Glutamate receptor

Overview
NameGlutamate receptor
Smed IDSMED30019712
Length (bp)3101
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutamate receptor (SMED30019712) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutamate receptor (SMED30019712) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutamate receptor (SMED30019712) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutamate receptor (SMED30019712) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019712

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30019712SMESG000073692.1 SmedASXL_007239SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30019712SMESG000073268.1 SmedASXL_016881SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30019712SMESG000073692.1 dd_Smed_v4_17395_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019712SMESG000073268.1 dd_Smed_v4_7562_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019712SMESG000073268.1 dd_Smed_v4_7562_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30019712SMESG000073692.1 dd_Smed_v6_17395_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30019712SMESG000073268.1 dd_Smed_v6_7562_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30019712SMESG000073268.1 OX_Smed_1.0.13048ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutamate receptor vs. Ensembl Human
Match: GRIA1 (glutamate ionotropic receptor AMPA type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4571])

HSP 1 Score: 553.903 bits (1426), Expect = 0.000e+0
Identity = 312/798 (39.10%), Postives = 479/798 (60.03%), Query Frame = 3
Query:  417 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE----VDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            PN + +G +F   ++ S E+ AF    A    +     + +  +V   +ISDSF+M    C      V A+FG    RTV+ + S   A  + +IT S    +  +++N+     +++LRP + +A++  I    WQ+ +Y+YD++  L  L+ + +    +   ++A       + ++   + + +  ++  ++ +++D + E   N I+ Q+ +L+K+ + YHY++  +   +I  +     G N T F  ++Y + +  + I  QW    +R   +         ++  Y +AL  DG++++  A + +++  R       N+GD + +P   P     +++ A+ +++F GLTGNVQFNE G R NY + +IE +  + ++ IG W+          +       +  +NRT  V++IL  P++M  K+ N   G D   +EG+C +L  EIAK + ++Y +  V D ++GA   D  +WNGM+GEL+   AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  +   E      S  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +++GS+KEFF  SKI +F+KMW +M+S  P VFV+    G+ +V  S+ +YA++LES+MN+Y   ++PC+T KVG NLDS KGYGIATP GS LR  +NLAVL+L E+  + ++  +WW ++ +C
Sbjct:   22 PNNIQIGGLFP--NQQSQEHAAFRF--ALSQLTEPPKLLPQIDIV---NISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPS----FPVDTSNQF----VLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVN---ILTTTEEGYRMLFQDLEKKKERLVVVDCESER-LNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAK-IMQQWKNSDARDHTRVD------WKRPKYTSALTYDGVKVMAEAFQ-SLRRQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMK-HDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGND--RYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGEC 787          
BLAST of Glutamate receptor vs. Ensembl Human
Match: GRIA1 (glutamate ionotropic receptor AMPA type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4571])

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 312/798 (39.10%), Postives = 480/798 (60.15%), Query Frame = 3
Query:  417 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE----VDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            PN + +G +F   ++ S E+ AF    A    +     + +  +V   +ISDSF+M    C      V A+FG    RTV+ + S   A  + +IT S    +  +++N+     +++LRP + +A++  I    WQ+ +Y+YD++  L  L+ + +    +   ++A       + ++   + + +  ++  ++ +++D + E   N I+ Q+ +L+K+ + YHY++  +   +I  +     G N T F  ++Y + +  + I  QW    +R   +         ++  Y +AL  DG++++  A + +++  R       N+GD + +P   P     +++ A+ +++F GLTGNVQFNE G R NY + +IE +  + ++ IG W+          +       +  +NRT  V++IL  P++M  K+ N   G D   +EG+C +L  EIAK + ++Y +  V D ++GA   D  +WNGM+GEL+   AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  +   E      S  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +++GS+KEFF  SKI +F+KMW +M+S  P VFV+    G+ +V  S+ +YA++LES+MN+Y   ++PC+T KVG NLDS KGYGIATP GS LR+ +NLAVL+L E+  + ++  +WW ++ +C
Sbjct:   22 PNNIQIGGLFP--NQQSQEHAAFRF--ALSQLTEPPKLLPQIDIV---NISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPS----FPVDTSNQF----VLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVN---ILTTTEEGYRMLFQDLEKKKERLVVVDCESER-LNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAK-IMQQWKNSDARDHTRVD------WKRPKYTSALTYDGVKVMAEAFQ-SLRRQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMK-HDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGND--RYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGEC 787          
BLAST of Glutamate receptor vs. Ensembl Human
Match: GRIA4 (glutamate ionotropic receptor AMPA type subunit 4 [Source:HGNC Symbol;Acc:HGNC:4574])

HSP 1 Score: 551.206 bits (1419), Expect = 0.000e+0
Identity = 316/807 (39.16%), Postives = 480/807 (59.48%), Query Frame = 3
Query:  417 PNIVLVGAIFDSLDRNSPEYTAFNL----KSAGKTFSNAEDNIIKTKVVYVDDI--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSA----DARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLT---SIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS----NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            P+ V +G +F  +     EYTAF L     +     S A  N++     +VD+I  ++SF +  A C      V A+FG    R+VHT+ S   A  +  IT S    + +E  ++     +++LRP +  A++  +    W   ++LYD++     L+ I E        +SA    +    S+ Q   +L+ ++R+     +K  ++D + E  +N I++Q+  + K    YHY++  +  ++I     I+GG N T F  +D+N P++ + +  +W  +  ++ Y  S T  +    L Y+  L++   E  +   +  +  +R   N+GD + +P   P     +++  + +++  GLTGNVQF+  G R NY +D+ E +     + +G W+    L     +P   +D   +   +NRT+ V++I+  P++M  K+     G D  ++EG+C DL +EIAK +   Y I  V D ++GA   D+  WNGM+GEL+  +A++ +APLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P +     S    NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +DSGS+KEFF  SKI +++KMW +M S  P VF +  + G+ +V  S+ ++AF+LES+MN+Y   ++PC+T KVG NLDS KGYG+ATP GS LR+++NLAVL+L E+  + ++  +WW ++ +C
Sbjct:   24 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVP----HVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPS----FPTEGESQF----VLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQ---LLEELDRRQ----EKKFVIDCEIERLQN-ILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVIKLM-DRW-KKLDQREYPGSETPPKYTSALTYDGVLVM--AETFRSLRRQKIDISR-RGNAGDCLANPAA-PWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELK-STGPRKVGYWNDMDKLVLIQDVPTLGNDTAAI---ENRTVVVTTIMESPYVMYKKNHEMFEGND--KYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGVATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGEC 795          
BLAST of Glutamate receptor vs. Ensembl Human
Match: GRIA4 (glutamate ionotropic receptor AMPA type subunit 4 [Source:HGNC Symbol;Acc:HGNC:4574])

HSP 1 Score: 551.206 bits (1419), Expect = 0.000e+0
Identity = 316/807 (39.16%), Postives = 480/807 (59.48%), Query Frame = 3
Query:  417 PNIVLVGAIFDSLDRNSPEYTAFNL----KSAGKTFSNAEDNIIKTKVVYVDDI--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSA----DARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLT---SIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS----NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            P+ V +G +F  +     EYTAF L     +     S A  N++     +VD+I  ++SF +  A C      V A+FG    R+VHT+ S   A  +  IT S    + +E  ++     +++LRP +  A++  +    W   ++LYD++     L+ I E        +SA    +    S+ Q   +L+ ++R+     +K  ++D + E  +N I++Q+  + K    YHY++  +  ++I     I+GG N T F  +D+N P++ + +  +W  +  ++ Y  S T  +    L Y+  L++   E  +   +  +  +R   N+GD + +P   P     +++  + +++  GLTGNVQF+  G R NY +D+ E +     + +G W+    L     +P   +D   +   +NRT+ V++I+  P++M  K+     G D  ++EG+C DL +EIAK +   Y I  V D ++GA   D+  WNGM+GEL+  +A++ +APLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P +     S    NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +DSGS+KEFF  SKI +++KMW +M S  P VF +  + G+ +V  S+ ++AF+LES+MN+Y   ++PC+T KVG NLDS KGYG+ATP GS LR+++NLAVL+L E+  + ++  +WW ++ +C
Sbjct:   24 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVP----HVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPS----FPTEGESQF----VLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQ---LLEELDRRQ----EKKFVIDCEIERLQN-ILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVIKLM-DRW-KKLDQREYPGSETPPKYTSALTYDGVLVM--AETFRSLRRQKIDISR-RGNAGDCLANPAA-PWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELK-STGPRKVGYWNDMDKLVLIQDVPTLGNDTAAI---ENRTVVVTTIMESPYVMYKKNHEMFEGND--KYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGVATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGEC 795          
BLAST of Glutamate receptor vs. Ensembl Human
Match: GRIA1 (glutamate ionotropic receptor AMPA type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4571])

HSP 1 Score: 549.666 bits (1415), Expect = 4.537e-180
Identity = 302/750 (40.27%), Postives = 460/750 (61.33%), Query Frame = 3
Query:  561 DISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE----VDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            +ISDSF+M    C      V A+FG    RTV+ + S   A  + +IT S    +  +++N+     +++LRP + +A++  I    WQ+ +Y+YD++  L  L+ + +    +   ++A       + ++   + + +  ++  ++ +++D + E   N I+ Q+ +L+K+ + YHY++  +   +I  +     G N T F  ++Y + +  + I  QW    +R   +         ++  Y +AL  DG++++  A + +++  R       N+GD + +P   P     +++ A+ +++F GLTGNVQFNE G R NY + +IE +  + ++ IG W+          +       +  +NRT  V++IL  P++M  K+ N   G D   +EG+C +L  EIAK + ++Y +  V D ++GA   D  +WNGM+GEL+   AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  +   E      S  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +++GS+KEFF  SKI +F+KMW +M+S  P VFV+    G+ +V  S+ +YA++LES+MN+Y   ++PC+T KVG NLDS KGYGIATP GS LR+ +NLAVL+L E+  + ++  +WW ++ +C
Sbjct:   73 NISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPS----FPVDTSNQF----VLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVN---ILTTTEEGYRMLFQDLEKKKERLVVVDCESER-LNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAK-IMQQWKNSDARDHTRVD------WKRPKYTSALTYDGVKVMAEAFQ-SLRRQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMK-HDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGND--RYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGEC 797          
BLAST of Glutamate receptor vs. Ensembl Celegans
Match: glr-1 (Glutamate receptor 1 [Source:UniProtKB/Swiss-Prot;Acc:P34299])

HSP 1 Score: 436.417 bits (1121), Expect = 1.072e-136
Identity = 269/800 (33.62%), Postives = 428/800 (53.50%), Query Frame = 3
Query:  573 SFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNI-IKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRR--------IDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKS--TRFHT--------NSG--DQVCSPVTNPKY---------CADELKPAITRIKFMG----LTGNVQFNESGFRHNYKIDIIE----ARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFS-------KNRTLRVSSILVPPFLMRVKD-------KNGKDTGEFEGFCKDLVNEIA-KMLNFTYTIHQVKDDQFGALVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMESN-PEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKCKKQVESNENSITKN 2810
            S+ M  A+C  L    +A+   +  +    I+ ++DA  +  ++ +   +   +   ++FG    + +RP ++  + DFI  + W  +L L D   A   L  ++ H  +R          DL AD +Q+     +  L   N   + N    I++D    +   +++  +   + ++ +YHY++   D          NG +N + F+       ++N+  +  W    S K +  +S++      +  EAA+  D + +        +++  + FH         N G     C P+++  +             +  A   +K       LTGN++F+  G R N+ + I++     +   + K +  W    G  S      + T+   S       K+  + V + LV PF+M  ++          +   +FEGFC DL+  +A K+  F Y I ++         + SW+GMIGEL+   A  VVA LTI   RERVVDFS PFM  G+S+M  KPD +E   F FM+PLS +IWM I FAY+GVSVV+FLVSRF+PYEW V+        +SN+F+++N  WF+L+AFMQQG DI PRS++GRI    WWFFT+IIVSSYTANLAA+LT+E+M  PI+S EDLAKQ+KIKYG+   GS+  FF  S ++I+++MW +MES  P VFV + + GI +V + +  YAF+LE++ N+Y N ++PC+T KVG+NL+S  GYGIATP GSD +D INLA+L L+E+ ++ ++  +WW ++ +C   +  + +S + N
Sbjct:   80 SWNMVNAVCDELKEGAMALLSSVDGKGREGIRGVSDALEMPLVSLTALSN--DDHQQQQFGNLFEVSVRPPISELLADFIVHKGWGEVLVLIDPVHASLHLPSLWRHLRTRTNTSVKASMFDLPADEKQF-----EAYLMQFNMM-RNNETNRILIDCASPKRLKKLLINIRSAQFNQANYHYVLANYDFLPYDQEMFQNGNINISGFN-------IINKDGREYW----SLKKHLKTSSSLGGGDDVSVEAAVGHDAMLVTWHGFAKCLQANDSLFHGTFRHRRFFNRGFPGIYCDPLSDRSHPNRPFSSFEHGKTIGVAFRNMKIGHKEGTLTGNIEFDRFGNRKNFDVSIVDLVSNTKATFNSKEVLAWRQGVGFFS------NRTVAQHSRKSQNDHKDNQVIVLTNLVAPFVMIKRECLEMANLTECQGNNKFEGFCIDLLKLLADKIEEFNYEI-KLGTKAGSKQADGSWDGMIGELLSGRAHAVVASLTINQERERVVDFSKPFMTTGISIMIKKPDKQEFSVFSFMQPLSTEIWMYIIFAYIGVSVVIFLVSRFSPYEWRVEETSRGGFTISNDFSVYNCLWFTLAAFMQQGTDILPRSISGRIASSAWWFFTMIIVSSYTANLAAFLTLEKMQAPIESVEDLAKQSKIKYGIQGGGSTASFFKYSSVQIYQRMWRYMESQVPPVFVASYAEGIERVRSHKGRYAFLLEATANEYENTRKPCDTMKVGANLNS-IGYGIATPFGSDWKDHINLAILALQERGELKKLENKWWYDRGQCDAGITVDGSSASLN 852          
BLAST of Glutamate receptor vs. Ensembl Celegans
Match: glr-2 (Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10914])

