 1-like [Source:ZFIN;Ac... [more]
back to top
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ttc55.570e-1227.48tetratricopeptide repeat domain 5 [Source:Xenbase;... [more]
tprg1l9.925e-1248.65tumor protein p63 regulated 1-like [Source:NCBI ge... [more]
ttc51.694e-936.54tetratricopeptide repeat domain 5 [Source:Xenbase;... [more]
back to top
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tprgl7.987e-1345.83transformation related protein 63 regulated like [... [more]
Tprg3.546e-1225.95transformation related protein 63 regulated [Sourc... [more]
back to top
BLAST of Tumor protein p63-regulated gene 1 protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6ZUI0|TPRG1_HUMAN1.886e-1226.72Tumor protein p63-regulated gene 1 protein OS=Homo... [more]
sp|A8WCF8|TPRGL_RAT2.771e-1245.83Tumor protein p63-regulated gene 1-like protein OS... [more]
sp|Q9DBS2|TPRGL_MOUSE4.788e-1245.83Tumor protein p63-regulated gene 1-like protein OS... [more]
sp|Q5T0D9|TPRGL_HUMAN1.305e-1158.82Tumor protein p63-regulated gene 1-like protein OS... [more]
sp|Q32LJ4|TPRGL_BOVIN1.977e-1152.94Tumor protein p63-regulated gene 1-like protein OS... [more]
back to top
BLAST of Tumor protein p63-regulated gene 1 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564YDG32.737e-2738.32HSac2 domain-containing protein OS=Hymenolepis dim... [more]
W6U9Z32.975e-2736.25Tumor protein p63-regulated gene 1-like protein OS... [more]
A0A068XZQ19.962e-2736.25Protein fam79a OS=Echinococcus multilocularis OX=6... [more]
A0A068WMD51.674e-2636.25Protein fam79a OS=Echinococcus granulosus OX=6210 ... [more]
A0A0R3X3T39.255e-2635.98HSac2 domain-containing protein OS=Hydatigena taen... [more]
back to top
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tprg15.343e-1526.15tumor protein p63-regulated gene 1-like protein [S... [more]
tprg1l3.252e-1224.44tumor protein p63 regulated 1 like [Source:NCBI ge... [more]
back to top
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000009815.12.599e-1141.18pep scaffold:Pmarinus_7.0:GL479354:40778:44882:1 g... [more]
ENSPMAT00000004130.18.863e-1050.00pep scaffold:Pmarinus_7.0:GL487498:1683:4338:-1 ge... [more]
back to top
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO340291.049e-622.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tumor protein p63-regulated gene 1 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tprg11.303e-1225.19tumor protein p63-regulated gene 1-like protein [S... [more]
tprg11.303e-1225.19tumor protein p63-regulated gene 1-like protein [S... [more]
tprg1l9.984e-1223.08tumor protein p63 regulated 1 like [Source:NCBI ge... [more]
back to top
BLAST of Tumor protein p63-regulated gene 1 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000033840.11.406e-11199.34SMESG000033840.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019715 ID=SMED30019715|Name=Tumor protein p63-regulated gene 1 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1105bp
ATTATTCAAATAGCGTTTGTTATGGAACCAACTAATGAGTTTGTTCCTCA
AATTAATCCAATTACGAATACTCTTATTACAACGTCAAAAGGCGATTATT
TCAGTGGAAAGGAAAATCTAAATGCTATAAAGGAAGACTTGCTTAAGGAG
GTTAAATCTGAAGATGGAGAAGTTCAAGGCTTATGGATTTTAACAATGGT
CGATCATTGGAACAATAACATTGAGAAAGCAGTTTTATTCATGACCAATT
CTATATATATTTAGATATGATTTTGTATTGAAAAAAGTTAAGGATGTCAA
AGTAGTGAAGGTTGCCGATATTGTTGAAATTAAAATTGGAACTTTGACTT
TTCCTGATAAATCTTTAATGCCATCAAGAAATATTAACGGTATCGAAATT
GTATGGGGTGATGTCAGCCAGGTTACATGGACTCAACGATGGAATCCACT
GTGTAAAAGTATACCGAGCTGTATTTTGATCAATCATCCTTTGTTTTACT
CAAAATTATCTGAAGATAAACCATTAGTTATAGAAAGAGAGAATTTTTCT
ACCGAAAATTTACGATTTACACTAGAAAATGTAATATCAGATGCAACCAA
ATTTAAAAATGAAAATATTATTGTTAATTCCTATGGCAATGTGGCGAGTT
TGATATTTAATCAAAGTGCACTTGGATTCAACAAGGATCGACATGGGGTT
AGCTTCTAAACGTCATCACAAATATTAGTGTGGATTGGTTGATTGTGTAT
TTCATTAAAATGTTTATGAGTAGTATTTCAATTTATTAAATCATTATATG
TGTAACATTCATATCACTTCTTGATCATTTATATTCGATCATAGTTCATT
TAAGCTTACTTGATAATGATTAAAATATTTTCGTCATGAAAGATTTGGTA
AGTATATAATAATAATTTATCGGCTTCATTTCTCATTTTTAATAATTGAG
TTGCATTTGGTTTGTTGCATTGTTTGCTGTGGATTGTCTGTGTTTTCTAT
ACGAAATTATGTCATTCATGGCCAGTATCAGCGTGTTTAATTAATGATTT
ATTCTCTTTAAAATATATCTACATTTTGGTTGTATATAAATACAGTTTAA
GCAAC
back to top

protein sequence of SMED30019715-orf-1

>SMED30019715-orf-1 ID=SMED30019715-orf-1|Name=SMED30019715-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=114bp
MPSRNINGIEIVWGDVSQVTWTQRWNPLCKSIPSCILINHPLFYSKLSED
KPLVIERENFSTENLRFTLENVISDATKFKNENIIVNSYGNVASLIFNQS
ALGFNKDRHGVSF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000103central nervous system
Vocabulary: INTERPRO
TermDefinition
IPR040242TPRG1-like
IPR034753hSac2
IPR022158Inositol_phosphatase
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 37..57
IPR022158Inositol phosphatasePFAMPF12456hSac2coord: 45..87
e-value: 7.4E-5
score: 22.4
IPR040242Tumor protein p63-regulated gene 1-likePANTHERPTHR31108FAMILY NOT NAMEDcoord: 19..87
IPR034753hSac2 domainPROSITEPS51791HSAC2coord: 34..88
score: 10.279