HSP 1 Score: 402.134 bits (1032), Expect = 9.933e-124
Identity = 268/768 (34.90%), Postives = 402/768 (52.34%), Query Frame = 3
Query:  735 STNERFGKN------IIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFE--HTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKH------------------IILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVA-------------VKSTRFHTNSGDQVCSP------------VTNPKYCADELKPAITRIKFMGLTGNVQFNE-SGFRHNYKIDIIEARVK-ESLKTIG---NWSTSHGLT-----SIPRNKSDLTLVNF----SKNRTLR--VSSILVPPFLMRVKDKNG----KDTGEFEGFCKDLVNEIAK-MLNFTYTIHQVKDDQFGALVND-SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMESNPE-----------------VFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            S +E  GK       I  + P     ++D+I  + W+ ++Y++D   A   LR +F   H  S +  L  D    + S  +   +++N   +R S +H                  +I+DL+G       ++ ++E    + +YHY+ +  D  E   S      +N TIF   D NN    +F+K++         Y+   +N+     +P  AA   D + +  +AL++A             V+   F+       C P              + K  A+ +K  +   K   LTG +QF++ +G R N+  +I+E +    SL +I     W+   G        +   K D +        SK   LR  V ++LV PF+M  +   G    K    FEG+C DL+N +AK +  F Y +     +++G+   D SW+GMIG L+   AD+ VAPLTIT  RER VDFS PFM  G+S+M  KP+ +E   F FM+PL   IW+    +Y GVS+ +FLVS F+PYE  ++     +  V+NEFT++NS WF+L+AFMQQG DI PR+++GRI    WWFFTLIIVSSYTANLAA+LT+ERM  PI+S EDLA QNKI YGV + GS+  FF +S + ++KKMW FM S  +                 +FV + + GI KV  S+ +YAF+LE + N+Y + + PC+T KVG NL++  GYGIAT  G+ LR S+NLA+L L EK ++ ++  +WW ++ +C
Sbjct:  126 SKSENIGKTTENNPMIFSVAPSAEQLLIDYIQYKGWRDVVYIHDGKNADRTLRTMFSYLHEKSPKYQLFVD-NYVAPSDEEMFKEFLNEFHRRISTQHTLKSNDSSEEIDEPIPVNVIVDLEGSYRTRAFLRALEESVLVKKEYHYVFSNFDVDETDLSGFHFSLINITIFRIFDKNN---KKFLKTR---AEFHDVYRGGFSNTD---SIPTAAAFAHDAILVAGKALQIAMNEHGKGIFDKSFVRHQLFNRGRKGLYCRPHEDQTESRQFETFEHGKKIAEAIKKVVLTDKDGTLTGRIQFDKVTGKRTNFSAEIVEIKPGVNSLNSIWERFQWAEGEGFLLGGERYVQEKKKDSSQTRKGILPSKPWQLRFNVVTVLVKPFVMLKRRNPGEPELKGNDRFEGYCIDLLNLLAKNITGFEYDVFISDGNKYGSRQADGSWDGMIGYLLNETADVAVAPLTITQERERAVDFSKPFMTTGISIMIKKPEKQEFNIFSFMEPLGMTIWIFTLSSYFGVSLTIFLVSWFSPYEKRIEFK-RGEFTVTNEFTLYNSLWFTLAAFMQQGTDILPRAVSGRIASSCWWFFTLIIVSSYTANLAAFLTLERMTPPIESVEDLANQNKILYGVNEGGSTAAFFEDSIVPLYKKMWNFMVSTTQKQIELEKQSITNSTSNRIFVSSYADGIEKVRTSKGKYAFLLEETTNNYESGRRPCDTMKVGQNLNT-LGYGIATKIGNPLRVSLNLAILYLSEKGELKKLENKWWYDRGQC 881          
BLAST of Glutamate receptor vs. Ensembl Celegans
Match: glr-2 (Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10914])

HSP 1 Score: 367.466 bits (942), Expect = 1.961e-111
Identity = 251/717 (35.01%), Postives = 370/717 (51.60%), Query Frame = 3
Query:  816 ENWQRILYLYDSNEALFRLRMIFE--HTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVA-------------VKSTRFHTNSGDQVCSP------------VTNPKYCADELKPAITRIKFMGLTGNVQFNE-SGFRHNYKIDIIEARVK-ESLKTIG---NWSTSHGLT-----SIPRNKSDLTLVNF----SKNRTLR--VSSILVPPFLMRVKDKNG----KDTGEFEGFCKDLVNEIAK-MLNFTYTIHQVKDDQFGALVND-SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMESNPE-----------------VFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            + W+ ++Y++D   A   LR +F   H  S +  L  D    + S  +   +++N   +R S +H    LK  +S     +++DE  K R ++H               +  GG                                   S+T+S     +P  AA   D + +  +AL++A             V+   F+       C P              + K  A+ +K  +   K   LTG +QF++ +G R N+  +I+E +    SL +I     W+   G        +   K D +        SK   LR  V ++LV PF+M  +   G    K    FEG+C DL+N +AK +  F Y +     +++G+   D SW+GMIG L+   AD+ VAPLTIT  RER VDFS PFM  G+S+M  KP+ +E   F FM+PL   IW+    +Y GVS+ +FLVS F+PYE  ++     +  V+NEFT++NS WF+L+AFMQQG DI PR+++GRI    WWFFTLIIVSSYTANLAA+LT+ERM  PI+S EDLA QNKI YGV + GS+  FF +S + ++KKMW FM S  +                 +FV + + GI KV  S+ +YAF+LE + N+Y + + PC+T KVG NL++  GYGIAT  G+ LR S+NLA+L L EK ++ ++  +WW ++ +C
Sbjct:  159 KGWRDVVYIHDGKNADRTLRTMFSYLHEKSPKYQLFVD-NYVAPSDEEMFKEFLNEFHRRISTQHT---LKSNDSS----EEIDEPIKTRAEFHD--------------VYRGGF----------------------------------SNTDS-----IPTAAAFAHDAILVAGKALQIAMNEHGKGIFDKSFVRHQLFNRGRKGLYCRPHEDQTESRQFETFEHGKKIAEAIKKVVLTDKDGTLTGRIQFDKVTGKRTNFSAEIVEIKPGVNSLNSIWERFQWAEGEGFLLGGERYVQEKKKDSSQTRKGILPSKPWQLRFNVVTVLVKPFVMLKRRNPGEPELKGNDRFEGYCIDLLNLLAKNITGFEYDVFISDGNKYGSRQADGSWDGMIGYLLNETADVAVAPLTITQERERAVDFSKPFMTTGISIMIKKPEKQEFNIFSFMEPLGMTIWIFTLSSYFGVSLTIFLVSWFSPYEKRIEFK-RGEFTVTNEFTLYNSLWFTLAAFMQQGTDILPRAVSGRIASSCWWFFTLIIVSSYTANLAAFLTLERMTPPIESVEDLANQNKILYGVNEGGSTAAFFEDSIVPLYKKMWNFMVSTTQKQIELEKQSITNSTSNRIFVSSYADGIEKVRTSKGKYAFLLEETTNNYESGRRPCDTMKVGQNLNT-LGYGIATKIGNPLRVSLNLAILYLSEKGELKKLENKWWYDRGQC 812          
BLAST of Glutamate receptor vs. Ensembl Celegans
Match: glr-3 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q21415])

HSP 1 Score: 356.295 bits (913), Expect = 4.758e-108
Identity = 221/673 (32.84%), Postives = 367/673 (54.53%), Query Frame = 3
Query:  792 AVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDG-VLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIIN-GGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKY-CADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWST------SHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGAL-VNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYE-WGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMESNPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKCKKQ 2777
            AV  FI  E W+ ++ +++  + L  +  +    +      S+   +       G  L++I  K  R     I++++  +++ +  ++Q   +    V YHY+V +MD   +    I      N T F   D N+    E+I      E  R+     S+     + +PY  ++ +D L LL R++K             D+   P     +    ++K         G++G++ +  SG R NY + +   R   S +    WS+      S     I  +   LTL    + + L++S  L  PF+M   +      G +EG+C DL+++IA +L FTYTI +V+D+ +G+   N  W+GM+GEL R +ADL VA LTI+  R  V+DF+ P+M  G+S++F KP  R+ + F FM PLS  +W+    +Y  VSV ++++++ +PYE +  D        V N+F++ NSFWF++ + MQQG ++ PR+ + R++ G+WWFF LI++SSYTANLAA LT  RM  PI++ +DLA Q KIKYG +  GS+  FF  SKIE +++MW  M S+P +FV++   GI +V +S  +YA+++ESSM + Y ++  CE  ++G  +D  KGYGI  P GS  R+ I+ A+L L+EK ++ ++ ++WW+++S   +Q
Sbjct:  138 AVAAFIKREKWKDVVVVFEEPDELLEITDMITAGHFDPDSFSSQLVRLKHGDDYGNELKHIKNKLDRY---RIVINIPLQKALH-FLEQAANMSMCGVLYHYVVMDMDLVTVDIDSIRGIEDCNITSFGVHDVNS----EYI------EDIRQEIVHKSSIRLPKKGVPYTTSIWIDTLRLLIRSMK--------SIQIWDE---PRCGSSWKSGSDIKKRFFENPLAGISGDLHWAPSGERSNYTLHVY--RRTLSFQKFAEWSSRTRRIASSEAVVIANSSEKLTL----EGKHLKISVYLEAPFVMITSN------GSYEGYCIDLLHKIANILKFTYTIQKVRDNAYGSKESNGKWSGMVGELQRGDADLAVASLTISYGRSEVIDFTVPYMHLGISILFKKPRIRDSDWFKFMDPLSTQVWIMTFASYFVVSVAIWIIAKISPYEQFERDEDNGQYKPVDNQFSLRNSFWFTVCSLMQQGSELCPRAASTRLLTGIWWFFALILISSYTANLAAVLTTRRMETPIENADDLAAQTKIKYGTLGRGSTMSFFNESKIETYERMWQLMSSSPGLFVQSSKEGIARVKSS--DYAYLMESSMLE-YAVERDCELMQIGGLIDQ-KGYGIGLPKGSPYRELISTAILRLQEKTELTELKEKWWKDKSVVCEQ 769          
BLAST of Glutamate receptor vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 332.798 bits (852), Expect = 4.961e-99
Identity = 185/446 (41.48%), Postives = 279/446 (62.56%), Query Frame = 3
Query: 1470 LTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPR--NKSDLTLVNFSKNRT---LRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS---WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEA--FGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEW-GVDTPVEVD----SKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFME-SNPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQ 2759
            LTG+VQF  +G R +     +  R+      +GNWS   G     R  N+ +  +   S++     LRV   L  PF++    K G++  ++EGFC DL+NE+ ++L F YTI +V+D  +G  + D    WNG+IG L R+EADL ++ +TIT SR  VVDF+ PFM  G+S++  +  +   +   + F++PLS  +W+ +  +Y  VS  + ++++F+PYEW  ++   E D        N+FT+ NSFWF++ + MQQG D+ PR+ A R++  VWW FT II+SSYTA LAA+LTVERM+ PI+S +DLA Q KI+YGV+ SGS+ +FF  SKI ++++MW  ME S+P VFV +   GI +V +    YA+++ESSM +YY L+  CE   +G  LDS KGYGIA P GS LRD ++  VL+L+E+  +  +  +WW ++
Sbjct:  345 LTGDVQFKSNGERDDIMYHGV-GRINSQFVKLGNWSEKRGWNFDSRYANRWEFDIDPDSEDLEGLHLRVVVYLEEPFVI----KTGEN--QYEGFCIDLLNEMTQVLKFNYTIIEVQDGTYG--IEDESGRWNGIIGALQRHEADLSLSAVTITYSRAEVVDFTLPFMHLGISILLARTSEETDKGSLWTFLEPLSLTVWISLLISYCIVSYSMHILAKFSPYEWYNLERIDERDFENIKNQKNQFTVLNSFWFTMGSLMQQGSDVIPRAAATRLIAVVWWMFTQIIISSYTAQLAAFLTVERMSTPIESTQDLANQQKIRYGVLKSGSTMDFFRESKIPMYERMWSVMESSSPGVFVNSSREGIARVKSGG--YAYMMESSMLEYY-LERDCELQSIGGLLDS-KGYGIALPKGSPLRDILSRTVLQLQERTILEALKNKWWRDR 777          
BLAST of Glutamate receptor vs. Ensembl Fly
Match: GluRIA (gene:FBgn0004619 transcript:FBtr0076982)

HSP 1 Score: 467.618 bits (1202), Expect = 4.707e-148
Identity = 279/825 (33.82%), Postives = 440/825 (53.33%), Query Frame = 3
Query:  549 VYVDDI--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYIT-YSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEH--TNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIIN-GGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAV--KSTRFHTN---------------SGDQVCSPVTN---------PKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLV-------NFSKNRTLRVSSILVPPFLMRVKDKNGKD---TGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGA---LVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS-----------------------NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMESNPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKCK-KQVESNENSITKNSV 2816
             YVD I  +D+F+++  IC      V ++ G + P +  T+ S ++  ++ ++T +      A  S    F    I +RP    A++D I    WQ I+YLYDS++ L RL+ I++     +    +    R  + + +   L  +     R S+K I+LD   E +K  I+Q + ++K  R  YHYL++ +       S ++  G +N T F  +D N   + +F  S+   E S +S   ++     L  +  +AAL+ D + +L  A    +  K  +F +N               +G    S + +         P    +++   + +++  GL+G ++F+E G R NY + ++E  V  +L+ +  W    GL  +  +    +         ++ +N T  VSS+L  P+L   +   G+       FEG+CKDL + +A  L   Y I  V+D  +GA        W+GM+GEL+R EAD+ ++ +TIT+ RERV+DFS PFM  G+S+M  KP  + P  F F+ PLS++IW+ +  +Y+GVS VL+ V+RF PYEW +    + DS                          NEFT+ NSFW+SL+AFMQQG DI+P S+AGRI   VWWFFT+I++SSYTANLAA+LTVERM  PIK+ EDL  Q  + YG +  GS+ EFF  S+I +  KMW +M +N    V     GI +V  S+ +YA ++ES  N+Y N + PC+T KVG N+D+ KG+G+ATP GS LR  +N AVL LKE  ++ ++  +WW ++++C   Q  S  N ++ ++V
Sbjct:   77 AYVDVINTADAFKLSRLICNQFSRGVYSMLGAVSPDSFDTLHSYSNTFQMPFVTPWFPEKVLAPSSGLLDFA---ISMRPDYHQAIIDTIQYYGWQSIIYLYDSHDGLLRLQQIYQELKPGNETFRVQMVKRIANVTMAIEFLHTLEDLG-RFSKKRIVLDCPAEMAKEIIVQHVRDIKLGRRTYHYLLSGLVMDNHWPSDVVEFGAINITGFRIVDSNRRAVRDFHDSRKRLEPSGQSQSQNAGGPNSLPAISAQAALMYDAVFVLVEAFNRILRKKPDQFRSNHLQRRSHGGSSSSSATGTNESSALLDCNTSKGWVTPWEQGEKISRVLRKVEIDGLSGEIRFDEDGRRINYTLHVVEMSVNSTLQQVAEWRDDAGLLPLHSHNYASSSRSASASTGDYDRNHTYIVSSLLEEPYLSLKQYTYGESLVGNDRFEGYCKDLADMLAAQLGIKYEIRLVQDGNYGAENQYAPGGWDGMVGELIRKEADIAISAMTITAERERVIDFSKPFMTLGISIMIKKPVKQTPGVFSFLNPLSQEIWISVILSYVGVSFVLYFVTRFPPYEWRIVRRPQADSTAQQPPGIIGGATLSEPQAHVPPVPPNEFTMLNSFWYSLAAFMQQGCDITPPSIAGRIAAAVWWFFTIILISSYTANLAAFLTVERMVAPIKTPEDLTMQTDVNYGTLLYGSTWEFFRRSQIGLHNKMWEYMNANQHHSVHTYDEGIRRVRQSKGKYALLVESPKNEYVNARPPCDTMKVGRNIDT-KGFGVATPIGSPLRKRLNEAVLTLKENGELLRIRNKWWFDKTECNLDQETSTPNELSLSNV 896          
BLAST of Glutamate receptor vs. Ensembl Fly
Match: KaiR1D (gene:FBgn0038837 transcript:FBtr0083987)

HSP 1 Score: 450.284 bits (1157), Expect = 4.544e-143
Identity = 285/833 (34.21%), Postives = 457/833 (54.86%), Query Frame = 3
Query:  399 KRRQPIPNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNII-KTKVVY-VDDIS--DSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRP---LVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYH-YLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADE--LKPAITRIKFM------GLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSH----GLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDK---NGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGAL--VNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWW-ENQSKCKKQVESNENSITKNSV 2816
            ++ Q +P+I+ +G +F   D    ++     + A     NA+ +I+ ++K+V  ++ IS  DSF     +C LL   V A+FGP    T   +QS+ D   + ++     +    ES        ++ L P    ++ A VD +    W+    +Y++N+ + RL+ + +        ++   RQ S S   G  + + ++ K +++ HI+LD   E   + +++Q  ++     DYH YLVT +D   +       GG N T F  +  N  ++++ ++ QW  +      +     S  L  +  E AL+ D + L  +AL     S +   +           P  C  +   +   + I +M      GLT  ++F+  GFR ++ +DI+E      ++ IG W+++       T     K      N  KN+TL V++IL  P+ MR +     +G D  +FEG+  DL++EI+K L F Y I  V D  +G+L  +   WNGMI EL+   ADL +A LTIT  RE+ VDF+TPFM  G+S+++ KP  + P  F F+ PLS D+W+ +  AYLGVSV+LF++++F PYEW   T    + KV ++FT+ N  WF++ + MQQG D  P++L+ R+V G+WWFFTLI++SSYTANLAA+LTVERM++PI+S EDLAKQ +IKYG +  GS+  FF +SKI  +++MW FMES  P VF  +   G+ +V   +  YAF++ES+  +Y   +  CE T+VG  LD+ K YGIATPP S  R +IN  +L+L+E+ K+  +  +WW E +   K +VE++++S   N +
Sbjct:   21 RKAQSLPDIIKIGGLFHPAD----DHQELAFRQAVDRI-NADRSILPRSKLVAQIERISPFDSFHAGKRVCGLLNIGVAAIFGPQSSHTASHVQSICDNMEIPHLENRWDYRLRRESC-------LVNLYPHPNTLSKAYVDIVRHWGWKTFTIIYENNDGIVRLQELLKAHGMTPFPITV--RQLSDS---GDYRPLLKQIKNSAEAHIVLDCSTERI-HEVLKQAQQIGM-MSDYHSYLVTSLDLHTVNLDEFRYGGTNITGFRLI--NEKIVSDVVR-QWSID------EKGLLRSANLTTVRSETALMYDAVHLFAKALHDLDTSQQIDIH-----------PISCDGQSTWQHGFSLINYMKIVEMKGLTNVIKFDHQGFRTDFMLDIVEL-TPAGIRKIGTWNSTLPDGINFTRTFSQKQQEIEANL-KNKTLVVTTILSNPYCMRKESAIPLSGND--QFEGYAVDLIHEISKSLGFNYKIQLVPDGSYGSLNKLTGEWNGMIRELLEQRADLAIADLTITFEREQAVDFTTPFMNLGVSILYRKPIKQPPNLFSFLSPLSLDVWIYMATAYLGVSVLLFILAKFTPYEWPAYTDAHGE-KVESQFTLLNCMWFAIGSLMQQGCDFLPKALSTRMVAGIWWFFTLIMISSYTANLAAFLTVERMDSPIESAEDLAKQTRIKYGALKGGSTAAFFRDSKISTYQRMWSFMESARPSVFTASNGEGVERVAKGKGSYAFLMESTSIEYVT-ERNCELTQVGGMLDT-KSYGIATPPNSPYRTAINSVILKLQEEGKLHILKTKWWKEKRGGGKCRVETSKSSSAANEL 807          
BLAST of Glutamate receptor vs. Ensembl Fly
Match: CG11155 (gene:FBgn0039927 transcript:FBtr0333701)

HSP 1 Score: 406.371 bits (1043), Expect = 7.760e-126
Identity = 283/815 (34.72%), Postives = 428/815 (52.52%), Query Frame = 3
Query:  414 IPNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDIS-----DSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFI-KSQWLTESSRKSYQPSSTNSQRLQKLPY---EAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKY-----CADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFS--KNRTLRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALV--NDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSK-VSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSK-CKKQVESNEN 2795
            +P ++ VGAIF   +R S   +AF  K A    +  +  +  T++VY  DI      DSF+    +C  L + V A+FGP        +QS+ +A  + +I       Y S+     F  N+     L+  A  D +   NW ++  +Y+ +  LF L     H+++        A  Y    S    + + R  ++     II+D      K+   + + +L+ +   YHY+ T  D             +N T F  +D ++    E I + Q L  +   +   S          PY   E+AL+ D +      L     +   H N   +  S  ++  +       +++  AIT     GLTG VQF E G R+ +K+DI++ + +E ++ +G W    G+     N SD T    S   N TL V +    P++M  +DKN      FEGFC DL+  IA  + F Y I  V D+ +G  +   +SWNG++ ELM   ADL VA +TI  +RE V+DF+ PFM  G+ ++F  P  +    F FM PL+ +IW+ +  AY+ VS  LF+++RF+PYEW    P   ++  V N+F+I NSFWF    F++QG  ++P++ + RIVGG W+FF LII+SSYTANLAA+LTVERM +PI+S  DLA+Q +I YG ++ GS+  FF +SKI I++KMW +ME+    VFVK    GI +V+  +  YAF++ES+M D Y +Q  C  T++G  LDS KGYGIATP GS  RD I+LA+LEL+EK  I  +  +WW+N    C +  +S E+
Sbjct:   39 LPPVIRVGAIFTEDERESSIESAF--KYAIYRINKEKTLLPNTQLVY--DIEYVPRDDSFRTTKKVCSQLEAGVQAIFGPTDALLASHVQSICEAYDIPHIEGRIDLEYNSK----EFSINLYPSHTLLTLAYRDIMVYLNWTKVAIIYEEDYGLFNLM----HSSTE-----TKAEMYIRQASPDSYRQVLRAIRQKEIYKIIVDTNPSHIKS-FFRSILQLQMNDHRYHYMFTTFDLETYDLEDFRYNSVNITAFRLVDVDSKRYLEVINQMQKLQHNGLDTINGS----------PYIQTESALMFDSVYAFANGLHFL--NLDNHQNFYIKNLSCTSDQTWNDGISLYNQINAAITD----GLTGTVQFVE-GRRNIFKLDILKLK-QEKIQKVGYWHPDDGV-----NISDPTAFYDSNIANITLVVMTREERPYVMVKEDKNLTGNLRFEGFCIDLLKAIATQVGFQYKIELVPDNMYGVYIPETNSWNGIVQELMERRADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFSISNSFWFITGTFLRQGSGLNPKATSTRIVGGCWFFFCLIIISSYTANLAAFLTVERMISPIESASDLAEQTEISYGTLEGGSTMTFFRDSKIGIYQKMWRYMENRKTAVFVKTYEDGIKRVM--EGSYAFLMESTMLD-YAVQRDCNLTQIGGLLDS-KGYGIATPKGSPWRDKISLAILELQEKGIIQILYDKWWKNTGDVCNRDDKSKES 808          
BLAST of Glutamate receptor vs. Ensembl Fly
Match: CG11155 (gene:FBgn0039927 transcript:FBtr0089195)

HSP 1 Score: 406.371 bits (1043), Expect = 7.760e-126
Identity = 283/815 (34.72%), Postives = 428/815 (52.52%), Query Frame = 3
Query:  414 IPNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDIS-----DSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFI-KSQWLTESSRKSYQPSSTNSQRLQKLPY---EAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKY-----CADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFS--KNRTLRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALV--NDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSK-VSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSK-CKKQVESNEN 2795
            +P ++ VGAIF   +R S   +AF  K A    +  +  +  T++VY  DI      DSF+    +C  L + V A+FGP        +QS+ +A  + +I       Y S+     F  N+     L+  A  D +   NW ++  +Y+ +  LF L     H+++        A  Y    S    + + R  ++     II+D      K+   + + +L+ +   YHY+ T  D             +N T F  +D ++    E I + Q L  +   +   S          PY   E+AL+ D +      L     +   H N   +  S  ++  +       +++  AIT     GLTG VQF E G R+ +K+DI++ + +E ++ +G W    G+     N SD T    S   N TL V +    P++M  +DKN      FEGFC DL+  IA  + F Y I  V D+ +G  +   +SWNG++ ELM   ADL VA +TI  +RE V+DF+ PFM  G+ ++F  P  +    F FM PL+ +IW+ +  AY+ VS  LF+++RF+PYEW    P   ++  V N+F+I NSFWF    F++QG  ++P++ + RIVGG W+FF LII+SSYTANLAA+LTVERM +PI+S  DLA+Q +I YG ++ GS+  FF +SKI I++KMW +ME+    VFVK    GI +V+  +  YAF++ES+M D Y +Q  C  T++G  LDS KGYGIATP GS  RD I+LA+LEL+EK  I  +  +WW+N    C +  +S E+
Sbjct:   39 LPPVIRVGAIFTEDERESSIESAF--KYAIYRINKEKTLLPNTQLVY--DIEYVPRDDSFRTTKKVCSQLEAGVQAIFGPTDALLASHVQSICEAYDIPHIEGRIDLEYNSK----EFSINLYPSHTLLTLAYRDIMVYLNWTKVAIIYEEDYGLFNLM----HSSTE-----TKAEMYIRQASPDSYRQVLRAIRQKEIYKIIVDTNPSHIKS-FFRSILQLQMNDHRYHYMFTTFDLETYDLEDFRYNSVNITAFRLVDVDSKRYLEVINQMQKLQHNGLDTINGS----------PYIQTESALMFDSVYAFANGLHFL--NLDNHQNFYIKNLSCTSDQTWNDGISLYNQINAAITD----GLTGTVQFVE-GRRNIFKLDILKLK-QEKIQKVGYWHPDDGV-----NISDPTAFYDSNIANITLVVMTREERPYVMVKEDKNLTGNLRFEGFCIDLLKAIATQVGFQYKIELVPDNMYGVYIPETNSWNGIVQELMERRADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFSISNSFWFITGTFLRQGSGLNPKATSTRIVGGCWFFFCLIIISSYTANLAAFLTVERMISPIESASDLAEQTEISYGTLEGGSTMTFFRDSKIGIYQKMWRYMENRKTAVFVKTYEDGIKRVM--EGSYAFLMESTMLD-YAVQRDCNLTQIGGLLDS-KGYGIATPKGSPWRDKISLAILELQEKGIIQILYDKWWKNTGDVCNRDDKSKES 808          
BLAST of Glutamate receptor vs. Ensembl Fly
Match: Ekar (gene:FBgn0039916 transcript:FBtr0110906)

HSP 1 Score: 387.111 bits (993), Expect = 9.699e-119
Identity = 276/822 (33.58%), Postives = 421/822 (51.22%), Query Frame = 3
Query:  414 IPNIVLVGAIFDSLD--RNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEES----KNRIIQQMDELKKDRVDYHYLVTEMDAR-----EIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESS--RKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDS-KVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSK-CKKQ---VESNENSITKNSV 2816
            +P +V +GAIF +     NS     + +       S   +  +   V YV+   DSF+    +C+L+   V AVF P        I S+ DA  +  I  S AH          F  N+   + LV  A  D I   NW R   L++    +  L     H  SR        RQ S       L     K   N    II+D          KN + QQM+E K     YHYL T  D       + K +F+     N T F  +D  +  + + +K   L      +K Y   + + ++   L  E AL+ D + +    L+   +S   H+ +   +     N       L   +  +++ GLTG +QF + G R  +K+D+I+ + + S+  +G W T HG  +I   +  +     S N TL V +IL  P++M    KN      F GFC D++  I++ + F Y +  V D ++GA   ++  WNGM+ +LM+ +ADL V  +TIT +RE V+DF+ PFM  G+S++F  P       F FM PL+ +IW+ +  AY  VS+ +++V + +P EW      ++++  + N+F++ +SFWF++  FMQQ  DI PR+++ RI+   W FF+LIIV+SYTANLAA+LT ERM NPI++ EDLA Q +I YG +DSGS+  FF +S IE +KK+W  M++  P  F      GI +V  +Q  YAF++ES+M DY  +Q  C  T++G  LD+ KGYGIATP GS  RD I+LA+LEL+E+  I  +  +WW+N  + C ++    +S  NS+   S+
Sbjct:   19 VPPLVRIGAIFSNQPGMYNSELAFRYAIHRLNMDKSLLPETTVDYYVEYVNRF-DSFETVQKVCKLIRVGVQAVFSPTDSVLATHINSICDALDIPNIGRS-AHD---------FSINVYPSKQLVNYAFNDVIQYLNWTRFGILHEKENGIINL-----HQLSRSFHGEVHMRQVSRDSYVSALNEFKGKEIHN----IIIDTNSNGISILLKNILQQQMNEYK-----YHYLFTSFDLETYDLEDFKYNFV-----NITSFRLVDTADVGVKQILKDIGLYSHHIFKKPYL--NLHIKKSTILESEPALMFDSVYVFAIGLQTLEQS---HSLTLLNISCEEENSWDGGLSLINYLNAVEWKGLTGPIQFKD-GQRVQFKLDLIKLK-QHSIVKVGEW-TPHGHLNI--TEPSMFFDAGSMNVTLVVITILETPYVMMHYGKNFTGNERFYGFCVDILETISREVGFDYILDLVPDRKYGAKDPETGEWNGMVAQLMKYKADLAVGSMTITYARESVIDFTKPFMNLGISILFKVPTSEPTRLFSFMNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPIEWKCINACDLENISIGNQFSLTDSFWFTIGTFMQQSPDIYPRAMSTRIISSTWGFFSLIIVASYTANLAAFLTTERMINPIENAEDLASQTEISYGTLDSGSTMTFFRDSVIETYKKIWRSMDNKKPSAFTTTYEDGIKRV--NQGNYAFLMESTMLDYI-VQRDCNLTQIGGLLDT-KGYGIATPKGSPWRDKISLAILELQERGDIQMLYDKWWKNTDETCTRKNTSKQSKANSLGLESI 796          
BLAST of Glutamate receptor vs. Ensembl Zebrafish
Match: gria4a (glutamate receptor, ionotropic, AMPA 4a [Source:ZFIN;Acc:ZDB-GENE-020125-7])

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 313/797 (39.27%), Postives = 475/797 (59.60%), Query Frame = 3
Query:  417 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDI--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFS--KNRTLRVSSILVPPFLMRVKDKNGKDTGE-FEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE-----VDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            P+ V +G +F  +     EYTAF L       S          V +VD+I  ++SF +  A C      V A+FG    R+VHT+ S   A  +  +T S    + +E   +     +++LRP +  A++  +   +W R ++LYD++     L+ I E        +SA   +   + +D   + +     R  +K  ++DL+ E  +N I++Q+  + K    YHY+V  +  ++I     ++GG N T F  +D++ P++ + ++ +W  +  ++ Y  S +  +    L Y+  L++   E  +   +  +  +R   N+GD + +P   P     +++  + +++  GLTGN+QF+  G R NY +D+ E +     + IG W+    L  +   +++L++ N S  +NRT+ V++I+  P++M  K+    +  E FEG+C DL +EIAK +   Y I  V D ++GA   ++  WNGM+GEL+  +A++ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P E        +  NEF IFNS WFSL AFMQQG D +PRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +DSGS+KEFF  SKI +++KMW +M+S  P VF K  + G+ +V  S+ +YAF+LES+MN+Y   ++PC+T KVG NLDS KGYG+ATP GS LR  +NLAVL+L E   + ++  +WW ++ +C
Sbjct:   19 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNATEAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLVTPS----FPAEGETQF----VLQLRPSIRGALLSLLDHYDWSRFVFLYDTDRGYAVLQAIMEKAGQNGWQVSAICVE---NFNDASYRRLLEDLDRRQEKKFVIDLEAERLQN-ILEQIVSVGKHVKGYHYIVANLGFKDISLERFMHGGANVTGFQLVDFSKPMVIKLMQ-RW-NKLDQREYPGSESPPRYTSSLTYDGVLVM--AEAFRNLRRQKIDISR-RGNAGDCLANPAA-PWNQGIDMERTLKQVRIQGLTGNIQFDHYGRRVNYTMDVFELK-SNGPRKIGYWNDLDKLVLV---QNELSMGNDSAMENRTVIVTTIMEGPYVMLKKNWEMYEGNEQFEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEEGSDGPPSDQPPNEFGIFNSLWFSLGAFMQQGCDFTPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDS-KGYGVATPKGSQLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGEC 790          
BLAST of Glutamate receptor vs. Ensembl Zebrafish
Match: gria4b (glutamate receptor, ionotropic, AMPA 4b [Source:ZFIN;Acc:ZDB-GENE-030131-8013])

HSP 1 Score: 549.28 bits (1414), Expect = 2.962e-180
Identity = 313/799 (39.17%), Postives = 472/799 (59.07%), Query Frame = 3
Query:  417 PNIVLVGAIFDSLDRNSPEYTAFNL----KSAGKTFSNAEDNIIKTKVVYVDDI--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGE-FEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS-----NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            P+ V +G +F  +     EYTAF L     +     S A  N++     +VD+I  ++SF +  A C      V A+FG    R+VHT+ S   A  +  IT S    + +E  ++     +++LRP +  A++  +   +W R ++LYD++     L+ I E        +SA   +   + +D   + +     R  +K  ++DL+ E   N +++Q+  + K    YHY++  +  ++I     ++GG N T F  +D++NP++ + ++ +W  +  ++ Y  S    +    L Y+  +++   E  +   +  V  +R    +GD + +P   P     +++  + ++   GLTGNVQF+  G R NY +D+ E +     + IG W+ +  L     +       +  +NRT+ V++I+  P++M  K+    +  E +EG+C DL +EIAK + F Y I  V D ++GA   ++  WNGM+GEL+  +A++ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P E    +      NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ  I YG +DSGS+KEFF  SKI +++KMW +M+S  P VF K  + G+ +V  S+ +YAF+LES+MN+Y   ++PC+T KVG NLDS KGYG+ATP GS LR  +NLAVL+L E   + ++  +WW ++ +C
Sbjct:   24 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVP----HVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCGALHISLITPS----FPTEGESQF----VLQLRPSIRGALLSLLDHYDWNRFVFLYDTDRGYSILQAIMEKAGQNGWQVSAICVE---NFNDASYRQLLEDLDRRQEKTFVIDLEAERLNN-MLEQIVSVGKHVKGYHYIMANLGFKDINLERFMHGGANVTGFQLVDFSNPMVIKLMQ-RW-NKLDQREYPGSDAPPKYTSALTYDGVMVM--AEAFRNLRRQKVDISR-RGIAGDCLANPAA-PWNQGIDMERTLKQVHLQGLTGNVQFDHYGRRVNYTMDVFELK-SNGPRRIGYWNDADKLVLTQDHALLPNETSGMENRTVIVTTIMEGPYVMLKKNWEMYEGNEQYEGYCVDLASEIAKHIGFKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEEGTDGLPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTDIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDS-KGYGVATPKGSQLRTPVNLAVLKLSESGILDKLKNKWWYDKGEC 796          
BLAST of Glutamate receptor vs. Ensembl Zebrafish
Match: gria4b (glutamate receptor, ionotropic, AMPA 4b [Source:ZFIN;Acc:ZDB-GENE-030131-8013])

HSP 1 Score: 547.354 bits (1409), Expect = 1.999e-179
Identity = 314/802 (39.15%), Postives = 474/802 (59.10%), Query Frame = 3
Query:  417 PNIVLVGAIFDSLDRNSPEYTAFNL----KSAGKTFSNAEDNIIKTKVVYVDDI--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGL------TSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGE-FEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS-----NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQ 2759
            P+ V +G +F  +     EYTAF L     +     S A  N++     +VD+I  ++SF +  A C      V A+FG    R+VHT+ S   A  +  IT S    + +E  ++     +++LRP +  A++  +   +W R ++LYD++     L+ I E        +SA   +   + +D   + +     R  +K  ++DL+ E   N +++Q+  + K    YHY++  +  ++I     ++GG N T F  +D++NP++ + ++ +W  +  ++ Y  S    +    L Y+  +++   E  +   +  V  +R    +GD + +P   P     +++  + ++   GLTGNVQF+  G R NY +D+ E +     + IG W+ +  L        +P   S +      +NRT+ V++I+  P++M  K+    +  E +EG+C DL +EIAK + F Y I  V D ++GA   ++  WNGM+GEL+  +A++ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P E    +      NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ  I YG +DSGS+KEFF  SKI +++KMW +M+S  P VF K  + G+ +V  S+ +YAF+LES+MN+Y   ++PC+T KVG NLDS KGYG+ATP GS LR ++NLAVL+L E+  + ++  +WW ++
Sbjct:   24 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVP----HVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCGALHISLITPS----FPTEGESQF----VLQLRPSIRGALLSLLDHYDWNRFVFLYDTDRGYSILQAIMEKAGQNGWQVSAICVE---NFNDASYRQLLEDLDRRQEKTFVIDLEAERLNN-MLEQIVSVGKHVKGYHYIMANLGFKDINLERFMHGGANVTGFQLVDFSNPMVIKLMQ-RW-NKLDQREYPGSDAPPKYTSALTYDGVMVM--AEAFRNLRRQKVDISR-RGIAGDCLANPAA-PWNQGIDMERTLKQVHLQGLTGNVQFDHYGRRVNYTMDVFELK-SNGPRRIGYWNDADKLVLTQDHALLPNETSGM------ENRTVIVTTIMEGPYVMLKKNWEMYEGNEQYEGYCVDLASEIAKHIGFKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEEGTDGLPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTDIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDS-KGYGVATPKGSQLRSAVNLAVLKLNEQGLLDKLKNKWWYDK 793          
BLAST of Glutamate receptor vs. Ensembl Zebrafish
Match: gria4b (glutamate receptor, ionotropic, AMPA 4b [Source:ZFIN;Acc:ZDB-GENE-030131-8013])

HSP 1 Score: 547.354 bits (1409), Expect = 1.999e-179
Identity = 314/802 (39.15%), Postives = 474/802 (59.10%), Query Frame = 3
Query:  417 PNIVLVGAIFDSLDRNSPEYTAFNL----KSAGKTFSNAEDNIIKTKVVYVDDI--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGL------TSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGE-FEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS-----NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQ 2759
            P+ V +G +F  +     EYTAF L     +     S A  N++     +VD+I  ++SF +  A C      V A+FG    R+VHT+ S   A  +  IT S    + +E  ++     +++LRP +  A++  +   +W R ++LYD++     L+ I E        +SA   +   + +D   + +     R  +K  ++DL+ E   N +++Q+  + K    YHY++  +  ++I     ++GG N T F  +D++NP++ + ++ +W  +  ++ Y  S    +    L Y+  +++   E  +   +  V  +R    +GD + +P   P     +++  + ++   GLTGNVQF+  G R NY +D+ E +     + IG W+ +  L        +P   S +      +NRT+ V++I+  P++M  K+    +  E +EG+C DL +EIAK + F Y I  V D ++GA   ++  WNGM+GEL+  +A++ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P E    +      NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ  I YG +DSGS+KEFF  SKI +++KMW +M+S  P VF K  + G+ +V  S+ +YAF+LES+MN+Y   ++PC+T KVG NLDS KGYG+ATP GS LR ++NLAVL+L E+  + ++  +WW ++
Sbjct:   24 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVP----HVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCGALHISLITPS----FPTEGESQF----VLQLRPSIRGALLSLLDHYDWNRFVFLYDTDRGYSILQAIMEKAGQNGWQVSAICVE---NFNDASYRQLLEDLDRRQEKTFVIDLEAERLNN-MLEQIVSVGKHVKGYHYIMANLGFKDINLERFMHGGANVTGFQLVDFSNPMVIKLMQ-RW-NKLDQREYPGSDAPPKYTSALTYDGVMVM--AEAFRNLRRQKVDISR-RGIAGDCLANPAA-PWNQGIDMERTLKQVHLQGLTGNVQFDHYGRRVNYTMDVFELK-SNGPRRIGYWNDADKLVLTQDHALLPNETSGM------ENRTVIVTTIMEGPYVMLKKNWEMYEGNEQYEGYCVDLASEIAKHIGFKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEEGTDGLPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTDIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDS-KGYGVATPKGSQLRSAVNLAVLKLNEQGLLDKLKNKWWYDK 793          
BLAST of Glutamate receptor vs. Ensembl Zebrafish
Match: gria2a (glutamate receptor, ionotropic, AMPA 2a [Source:ZFIN;Acc:ZDB-GENE-020125-3])

HSP 1 Score: 543.888 bits (1400), Expect = 3.767e-178
Identity = 315/822 (38.32%), Postives = 488/822 (59.37%), Query Frame = 3
Query:  348 LILSAILIPCQPEQLLRKRRQPIPNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVD--DISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSA-DARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKS---TRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDL--TLVNFSKNRTLRVSSILVPPFLMRVKDKN-GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVD---SKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            +ILS +L+P     L        P++ + G      D+   EY+AF +      F  AE  +      ++D  ++++SF +    C      V A+FG    ++V+TI S  +   + +IT S    + ++  N+     ++++RP +   ++  +    W++  YLYDS+  L  L+ + +    R+  ++A +         D   + + +  +  +++ +ILD + ++ K+ I++Q+  + +    YHY++      +   S I  GG N + F  +D+++P++ +F   +W  E+  +   P + +  R     Y +AL  D ++++  A +   K         N+GD + +P   P     E++ A+ +++  GLTGN+QF++ G R NY ++++E +    +K IG W+    +  +   KSDL        +N+T+ V++IL  P++M  K+     D   +EG+C DL  EIAK   F Y +  V D ++GA   ++  WNGM+GEL+  +AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  +   +     S+ +NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +D+GS+KEFF  SKI +F KMW +M+S  P VFVKN   G+ +V  S+ +YA++LES+MN+Y   ++PC+T KVG NLDS KGYGIATP GS LR+++NLAVL+L E+  + ++  +WW ++ +C
Sbjct:    5 MILSGLLLPA----LWGLALGGSPSVQIGGLFPRGADQ---EYSAFRIGMV--QFGTAEFRLTP----HIDNLEVANSFAITNCFCSQFSRGVYAIFGFYDKKSVNTITSFCETLHVSFITPS----FPADGLNQF----VLQMRPDIKGPLISLVEYYKWEKFAYLYDSDRGLSTLQAVLDTAAERKWQVTAINVGNLKDEWKDEAYRSLFQDLENKNERRVILDCEQDKVKD-IMEQVITIGRHVKGYHYIIANFGFVDGDLSKIQYGGANVSGFQIVDFDDPLVAKF-DQRW--EALEEKEYPGADSRIR-----YTSALTYDAVQVMTEAFRFLHKQRIDISRRGNNGDCLANPAV-PWAQGVEIERALKQVRVDGLTGNIQFDQYGRRVNYTVNVMELKNSGPVK-IGYWNE---MDKMAVTKSDLFPNDTMGMENKTVIVTTILEAPYVMLKKNAELFTDNERYEGYCVDLAAEIAKHCGFKYQLRIVADGKYGARDAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGQLGPSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDAGSTKEFFRRSKIALFDKMWQYMKSAEPSVFVKNTVEGVLRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRNAVNLAVLKLNEQGLLDKLKNKWWYDKGEC 790          
BLAST of Glutamate receptor vs. Ensembl Xenopus
Match: traf3ip2 (TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB-GENE-6035451])

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 317/801 (39.58%), Postives = 477/801 (59.55%), Query Frame = 3
Query:  417 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEW-------GVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            PN + +G +F   ++ S E+ AF    A    S     + +  +V   +ISDSF+M    C      V A+FG    +TV+ + S   A  + +IT S        +T+ +F   +++LRP + +A++  I    W++ +Y+YD++  L  L+ + +    +   ++A       + ++   + + +   ++  + I++D + E     + Q + +L+K+ + YHY++  +   +I        G N T F  ++Y + +++  I  QW      K+Y          +K  Y +AL  DG+ ++  A + +++  R       N+GD + +P   P     +++ A+ +++  GL+GNVQFNE G R NY + ++E +  E ++ I +W+    L  +  +          +NRT  V++IL  P++M  K+ +   G D   FEG+C +L  EIAK + F Y +  VKD ++GA  +D  +WNGM+GEL+   ADL VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW       G + P    +  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S +DLAKQ +I YG +DSGS+KEFF  SKI +F+KMW +M S  P VFVK    G+N+V  S+ +YA++LES+MN+Y   ++PC+T KVG NLDS KGYGIATP GS LR+ +NLAVL+L E+  + ++  +WW ++ +C
Sbjct:   22 PNHIQIGGLFP--NQQSQEHAAFRF--ALSQLSEPPKLLPQIDIV---NISDSFEMTYTFCSQFSKGVYAIFGFYDRKTVNMLTSFCGALHVCFITPS-----FPVATSNQF---VLQLRPELQDALISVIEYYKWKKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVN---ILTTTEEGYRLLFQDLDKSKDRQIVIDCESERLNAILTQVVVKLEKNIIGYHYILANLGFMDIDMQKFKEAGANVTGFQLVNYTDTMVSR-IMQQW------KNYDGREQPRVDWKKPKYTSALTYDGVRVMAEAFQ-SLRKQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRLEGLSGNVQFNEKGRRTNYTLHVLELK-HEGIRHIAHWNEDDKLIPLATDAQAGNDTIGVQNRTYIVTTILEAPYVMLKKNADQLEGND--RFEGYCVELAAEIAKHVGFKYKLEIVKDGKYGARDSDMKAWNGMVGELVYGRADLAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHNEEFEEGKEQPT---TDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIAYGTLDSGSTKEFFKRSKIAVFEKMWTYMRSAEPSVFVKTTEEGMNRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSPLRNPVNLAVLKLNEQGLLDKLKNKWWYDKGEC 788          
BLAST of Glutamate receptor vs. Ensembl Xenopus
Match: traf3ip2 (TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB-GENE-6035451])

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 308/753 (40.90%), Postives = 459/753 (60.96%), Query Frame = 3
Query:  561 DISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEW-------GVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            +ISDSF+M    C      V A+FG    +TV+ + S   A  + +IT S        +T+ +F   +++LRP + +A++  I    W++ +Y+YD++  L  L+ + +    +   ++A       + ++   + + +   ++  + I++D + E   N I+ Q+ +L+K+ + YHY++  +   +I        G N T F  ++Y + +++  I  QW     R+     S  S     + Y +AL  DG+ ++  A + +++  R       N+GD + +P   P     +++ A+ +++  GL+GNVQFNE G R NY + ++E +  E ++ I +W+    L  +  +          +NRT  V++IL  P++M  K+ +   G D   FEG+C +L  EIAK + F Y +  VKD ++GA  +D  +WNGM+GEL+   ADL VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW       G + P    +  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S +DLAKQ +I YG +DSGS+KEFF  SKI +F+KMW +M S  P VFVK    G+N+V  S+ +YA++LES+MN+Y   ++PC+T KVG NLDS KGYGIATP GS LR ++NLAVL+L E+  + ++  +WW ++ +C
Sbjct:   61 NISDSFEMTYTFCSQFSKGVYAIFGFYDRKTVNMLTSFCGALHVCFITPS-----FPVATSNQF---VLQLRPELQDALISVIEYYKWKKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVN---ILTTTEEGYRLLFQDLDKSKDRQIVIDCESER-LNAILTQVVKLEKNIIGYHYILANLGFMDIDMQKFKEAGANVTGFQLVNYTDTMVSR-IMQQWKNYDGREQPHLGSNTS----TIKYTSALTYDGVRVMAEAFQ-SLRKQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRLEGLSGNVQFNEKGRRTNYTLHVLELK-HEGIRHIAHWNEDDKLIPLATDAQAGNDTIGVQNRTYIVTTILEAPYVMLKKNADQLEGND--RFEGYCVELAAEIAKHVGFKYKLEIVKDGKYGARDSDMKAWNGMVGELVYGRADLAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHNEEFEEGKEQPT---TDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIAYGTLDSGSTKEFFKRSKIAVFEKMWTYMRSAEPSVFVKTTEEGMNRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSPLRGAVNLAVLKLSEQGVLDKLKSKWWYDKGEC 787          
BLAST of Glutamate receptor vs. Ensembl Xenopus
Match: traf3ip2 (TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB-GENE-6035451])

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 309/763 (40.50%), Postives = 462/763 (60.55%), Query Frame = 3
Query:  561 DISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEW-------GVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKCKKQVESNENS 2798
            +ISDSF+M    C      V A+FG    +TV+ + S   A  + +IT S        +T+ +F   +++LRP + +A++  I    W++ +Y+YD++  L  L+ + +    +   ++A       + ++   + + +   ++  + I++D + E   N I+ Q+  L+K+ + YHY++  +   +I        G N T F  ++Y + +++  I  QW      K+Y          +K  Y +AL  DG+ ++  A + +++  R       N+GD + +P   P     +++ A+ +++  GL+GNVQFNE G R NY + ++E +  E ++ I +W+    L  +  +          +NRT  V++IL  P++M  K+ +   G D   FEG+C +L  EIAK + F Y +  VKD ++GA  +D  +WNGM+GEL+   ADL VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW       G + P    +  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S +DLAKQ +I YG +DSGS+KEFF  SKI +F+KMW +M S  P VFVK    G+N+V  S+ +YA++LES+MN+Y   ++PC+T KVG NLDS KGYGIATP GS LR ++NLAVL+L E+  + ++  +WW ++ +C  +   ++ S
Sbjct:   60 NISDSFEMTYTFCSQFSKGVYAIFGFYDRKTVNMLTSFCGALHVCFITPS-----FPVATSNQF---VLQLRPELQDALISVIEYYKWKKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVN---ILTTTEEGYRLLFQDLDKSKDRQIVIDCESERL-NAILTQV--LEKNIIGYHYILANLGFMDIDMQKFKEAGANVTGFQLVNYTDTMVSR-IMQQW------KNYDGREQPRVDWKKPKYTSALTYDGVRVMAEAFQ-SLRKQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRLEGLSGNVQFNEKGRRTNYTLHVLELK-HEGIRHIAHWNEDDKLIPLATDAQAGNDTIGVQNRTYIVTTILEAPYVMLKKNADQLEGND--RFEGYCVELAAEIAKHVGFKYKLEIVKDGKYGARDSDMKAWNGMVGELVYGRADLAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHNEEFEEGKEQPT---TDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIAYGTLDSGSTKEFFKRSKIAVFEKMWTYMRSAEPSVFVKTTEEGMNRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSPLRGAVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKTS 792          
BLAST of Glutamate receptor vs. Ensembl Xenopus
Match: traf3ip2 (TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB-GENE-6035451])

HSP 1 Score: 551.592 bits (1420), Expect = 0.000e+0
Identity = 303/742 (40.84%), Postives = 452/742 (60.92%), Query Frame = 3
Query:  594 ICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEW-------GVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            IC      V A+FG    +TV+ + S   A  + +IT S        +T+ +F   +++LRP + +A++  I    W++ +Y+YD++  L  L+ + +    +   ++A       + ++   + + +   ++  + I++D + E   N I+ Q+ +L+K+ + YHY++  +   +I        G N T F  ++Y + +++  I  QW     R+     S  S     + Y +AL  DG+ ++  A + +++  R       N+GD + +P   P     +++ A+ +++  GL+GNVQFNE G R NY + ++E +  E ++ I +W+    L  +  +          +NRT  V++IL  P++M  K+ +   G D   FEG+C +L  EIAK + F Y +  VKD ++GA  +D  +WNGM+GEL+   ADL VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW       G + P    +  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S +DLAKQ +I YG +DSGS+KEFF  SKI +F+KMW +M S  P VFVK    G+N+V  S+ +YA++LES+MN+Y   ++PC+T KVG NLDS KGYGIATP GS LR+ +NLAVL+L E+  + ++  +WW ++ +C
Sbjct:   49 ICSQFSKGVYAIFGFYDRKTVNMLTSFCGALHVCFITPS-----FPVATSNQF---VLQLRPELQDALISVIEYYKWKKFVYIYDADRGLSVLQKVLDTAAEKNWQVTA---VNILTTTEEGYRLLFQDLDKSKDRQIVIDCESER-LNAILTQVVKLEKNIIGYHYILANLGFMDIDMQKFKEAGANVTGFQLVNYTDTMVSR-IMQQWKNYDGREQPHLGSNTS----TIKYTSALTYDGVRVMAEAFQ-SLRKQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRLEGLSGNVQFNEKGRRTNYTLHVLELK-HEGIRHIAHWNEDDKLIPLATDAQAGNDTIGVQNRTYIVTTILEAPYVMLKKNADQLEGND--RFEGYCVELAAEIAKHVGFKYKLEIVKDGKYGARDSDMKAWNGMVGELVYGRADLAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHNEEFEEGKEQPT---TDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIAYGTLDSGSTKEFFKRSKIAVFEKMWTYMRSAEPSVFVKTTEEGMNRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSPLRNPVNLAVLKLNEQGLLDKLKNKWWYDKGEC 764          
BLAST of Glutamate receptor vs. Ensembl Xenopus
Match: traf3ip2 (TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB-GENE-6035451])

HSP 1 Score: 545.814 bits (1405), Expect = 1.731e-179
Identity = 301/734 (41.01%), Postives = 450/734 (61.31%), Query Frame = 3
Query:  618 VIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEW-------GVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            V A+FG    +TV+ + S   A  + +IT S        +T+ +F   +++LRP + +A++  I    W++ +Y+YD++  L  L+ + +    +   ++A       + ++   + + +   ++  + I++D + E   N I+ Q+ +L+K+ + YHY++  +   +I        G N T F  ++Y + +++  I  QW      K+Y          +K  Y +AL  DG+ ++  A + +++  R       N+GD + +P   P     +++ A+ +++  GL+GNVQFNE G R NY + ++E +  E ++ I +W+    L  +  +          +NRT  V++IL  P++M  K+ +   G D   FEG+C +L  EIAK + F Y +  VKD ++GA  +D  +WNGM+GEL+   ADL VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW       G + P    +  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S +DLAKQ +I YG +DSGS+KEFF  SKI +F+KMW +M S  P VFVK    G+N+V  S+ +YA++LES+MN+Y   ++PC+T KVG NLDS KGYGIATP GS LR+ +NLAVL+L E+  + ++  +WW ++ +C
Sbjct:   30 VYAIFGFYDRKTVNMLTSFCGALHVCFITPS-----FPVATSNQF---VLQLRPELQDALISVIEYYKWKKFVYIYDADRGLSVLQKVLDTAAEKNWQVTA---VNILTTTEEGYRLLFQDLDKSKDRQIVIDCESERL-NAILTQVVKLEKNIIGYHYILANLGFMDIDMQKFKEAGANVTGFQLVNYTDTMVSR-IMQQW------KNYDGREQPRVDWKKPKYTSALTYDGVRVMAEAFQ-SLRKQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRLEGLSGNVQFNEKGRRTNYTLHVLELK-HEGIRHIAHWNEDDKLIPLATDAQAGNDTIGVQNRTYIVTTILEAPYVMLKKNADQLEGND--RFEGYCVELAAEIAKHVGFKYKLEIVKDGKYGARDSDMKAWNGMVGELVYGRADLAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHNEEFEEGKEQPT---TDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIAYGTLDSGSTKEFFKRSKIAVFEKMWTYMRSAEPSVFVKTTEEGMNRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSPLRNPVNLAVLKLNEQGLLDKLKNKWWYDKGEC 735          
BLAST of Glutamate receptor vs. Ensembl Mouse
Match: Gria1 (glutamate receptor, ionotropic, AMPA1 (alpha 1) [Source:MGI Symbol;Acc:MGI:95808])

HSP 1 Score: 553.903 bits (1426), Expect = 0.000e+0
Identity = 313/798 (39.22%), Postives = 477/798 (59.77%), Query Frame = 3
Query:  417 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE----VDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            PN + +G +F   ++ S E+ AF    A    +     + +  +V   +ISDSF+M    C      V A+FG    RTV+ + S   A  + +IT S    +  +++N+     +++LRP +  A++  I    WQ  +Y+YD++  L  L+ + +    +   ++A       + ++   + + +  ++  ++ +++D + E   N I+ Q+ +L+K+ + YHY++  +   +I  +     G N T F  ++Y + +    I  QW T  +R   +         ++  Y +AL  DG++++  A + +++  R       N+GD + +P   P     +++ A+ +++F GLTGNVQFNE G R NY + +IE +  + ++ IG W+          +       +  +NRT  V++IL  P++M  K+ N   G D   +EG+C +L  EIAK + ++Y +  V D ++GA   D  +WNGM+GEL+   AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  +   E      S  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +++GS+KEFF  SKI +F+KMW +M+S  P VFV+    G+ +V  S+ +YA++LES+MN+Y   ++PC+T KVG NLDS KGYGIATP GS LR  +NLAVL+L E+  + ++  +WW ++ +C
Sbjct:   22 PNNIQIGGLFP--NQQSQEHAAFRF--ALSQLTEPPKLLPQIDIV---NISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPS----FPVDTSNQF----VLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVN---ILTTTEEGYRMLFQDLEKKKERLVVVDCESER-LNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAR-IMQQWRTSDARDHTRVD------WKRPKYTSALTYDGVKVMAEAFQ-SLRRQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMK-HDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGND--RYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGEC 787          
BLAST of Glutamate receptor vs. Ensembl Mouse
Match: Gria1 (glutamate receptor, ionotropic, AMPA1 (alpha 1) [Source:MGI Symbol;Acc:MGI:95808])

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 313/798 (39.22%), Postives = 478/798 (59.90%), Query Frame = 3
Query:  417 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE----VDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            PN + +G +F   ++ S E+ AF    A    +     + +  +V   +ISDSF+M    C      V A+FG    RTV+ + S   A  + +IT S    +  +++N+     +++LRP +  A++  I    WQ  +Y+YD++  L  L+ + +    +   ++A       + ++   + + +  ++  ++ +++D + E   N I+ Q+ +L+K+ + YHY++  +   +I  +     G N T F  ++Y + +    I  QW T  +R   +         ++  Y +AL  DG++++  A + +++  R       N+GD + +P   P     +++ A+ +++F GLTGNVQFNE G R NY + +IE +  + ++ IG W+          +       +  +NRT  V++IL  P++M  K+ N   G D   +EG+C +L  EIAK + ++Y +  V D ++GA   D  +WNGM+GEL+   AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  +   E      S  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +++GS+KEFF  SKI +F+KMW +M+S  P VFV+    G+ +V  S+ +YA++LES+MN+Y   ++PC+T KVG NLDS KGYGIATP GS LR+ +NLAVL+L E+  + ++  +WW ++ +C
Sbjct:   22 PNNIQIGGLFP--NQQSQEHAAFRF--ALSQLTEPPKLLPQIDIV---NISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPS----FPVDTSNQF----VLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVN---ILTTTEEGYRMLFQDLEKKKERLVVVDCESER-LNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAR-IMQQWRTSDARDHTRVD------WKRPKYTSALTYDGVKVMAEAFQ-SLRRQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMK-HDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGND--RYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGEC 787          
BLAST of Glutamate receptor vs. Ensembl Mouse
Match: Gria4 (glutamate receptor, ionotropic, AMPA4 (alpha 4) [Source:MGI Symbol;Acc:MGI:95811])

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 317/807 (39.28%), Postives = 480/807 (59.48%), Query Frame = 3
Query:  417 PNIVLVGAIFDSLDRNSPEYTAFNLK----SAGKTFSNAEDNIIKTKVVYVDDI--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSA----DARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSI---PRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS----NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            P+ V +G +F  +     EYTAF L     +     S A  N++     +VD+I  ++SF +  A C      V A+FG    R+VHT+ S   A  +  IT S    + +E  ++     +++LRP +  A++  +    W   ++LYD++     L+ I E        +SA    +    S+ Q   +L+ ++R+     +K  ++D + E  +N I++Q+  + K    YHY++  +  ++I     I+GG N T F  +D+N P++ + +  +W  +  ++ Y  S T  +    L Y+  L++   E  +   +  +  +R   N+GD + +P   P     +++  + +++  GLTGNVQF+  G R NY +D+ E +     + +G W+    L  I   P   +D   +   +NRT+ V++I+  P++M  K+     G D  ++EG+C DL +EIAK +   Y I  V D ++GA   D+  WNGM+GEL+  +A++ +APLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P +     S    NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +DSGS+KEFF  SKI +++KMW +M S  P VF +  + G+ +V  S+ ++AF+LES+MN+Y   ++PC+T KVG NLDS KGYG+ATP GS LR+++NLAVL+L E+  + ++  +WW ++ +C
Sbjct:   24 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVP----HVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPS----FPTEGESQF----VLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQ---LLEELDRRQ----EKKFVIDCEIERLQN-ILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLM-DRW-KKLDQREYPGSETPPKYTSALTYDGVLVM--AETFRSLRRQKIDISR-RGNAGDCLANPAA-PWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELK-STGPRKVGYWNDMDKLVLIQDAPTLGNDTAAI---ENRTVVVTTIMESPYVMYKKNHEMFEGND--KYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGVATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGEC 795          
BLAST of Glutamate receptor vs. Ensembl Mouse
Match: Gria4 (glutamate receptor, ionotropic, AMPA4 (alpha 4) [Source:MGI Symbol;Acc:MGI:95811])

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 317/807 (39.28%), Postives = 480/807 (59.48%), Query Frame = 3
Query:  417 PNIVLVGAIFDSLDRNSPEYTAFNLK----SAGKTFSNAEDNIIKTKVVYVDDI--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSA----DARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSI---PRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS----NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            P+ V +G +F  +     EYTAF L     +     S A  N++     +VD+I  ++SF +  A C      V A+FG    R+VHT+ S   A  +  IT S    + +E  ++     +++LRP +  A++  +    W   ++LYD++     L+ I E        +SA    +    S+ Q   +L+ ++R+     +K  ++D + E  +N I++Q+  + K    YHY++  +  ++I     I+GG N T F  +D+N P++ + +  +W  +  ++ Y  S T  +    L Y+  L++   E  +   +  +  +R   N+GD + +P   P     +++  + +++  GLTGNVQF+  G R NY +D+ E +     + +G W+    L  I   P   +D   +   +NRT+ V++I+  P++M  K+     G D  ++EG+C DL +EIAK +   Y I  V D ++GA   D+  WNGM+GEL+  +A++ +APLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P +     S    NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +DSGS+KEFF  SKI +++KMW +M S  P VF +  + G+ +V  S+ ++AF+LES+MN+Y   ++PC+T KVG NLDS KGYG+ATP GS LR+++NLAVL+L E+  + ++  +WW ++ +C
Sbjct:   24 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVP----HVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPS----FPTEGESQF----VLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQ---LLEELDRRQ----EKKFVIDCEIERLQN-ILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLM-DRW-KKLDQREYPGSETPPKYTSALTYDGVLVM--AETFRSLRRQKIDISR-RGNAGDCLANPAA-PWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELK-STGPRKVGYWNDMDKLVLIQDAPTLGNDTAAI---ENRTVVVTTIMESPYVMYKKNHEMFEGND--KYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGVATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGEC 795          
BLAST of Glutamate receptor vs. Ensembl Mouse
Match: Gria4 (glutamate receptor, ionotropic, AMPA4 (alpha 4) [Source:MGI Symbol;Acc:MGI:95811])

HSP 1 Score: 550.436 bits (1417), Expect = 1.284e-180
Identity = 317/807 (39.28%), Postives = 477/807 (59.11%), Query Frame = 3
Query:  417 PNIVLVGAIFDSLDRNSPEYTAFNL----KSAGKTFSNAEDNIIKTKVVYVDDI--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSA----DARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSI---PRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS----NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            P+ V +G +F  +     EYTAF L     +     S A  N++     +VD+I  ++SF +  A C      V A+FG    R+VHT+ S   A  +  IT S    + +E  ++     +++LRP +  A++  +    W   ++LYD++     L+ I E        +SA    +    S+ Q   +L+ ++R+     +K  ++D + E  +N I++Q+  + K    YHY++  +  ++I     I+GG N T F  +D+N P++ + +  +W  +  ++ Y  S T  +    L Y+  L++   E  +   +  +  +R   N+GD + +P   P     +++  + +++  GLTGNVQF+  G R NY +D+ E +     + +G W+    L  I   P   +D   +   +NRT+ V++I+  P++M  K+     G D  ++EG+C DL +EIAK +   Y I  V D ++GA   D+  WNGM+GEL+  +A++ +APLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P +     S    NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +DSGS+KEFF  SKI +++KMW +M S  P VF +  + G+ +V  S+ ++AF+LES+MN+Y   ++PC+T KVG NLDS KGYG+ATP GS LR  +NLAVL+L E   + ++  +WW ++ +C
Sbjct:   24 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVP----HVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPS----FPTEGESQF----VLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQ---LLEELDRRQ----EKKFVIDCEIERLQN-ILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLM-DRW-KKLDQREYPGSETPPKYTSALTYDGVLVM--AETFRSLRRQKIDISR-RGNAGDCLANPAA-PWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELK-STGPRKVGYWNDMDKLVLIQDAPTLGNDTAAI---ENRTVVVTTIMESPYVMYKKNHEMFEGND--KYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGEC 795          
BLAST of Glutamate receptor vs. UniProt/SwissProt
Match: sp|P19490|GRIA1_RAT (Glutamate receptor 1 OS=Rattus norvegicus OX=10116 GN=Gria1 PE=1 SV=2)

HSP 1 Score: 554.673 bits (1428), Expect = 0.000e+0
Identity = 314/798 (39.35%), Postives = 478/798 (59.90%), Query Frame = 3
Query:  417 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE----VDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            PN + +G +F   ++ S E+ AF    A    +     + +  +V   +ISDSF+M    C      V A+FG    RTV+ + S   A  + +IT S    +  +++N+     +++LRP +  A++  I    WQ  +Y+YD++  L  L+ + +    +   ++A       + ++   + + +  ++  ++ +++D + E   N I+ Q+ +L+K+ + YHY++  +   +I  +     G N T F  ++Y + +    I  QW T  SR   +         ++  Y +AL  DG++++  A + +++  R       N+GD + +P   P     +++ A+ +++F GLTGNVQFNE G R NY + +IE +  + ++ IG W+          +       +  +NRT  V++IL  P++M  K+ N   G D   +EG+C +L  EIAK + ++Y +  V D ++GA   D  +WNGM+GEL+   AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  +   E      S  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +++GS+KEFF  SKI +F+KMW +M+S  P VFV+    G+ +V  S+ +YA++LES+MN+Y   ++PC+T KVG NLDS KGYGIATP GS LR+ +NLAVL+L E+  + ++  +WW ++ +C
Sbjct:   22 PNNIQIGGLFP--NQQSQEHAAFRF--ALSQLTEPPKLLPQIDIV---NISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPS----FPVDTSNQF----VLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVN---ILTTTEEGYRMLFQDLEKKKERLVVVDCESER-LNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAR-IMQQWRTSDSRDHTRVD------WKRPKYTSALTYDGVKVMAEAFQ-SLRRQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMK-HDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGND--RYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGEC 787          
BLAST of Glutamate receptor vs. UniProt/SwissProt
Match: sp|P23818|GRIA1_MOUSE (Glutamate receptor 1 OS=Mus musculus OX=10090 GN=Gria1 PE=1 SV=1)

HSP 1 Score: 553.903 bits (1426), Expect = 0.000e+0
Identity = 313/798 (39.22%), Postives = 477/798 (59.77%), Query Frame = 3
Query:  417 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE----VDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            PN + +G +F   ++ S E+ AF    A    +     + +  +V   +ISDSF+M    C      V A+FG    RTV+ + S   A  + +IT S    +  +++N+     +++LRP +  A++  I    WQ  +Y+YD++  L  L+ + +    +   ++A       + ++   + + +  ++  ++ +++D + E   N I+ Q+ +L+K+ + YHY++  +   +I  +     G N T F  ++Y + +    I  QW T  +R   +         ++  Y +AL  DG++++  A + +++  R       N+GD + +P   P     +++ A+ +++F GLTGNVQFNE G R NY + +IE +  + ++ IG W+          +       +  +NRT  V++IL  P++M  K+ N   G D   +EG+C +L  EIAK + ++Y +  V D ++GA   D  +WNGM+GEL+   AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  +   E      S  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +++GS+KEFF  SKI +F+KMW +M+S  P VFV+    G+ +V  S+ +YA++LES+MN+Y   ++PC+T KVG NLDS KGYGIATP GS LR  +NLAVL+L E+  + ++  +WW ++ +C
Sbjct:   22 PNNIQIGGLFP--NQQSQEHAAFRF--ALSQLTEPPKLLPQIDIV---NISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPS----FPVDTSNQF----VLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVN---ILTTTEEGYRMLFQDLEKKKERLVVVDCESER-LNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAR-IMQQWRTSDARDHTRVD------WKRPKYTSALTYDGVKVMAEAFQ-SLRRQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMK-HDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGND--RYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGEC 787          
BLAST of Glutamate receptor vs. UniProt/SwissProt
Match: sp|Q38PU8|GRIA1_MACFA (Glutamate receptor 1 OS=Macaca fascicularis OX=9541 GN=GRIA1 PE=2 SV=1)

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 312/798 (39.10%), Postives = 480/798 (60.15%), Query Frame = 3
Query:  417 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE----VDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            PN + +G +F   ++ S E+ AF    A    +     + +  +V   +ISDSF+M    C      V A+FG    RTV+ + S   A  + +IT S    +  +++N+     +++LRP + +A++  I    WQ+ +Y+YD++  L  L+ + +    +   ++A       + ++   + + +  ++  ++ +++D + E   N I+ Q+ +L+K+ + YHY++  +   +I  +     G N T F  ++Y + +  + I  QW    +R   +         ++  Y +AL  DG++++  A + +++  R       N+GD + +P   P     +++ A+ +++F GLTGNVQFNE G R NY + +IE +  + ++ IG W+          +       +  +NRT  V++IL  P++M  K+ N   G D   +EG+C +L  EIAK + ++Y +  V D ++GA   D  +WNGM+GEL+   AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  +   E      S  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +++GS+KEFF  SKI +F+KMW +M+S  P VFV+    G+ +V  S+ +YA++LES+MN+Y   ++PC+T KVG NLDS KGYGIATP GS LR+ +NLAVL+L E+  + ++  +WW ++ +C
Sbjct:   22 PNNIQIGGLFP--NQQSQEHAAFRF--ALSQLTEPPKLLPQIDIV---NISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPS----FPVDTSNQF----VLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVN---ILTTTEEGYRMLFQDLEKKKERLVVVDCESER-LNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAK-IMQQWKNSDARDHTRVD------WKRPKYTSALTYDGVKVMAEAFQ-SLRRQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMK-HDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGND--RYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGEC 787          
BLAST of Glutamate receptor vs. UniProt/SwissProt
Match: sp|P42261|GRIA1_HUMAN (Glutamate receptor 1 OS=Homo sapiens OX=9606 GN=GRIA1 PE=1 SV=2)

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 312/798 (39.10%), Postives = 480/798 (60.15%), Query Frame = 3
Query:  417 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE----VDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            PN + +G +F   ++ S E+ AF    A    +     + +  +V   +ISDSF+M    C      V A+FG    RTV+ + S   A  + +IT S    +  +++N+     +++LRP + +A++  I    WQ+ +Y+YD++  L  L+ + +    +   ++A       + ++   + + +  ++  ++ +++D + E   N I+ Q+ +L+K+ + YHY++  +   +I  +     G N T F  ++Y + +  + I  QW    +R   +         ++  Y +AL  DG++++  A + +++  R       N+GD + +P   P     +++ A+ +++F GLTGNVQFNE G R NY + +IE +  + ++ IG W+          +       +  +NRT  V++IL  P++M  K+ N   G D   +EG+C +L  EIAK + ++Y +  V D ++GA   D  +WNGM+GEL+   AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  +   E      S  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +++GS+KEFF  SKI +F+KMW +M+S  P VFV+    G+ +V  S+ +YA++LES+MN+Y   ++PC+T KVG NLDS KGYGIATP GS LR+ +NLAVL+L E+  + ++  +WW ++ +C
Sbjct:   22 PNNIQIGGLFP--NQQSQEHAAFRF--ALSQLTEPPKLLPQIDIV---NISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPS----FPVDTSNQF----VLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVN---ILTTTEEGYRMLFQDLEKKKERLVVVDCESER-LNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAK-IMQQWKNSDARDHTRVD------WKRPKYTSALTYDGVKVMAEAFQ-SLRRQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMK-HDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGND--RYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGEC 787          
BLAST of Glutamate receptor vs. UniProt/SwissProt
Match: sp|Q9Z2W8|GRIA4_MOUSE (Glutamate receptor 4 OS=Mus musculus OX=10090 GN=Gria4 PE=1 SV=2)

HSP 1 Score: 550.436 bits (1417), Expect = 8.983e-180
Identity = 317/807 (39.28%), Postives = 477/807 (59.11%), Query Frame = 3
Query:  417 PNIVLVGAIFDSLDRNSPEYTAFNL----KSAGKTFSNAEDNIIKTKVVYVDDI--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSA----DARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSI---PRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS----NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            P+ V +G +F  +     EYTAF L     +     S A  N++     +VD+I  ++SF +  A C      V A+FG    R+VHT+ S   A  +  IT S    + +E  ++     +++LRP +  A++  +    W   ++LYD++     L+ I E        +SA    +    S+ Q   +L+ ++R+     +K  ++D + E  +N I++Q+  + K    YHY++  +  ++I     I+GG N T F  +D+N P++ + +  +W  +  ++ Y  S T  +    L Y+  L++   E  +   +  +  +R   N+GD + +P   P     +++  + +++  GLTGNVQF+  G R NY +D+ E +     + +G W+    L  I   P   +D   +   +NRT+ V++I+  P++M  K+     G D  ++EG+C DL +EIAK +   Y I  V D ++GA   D+  WNGM+GEL+  +A++ +APLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P +     S    NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +DSGS+KEFF  SKI +++KMW +M S  P VF +  + G+ +V  S+ ++AF+LES+MN+Y   ++PC+T KVG NLDS KGYG+ATP GS LR  +NLAVL+L E   + ++  +WW ++ +C
Sbjct:   24 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVP----HVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPS----FPTEGESQF----VLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQ---LLEELDRRQ----EKKFVIDCEIERLQN-ILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLM-DRW-KKLDQREYPGSETPPKYTSALTYDGVLVM--AETFRSLRRQKIDISR-RGNAGDCLANPAA-PWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELK-STGPRKVGYWNDMDKLVLIQDAPTLGNDTAAI---ENRTVVVTTIMESPYVMYKKNHEMFEGND--KYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGEC 795          
BLAST of Glutamate receptor vs. TrEMBL
Match: A0A267GZ97 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005451g1 PE=3 SV=1)

HSP 1 Score: 726.087 bits (1873), Expect = 0.000e+0
Identity = 411/892 (46.08%), Postives = 573/892 (64.24%), Query Frame = 3
Query:  429 LVGAIFDSLDRNSPEYTAFNL---KSAGKTFSNAEDNIIK--TKVV-YVDDISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERF-------------GKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDG-------VLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTN----SQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAIT-RIK-FMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLT---LVNFSKNRTLRVSSILVPPFLMRVKDKNGKDT-----GEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGA-LVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMESNPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKCKKQVESNENSITKNSVRFDDXXXXXXXXXXXXXXXXXXXXXXXVYKCTLESKRKSKSFMVTFKELVDQSKK 2981
            L+G IF    + S  + AF+    +    ++ + +  ++    KVV YV+D+ DSFQM+ AIC+L+    I +FGP+H +T+  + S+TD   + YIT S      S+    R              G+ I++LRP++  AVV+ I  E W+RI +LYDS  AL RLR IFE    +   +SAD R  +    DG       VL+YIN KS   + K + LDL+  E + RI  ++  ++ +R+DYHYL+   D  E+  +  ++GG+N T F+ L++++P    F    W +++  ++Y P++ +    S R+  +P   AL++DG     +A +  +   R ++    + C P   P + A+ +      R+  F G+TG VQF+++G+R NY++  IEA V+  L+ I  WS  +G   + RN S       + FS NRT  V+SIL  PFLM  ++ +   T       F GFC DL+  +AK + F Y I  V D ++G   VND+WNGMIGEL R EAD+ VAPLTITS RE+VVDFSTP+ME GLS+MFLKP + E + FGFMKPLSK+IWMCI FAYLGVSVVLF+VSRF+PYEW ++   +   KV+N+F+IFNS WF+LSAFMQQGGDISPRSL+GRIVG VWWFFTLIIVSSYTANLAA+LTVERM+ PI+SYEDLAKQ KIKYGVV++GSSKEFF NS ++ F++MW FME+NP VFV  +  G+++V+NS  +YAF+LES+MN+YY+ QE C T KVGSNLDSG+GYGIATP GSDLR+ INL VL+ KEK +I ++   WW+  SKC+ Q + ++ S +  S+    + GLF +L+ G   G+ LSI+E VY+C L +KRK + F     E++  S +
Sbjct:   39 LIGGIFQMDSQESASHAAFDFAFDQLMLNSWFDPQGTLLYRYEKVVEYVEDLEDSFQMSSAICRLISRGAIVIFGPVHYKTIPMVLSITDYFEVAYITTSFVDKLPSDRILHRRALFNGIADRRQPQGRFIVRLRPVITPAVVELIDHEKWERIFFLYDSKSALLRLREIFERYKGKESTISADIRDLT----DGGPGAAATVLRYINEKSM-ETLKRVFLDLEDREVQQRIFDEIKAIRGNRLDYHYLIMGSDINEVNQTMFLHGGVNITGFTVLNFSDPTFARFRDEFWFSDARLRAY-PTALDKLDPSSRI--VPLSVALMIDGFSAFFKAHQ-KLTPQRRNSRDHKEACMPPETPAFPAENITAVFKGRVSGFPGVTGWVQFDQAGYRENYRVQGIEAGVRSELQPISIWS--NGQFRLTRNYSKSRKGFHLPFS-NRTRIVTSILGEPFLMVRQNSSLDGTPLVGNDRFVGFCADLIKLLAKDIGFDYVIKPVADGKYGDDSVNDTWNGMIGELYRLEADIAVAPLTITSKREKVVDFSTPYMEVGLSIMFLKPTNPESDQFGFMKPLSKEIWMCIAFAYLGVSVVLFVVSRFSPYEWHLNQESDKADKVTNDFSIFNSLWFTLSAFMQQGGDISPRSLSGRIVGSVWWFFTLIIVSSYTANLAAFLTVERMSTPIQSYEDLAKQTKIKYGVVNAGSSKEFFRNSSVQEFRRMWQFMEANPNVFVNTVKEGVDRVLNSNNDYAFLLESTMNEYYS-QENCRTIKVGSNLDSGRGYGIATPSGSDLREIINLKVLQFKEKGEITRLKSTWWD-ASKCQDQNQDSKKS-SAQSLELRSVIGLFYILIVGTVFGVILSIMEFVYRCALLAKRKKRKFKEVMNEMLILSTR 915          
BLAST of Glutamate receptor vs. TrEMBL
Match: A0A158R8F8 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5365 PE=3 SV=1)

HSP 1 Score: 722.62 bits (1864), Expect = 0.000e+0
Identity = 400/910 (43.96%), Postives = 561/910 (61.65%), Query Frame = 3
Query:  408 QPIPNIVLVG--AIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNI-IKTKVVYVDDISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSF---------------SQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQ-----KLPYEAALIVDGLELLKRALKVA--------VKSTRFHTN-----SGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLT---SIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDT-GEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGV---------DTPVEVD--------SKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMESNPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKCKKQVESNENSITKNSVRFDDXXXXXXXXXXXXXXXXXXXXXXXVYKCTLESKRKSKSFMVTFKELV 2966
             P  +I+  G  AIF    RN+ EY AF  KS   + S    N  IK K+V+V DI DSFQMA AIC+L+   V+A+F P++P T+  ++S+T  +R+++ T +D HH+ + +++     NIIKL+PL A A++DF+    W+ +LYLY+S EA +RLR + E    R    + D RQ  +               ++S G+ Q++N ++    +K I++DL   ES  + I  +  +   R D H+L+   D + I  S +  GG+N T  + +D+++  L              KSY+       RL       L  EAAL++DG++ L +AL++         +  +  H+N     +G+  C P + P + A ++   + +   +   G ++F                        +G W++  G+    S  +N S+ + V+ +K R   VSSIL+ PF+M  KD NG    GE+EGFC DLV ++A+M+ F Y +  V D QFG+LVN SW+GM+GEL+R EAD+VVAPLTITS RERVVDF+TPFMEFGLSVM+ K D   P+   FM+PLS +IWMCI+FAYLGVSVVLFLVSR +P EWG          D  +E D        S   + F+IFNSFWF+LS F+QQGGDI PRSL+GRIVGG WWFFTLIIVSSYTANLAAYLTVERM NPI+SYEDLA+Q+K+KYG++ SGS+++FF  S I+IF++MW FMESNPE     +  G+ +VINS ++YAFILES+MN+Y+N + PC T KVG NLDSGKGYG+ATPPGSDLRD +NLAVLELKE + I Q+ + WWE + +C K  +S + +   +S+  D + GLF LL G L +GI L+ILE +Y+C + +KR   S   T ++++
Sbjct:   59 HPTLSIIRAGRSAIFQMDARNTTEYNAF--KSYPSSASLLWQNFQIKEKIVHVKDIHDSFQMASAICELVAEGVVAIFAPVYPETLTIVKSMTTQHRVLFFTTADPHHFGTGTSDLSGAANIIKLKPLKAPAILDFMMHAEWEDVLYLYESEEAAYRLRWVLEKAIKRSPTFTVDFRQLRWDPEPPVNGEEAGGGGAESTGLRQHVNSRTNTFYRKSILVDLSKRESTAKFIAAIGSIMPQRADLHFLIVGGDIKCINDSSLQFGGINMTALADIDFDSVAL--------------KSYKAELNPRARLADMTNGNLSTEAALLIDGMKSLVQALRLLNEDVYAGRLSKSGLHSNGETSPTGNLPCQPSSPPPFTAPQIMEKLQQTNQLSTGGKLKF---------------------FLQLGEWNSLDGIVMRVSTDKNDSEAS-VDLNKVRI--VSSILLSPFMMEKKDVNGNPIKGEYEGFCVDLVQKLAEMIKFKYKMKAVSDGQFGSLVNGSWDGMVGELLRREADIVVAPLTITSDRERVVDFTTPFMEFGLSVMYQKIDRPHPDPLSFMEPLSTEIWMCISFAYLGVSVVLFLVSRLSPAEWGAPLNKSKTLADPNLEGDECDGEMTISHTDSIFSIFNSFWFALSTFVQQGGDIVPRSLSGRIVGGAWWFFTLIIVSSYTANLAAYLTVERMTNPIQSYEDLARQSKVKYGIIKSGSTRDFFEKSSIKIFQQMWKFMESNPEALAPTVKAGVERVINSNKDYAFILESTMNEYFNQRRPCTTVKVGPNLDSGKGYGVATPPGSDLRDRLNLAVLELKEMDWIAQLYRLWWEERGECGKMAKSADKNTATSSLGLDSVYGLFYLLAGALVIGIVLAILEFIYRCAVNAKRTKVSSSTTTQQII 928          
BLAST of Glutamate receptor vs. TrEMBL
Match: A0A267ENE6 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023176g3 PE=3 SV=1)

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 416/942 (44.16%), Postives = 559/942 (59.34%), Query Frame = 3
Query:  429 LVGAIFDSLDRNSPEYTAFNL-------------KSAG-KTFS-----NAEDNIIKTKVVYVDDISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNER----------------------------FGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYS-----FSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKV--AVKSTRFHTNSGDQVCSPVTNPKYCADELKPAI------TRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHG--LTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTG-----EFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND-SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE-VDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMESNPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWW-ENQSKCKKQVESNENSITKNSVRFDDXXXXXXXXXXXXXXXXXXXXXXXVYKCTLESKRKSKSFMVTFKELVDQSKKREQNYDDIHSFSKI--KGESR 3038
            L+G IF +    S  Y AFN              + AG  +FS         +  +  V +V++  DSFQ++ AIC+L+   V+A+FGP H +T+  +QS+TD   ++Y+T S       +    R                             GK +I+L+P++  A++  I  ENW+R  +LYDS  AL RLR +FE  N+R   +SAD R  +      + +  VL YI++KSK  + K + LD+  +E + ++  ++  ++  R +YHYL+   D  E+  +   +GG+N T FS L+ +NP    F    W  E   + +     N Q +  +P  AAL++DG+E L RA +   AV+ TR   +     C P   P Y A  L  AI      T   F GLTG V+FN +G+R  +++ + EA VK  L  I  WS   G  +T     K  L L NFS NRT  V+SIL  PFLM   + +   T       F GFC D + ++A+ + F Y I  V D  FG   N+ +WNGMIGEL R EAD+ VAPLTITS RE+ VDFSTP+ME GLSVMFL+P   E + FGFMKPLS +IWMCI FAYLGVSVVLF+VSRF+PYEW +         +V N+F+IFNS WF+LSAFMQQGGDISPRSL+GRIVG VWWFFTLIIVSSYTANLAA+LTVERM+ PI+SYEDLAKQ KIKYGVV+SGSSK+FF  S  + F++MW FME+NP VFV  I  G+N+V+NS  +YAF+LES+MN+YY+ Q+ C T KVG NL+SG+GYGIATP GSDLRD INL VL+LKEK  I  +  +WW E Q  C  Q + +    +  S+    + GLF +L+ G A G+ LS+LE  Y+C L +KRK +SF    ++++  S +     +  H  S +   G SR
Sbjct:   68 LIGGIFKNSSLQSASYAAFNFAIEQLRLRSDSGDRLAGPASFSWFGPLGGRRDRYEAAVEFVENPEDSFQISSAICRLVSRGVLAIFGPAHYKTLPMVQSMTDNLAVLYLTNSFVDQLQPDRIVHRRQKTSSGGGAGRASGGGGSSSGRGGSRVHGKFLIRLKPVITQALIAIIDHENWERFFFLYDSQSALLRLRELFEAYNNRDATISADIRDLTDNSDRSAAAATVLNYIDKKSK-ETLKRVFLDVSDQELQRKLFAEIRSIRSSRFNYHYLIMGSDMNELNMTSFRHGGVNITGFSLLNASNPKFRRFRDEFWSQEERLRRWPTKFDNLQGV--VPLSAALMLDGMEALVRAHEQLPAVRQTRRQADD----CLPTLTPAYPAASLSGAIKSARHGTGAGFEGLTGWVEFNRTGYRDRFRVQVFEAGVKSELLPISEWSRDGGFRITRSKLRKKGLRL-NFS-NRTRVVTSILSEPFLMLRGNTSFDGTPLVGNERFTGFCADFIKQLARKIGFDYVIKPVADGNFGDDSNNGTWNGMIGELYRQEADIAVAPLTITSKREKAVDFSTPYMEVGLSVMFLRPTKAESDRFGFMKPLSMEIWMCIAFAYLGVSVVLFVVSRFSPYEWYMSQESGGPPGRVINDFSIFNSLWFALSAFMQQGGDISPRSLSGRIVGSVWWFFTLIIVSSYTANLAAFLTVERMSTPIQSYEDLAKQTKIKYGVVNSGSSKDFFRESTSQDFRRMWQFMEANPNVFVDTIQEGVNRVLNSNNDYAFLLESTMNEYYS-QQNCRTMKVGGNLESGRGYGIATPSGSDLRDPINLNVLQLKEKGDISALQTKWWYEKQGSCPNQEKDDAKKNSAQSLELQSVAGLFYILVAGTAFGVVLSLLEFGYRCALLAKRKKRSFREVARDMLILSTRGRLTVECPHESSDLIDGGASR 999          
BLAST of Glutamate receptor vs. TrEMBL
Match: A0A267FKB2 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023176g1 PE=3 SV=1)

HSP 1 Score: 702.975 bits (1813), Expect = 0.000e+0
Identity = 415/942 (44.06%), Postives = 559/942 (59.34%), Query Frame = 3
Query:  429 LVGAIFDSLDRNSPEYTAFNL-------------KSAG-KTFS-----NAEDNIIKTKVVYVDDISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNER----------------------------FGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYS-----FSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKV--AVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIK------FMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHG--LTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTG-----EFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND-SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE-VDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMESNPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWW-ENQSKCKKQVESNENSITKNSVRFDDXXXXXXXXXXXXXXXXXXXXXXXVYKCTLESKRKSKSFMVTFKELVDQSKKREQNYDDIHSFSKI--KGESR 3038
            L+G IF +    S  Y AFN              + AG  +FS         +  +  V +V++  DSFQ++ AIC+L+   V+A+FGP H +T+  +QS+TD   ++Y+T S       +    R                             GK +I+L+P++  A++  I  ENW+R  +LYDS  AL RLR +FE  N+R   +SAD R  +      + +  VL YI++KSK  + K + LD+  +E + ++  ++  ++  R +YHYL+   D  E+  +   +GG+N T FS L+ +NP    F    W  E   + +     N Q +  +P  AAL++DG+E L RA +   AV+ TR   +     C P   P Y A  L  AI   +      F GLTG V+FN +G+R  +++ + EA VK  L  I  WS   G  +T     K  L L NFS NRT  V+SIL  PFLM   + +   T       F GFC D + ++A+ + F Y I  V D  FG   N+ +WNGMIGEL R EAD+ VAPLTITS RE+ VDFSTP+ME GLSVMFL+P   E + FGFMKPLS +IWMCI FAYLGVSVVLF+VSRF+PYEW +         +V N+F+IFNS WF+LSAFMQQGGDISPRSL+GRIVG VWWFFTLIIVSSYTANLAA+LTVERM+ PI+SYEDLAKQ KIKYGVV+SGSSK+FF  S  + F++MW FME+NP VFV  I  G+N+V+NS  +YAF+LES+MN+YY+ Q+ C T KVG NL+SG+GYGIATP GSDLRD INL VL+LKEK  I  +  +WW E Q  C  Q + +    +  S+    + GLF +L+ G A G+ LS+LE  Y+C L +KRK +SF    ++++  S +     +  H  S +   G SR
Sbjct:   59 LIGGIFKNSSLQSASYAAFNFAIEQLRLRSDSGDRLAGPASFSWFGPLGGRRDRYEAAVEFVENPEDSFQISSAICRLVSRGVLAIFGPAHYKTLPMVQSMTDNLAVLYLTNSFVDQLQPDRIVHRRQKTSSGGGASRASGGGGSSSGRGGSRVHGKFLIRLKPVITQALIAIIDHENWERFFFLYDSQSALLRLRELFEAYNNRDATISADIRDLTDNSDRSAAAATVLNYIDKKSK-ETLKRVFLDVSDQELQRKLFAEIRSIRSSRFNYHYLIMGSDMNELNMTSFRHGGVNITGFSLLNASNPKFRRFRDEFWSQEERLRRWPTKFDNLQGV--VPLSAALMLDGMEALVRAHEQLPAVRQTRRQADD----CLPTLTPAYPAASLSGAIKSARHGAGAGFEGLTGWVEFNRTGYRDRFRVQVFEAGVKSELLPISEWSRDGGFRITRSKLRKKGLRL-NFS-NRTRVVTSILSEPFLMLRGNTSFDGTPLVGNERFTGFCADFIKQLARKIGFDYVIKPVADGNFGDDSNNGTWNGMIGELYRQEADIAVAPLTITSKREKAVDFSTPYMEVGLSVMFLRPTKAESDRFGFMKPLSMEIWMCIAFAYLGVSVVLFVVSRFSPYEWYMSQESGGPPGRVINDFSIFNSLWFALSAFMQQGGDISPRSLSGRIVGSVWWFFTLIIVSSYTANLAAFLTVERMSTPIQSYEDLAKQTKIKYGVVNSGSSKDFFRESTSQDFRRMWQFMEANPNVFVDTIQEGVNRVLNSNNDYAFLLESTMNEYYS-QQNCRTMKVGGNLESGRGYGIATPSGSDLRDPINLNVLQLKEKGDISALQTKWWYEKQGSCPNQEKDDAKKNSAQSLELQSVAGLFYILVAGTAFGVVLSLLEFGYRCALLAKRKKRSFREVARDMLILSTRGRLTVECPHESSDLIDGGASR 990          
BLAST of Glutamate receptor vs. TrEMBL
Match: A0A267F5K3 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023176g2 PE=3 SV=1)

HSP 1 Score: 701.819 bits (1810), Expect = 0.000e+0
Identity = 409/908 (45.04%), Postives = 546/908 (60.13%), Query Frame = 3
Query:  429 LVGAIFDSLDRNSPEYTAFNL-------------KSAG-KTFS-----NAEDNIIKTKVVYVDDISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNER----------------------------FGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYS-----FSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKV--AVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIK------FMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHG--LTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTG-----EFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND-SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE-VDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMESNPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWW-ENQSKCKKQVESNENSITKNSVRFDDXXXXXXXXXXXXXXXXXXXXXXXVYKCTLESKRKSKSF 2942
            L+G IF +    S  Y AFN              + AG  +FS         +  +  V +V++  DSFQ++ AIC+L+   V+A+FGP H +T+  +QS+TD   ++Y+T S       +    R                             GK +I+L+P++  A++  I  ENW+R  +LYDS  AL RLR +FE  N+R   +SAD R  +      + +  VL YI++KSK  + K + LD+  +E + ++  ++  ++  R +YHYL+   D  E+  +   +GG+N T FS L+ +NP    F    W  E   + +     N Q +  +P  AAL++DG+E L RA +   AV+ TR   +     C P   P Y A  L  AI   +      F GLTG V+FN +G+R  +++ + EA VK  L  I  WS   G  +T     K  L L NFS NRT  V+SIL  PFLM   + +   T       F GFC D + ++A+ + F Y I  V D  FG   N+ +WNGMIGEL R EAD+ VAPLTITS RE+ VDFSTP+ME GLSVMFL+P   E + FGFMKPLS +IWMCI FAYLGVSVVLF+VSRF+PYEW +         +V N+F+IFNS WF+LSAFMQQGGDISPRSL+GRIVG VWWFFTLIIVSSYTANLAA+LTVERM+ PI+SYEDLAKQ KIKYGVV+SGSSK+FF  S  + F++MW FME+NP VFV  I  G+N+V+NS  +YAF+LES+MN+YY+ Q+ C T KVG NL+SG+GYGIATP GSDLRD INL VL+LKEK  I  +  +WW E Q  C  Q + +    +  S+    + GLF +L+ G A G+ LS+LE  Y+C L +KRK +SF
Sbjct:   59 LIGGIFKNSSLQSASYAAFNFAIEQLRLRSDSGDRLAGPASFSWFGPLGGRRDRYEAAVEFVENPEDSFQISSAICRLVSRGVLAIFGPAHYKTLPMVQSMTDNLAVLYLTNSFVDQLQPDRIVHRRQKTSSGGGAGRASGGGGSSSGRGGSRVHGKFLIRLKPVITQALIAIIDHENWERFFFLYDSQSALLRLRELFEAYNNRDATISADIRDLTDNSDRSAAAATVLNYIDKKSK-ETLKRVFLDVSDQELQRKLFAEIRSIRSSRFNYHYLIMGSDMNELNMTSFRHGGVNITGFSLLNASNPKFRRFRDEFWSQEERLRRWPTKFDNLQGV--VPLSAALMLDGMEALVRAHEQLPAVRQTRRQADD----CLPTLTPAYPAASLSGAIKSARHGAGAGFEGLTGWVEFNRTGYRDRFRVQVFEAGVKSELLPISEWSRDGGFRITRSKLRKKGLRL-NFS-NRTRVVTSILSEPFLMLRGNTSFDGTPLVGNERFTGFCADFIKQLARKIGFDYVIKPVADGNFGDDSNNGTWNGMIGELYRQEADIAVAPLTITSKREKAVDFSTPYMEVGLSVMFLRPTKAESDRFGFMKPLSMEIWMCIAFAYLGVSVVLFVVSRFSPYEWYMSQESGGPPGRVINDFSIFNSLWFALSAFMQQGGDISPRSLSGRIVGSVWWFFTLIIVSSYTANLAAFLTVERMSTPIQSYEDLAKQTKIKYGVVNSGSSKDFFRESTSQDFRRMWQFMEANPNVFVDTIQEGVNRVLNSNNDYAFLLESTMNEYYS-QQNCRTMKVGGNLESGRGYGIATPSGSDLRDPINLNVLQLKEKGDISALQTKWWYEKQGSCPNQEKDDAKKNSAQSLELQSVAGLFYILVAGTAFGVVLSLLEFGYRCALLAKRKKRSF 956          
BLAST of Glutamate receptor vs. Ensembl Cavefish
Match: gria4a (glutamate receptor, ionotropic, AMPA 4a [Source:ZFIN;Acc:ZDB-GENE-020125-7])

HSP 1 Score: 548.51 bits (1412), Expect = 1.778e-180
Identity = 315/800 (39.38%), Postives = 478/800 (59.75%), Query Frame = 3
Query:  417 PNIVLVGAIFDSLDRNSPEYTAFNLKS-AGKTFSNAEDNIIKTKVVYVDDI--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFS--KNRTLRVSSILVPPFLMRVKD---KNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS-----NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            P+ V +G +F  +     EYTAF L      T  NA +      V +VD+I  ++SF +  A C      V A+FG    R+VHT+ S   A  +  I+ S    + +E   +     +++LRP +  A++  +   +W R +++YD++     L+ I E        +SA   +   + +D   + +     R  +K  ++DL+ E  +  I++Q   + K    YHY++  +  ++I     ++GG N T F  +D++ P++ + ++ +W  +  ++ Y  S +  +    L Y+A L++   E  +   +  +  +R   N+GD + +P   P     +++  + +++  GLTGN+QF+  G R NY +D+ E R     K IG W+    L  +   +++L   N S  +NRT+ V++I+  P++M  K+     G D  ++EG+C DL +EIAK +   Y I  V D ++GA   ++  WNGM+GEL+  +A++ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P E           NEF IFNS WFSL AFMQQG D +PRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +D+GS+KEFF  SKI +++KMW +M+S  P VF K  + G+ +V  S+ +YAF+LES+MN+Y   ++PC+T KVG NLDS KGYGIATP GS LR+++NLAVL+L E+  + ++  +WW ++ +C
Sbjct:   18 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNATEAPFNL-VPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLISPS----FPAEGETQF----VLQLRPNLRGALISILDHYDWNRFVFIYDTDRGYAILQAIMEKAGQNGWQVSAICVE---NFNDAGYRRLLEDLDRRQEKKFVIDLEAERLQT-ILEQAVSVGKHVKGYHYIIANLGFKDISLERFMHGGANVTGFQLVDFSKPMVIKLMQ-RW-NKLDQREYPGSESPPKFSSSLTYDAVLVM--AEAFRNLRRQKIDISR-RGNAGDCLANPAA-PWNQGIDMERTLKQVRIQGLTGNIQFDHYGRRVNYTMDVFELRSNGPQK-IGYWNDIDKLVLV---QNELGAGNGSAMENRTVIVTTIMEGPYVMLKKNWEMYEGND--QYEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEEGSESAPADQPPNEFGIFNSLWFSLGAFMQQGCDFTPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDAGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDS-KGYGIATPKGSQLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGEC 789          
BLAST of Glutamate receptor vs. Ensembl Cavefish
Match: gria4b (glutamate receptor 4 [Source:NCBI gene;Acc:103035012])

HSP 1 Score: 547.354 bits (1409), Expect = 1.413e-179
Identity = 316/798 (39.60%), Postives = 473/798 (59.27%), Query Frame = 3
Query:  417 PNIVLVGAIFDSLDRNSPEYTAFNL----KSAGKTFSNAEDNIIKTKVVYVDDI--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKD---KNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE-VDSKVS----NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQ 2759
            P+ V +G +F  +     EYTAF L     +     S A  N++     +VD+I  ++SF +  A C      V A+FG    R+VHT+ S   A  +  IT S    +  E  ++     +++LRP +  A++  +   +W R ++LYD++     L+ I E        +SA   +   + +D   + +     R  +K  ++DL+ E   N +++Q+  + K    YHY++  +  ++I     ++GG N T F  +D+ NP++ + ++ +W  +  ++ Y  S +  +    L Y+  +++   E  +   +  V  +R   N+GD + +P   P     +++  + +++  GLTGNVQF+  G R NY +D+ E +     + IG W+ +  L  I          +  +NRT+ V++I+  P++M  K+     G D   +EG+C DL +EIAK +   Y I  V D ++GA   ++  WNGM+GEL+  +A++ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P E  D   S    NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ  I YG +DSGS+KEFF  SKI +++KMW +M+S  P VF K  + G+ +V  S+ +YAF+LES+MN+Y   ++PC+T KVG NLDS KGYG+ATP GS LR ++NLAVL+L E+  + ++  +WW ++
Sbjct:   24 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVP----HVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCGALHISLITPS----FPIEGESQF----VLQLRPSIRGALLSILDHYDWNRFVFLYDTDRGYSILQAIMEKAGQNGWQVSAICVE---NFNDASYRQLLEDLDRRQEKTFVIDLEPERLTN-MLEQIVSVGKHVKGYHYIMANLGFKDINLERFMHGGANVTGFQLVDFGNPMVIKLLQ-RW-NKLDQREYPGSDSPPKYTSALTYDGVMVM--AEAFRNLRRQKVDISR-RGNAGDCLANPAA-PWNQGIDMERTLKQVRLQGLTGNVQFDHYGRRVNYTMDVFELK-NNGPRRIGYWNDADKLVLIQDQALLPNETSGMENRTVVVTTIMEGPYVMLKKNWEMYEGND--RYEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEEGTDGPPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTDIAYGTLDSGSTKEFFRRSKIAVYEKMWGYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDS-KGYGVATPKGSQLRSAVNLAVLKLNEQGLLDKLKNKWWYDK 793          
BLAST of Glutamate receptor vs. Ensembl Cavefish
Match: GRIA2 (glutamate ionotropic receptor AMPA type subunit 2 [Source:NCBI gene;Acc:103039282])

HSP 1 Score: 540.806 bits (1392), Expect = 3.817e-178
Identity = 301/760 (39.61%), Postives = 464/760 (61.05%), Query Frame = 3
Query:  561 DISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSA-DARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKS---TRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFS--KNRTLRVSSILVPPFLMRVKDKN-GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGV----DTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKCKKQVESNENS 2798
            ++++SF +    C      V A+FG    ++V+TI S      + +IT S    +  + T +     II++RP +   ++  I    W +  YLYDS+  L  L+++ +    R+  ++A +       + D   + + +  +   ++ +ILD + ++ K+ I++Q+  + +    YHY++  +   +   S I  GG N + F  +D+ +P++++F   +W  E+  +   P + +     K+ Y +AL  D ++++  A +   K         N+GD + +P   P     E++ A+ +++  GLTGN+QF++ G R NY ++++E +    +K IG W+    +  +   KSDL   +    +N+T+ V++IL  P++M  K+ +   D   +EG+C DL  EIAK   F Y +  V D ++GA   ++  WNGM+GEL+  +AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW      D  ++ +   +NEF IFNS WFSL AFM+QG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +DSGS+KEFF  SKI +F KMW +M S  P VFVK  + G+ +V  S+ +YA++LES+MN+Y   ++PC+T KVG NLDS KGYGIATP GS LR+++NLAVL+L E+  + ++  +WW ++ +C      ++N+
Sbjct:   69 EVANSFAVTNCFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPS----FPLDGTQQF----IIQMRPDIKGPLLSLIEYYKWDKFAYLYDSDRGLTTLQVVLDTAAERKWQVTAINVGNMKDERKDEAYRSLFQDLENKKERRVILDCEQDKVKD-IMEQIITIGRHVKGYHYIIANLGFVDGDLSKIQYGGANVSGFQIVDFEDPLVSKF-DQRW--EALEEKEYPGADS-----KIRYTSALTYDAVQVMTEAFRYLNKQHIDISRRANNGDCLANPAV-PWAQGVEIERALKQVRVEGLTGNIQFDQYGRRVNYTVNVMELKNNGPVK-IGYWNE---VDKMAVTKSDLFPNDTMGLENKTVIVTTILEAPYVMLKKNADLFMDNERYEGYCVDLAAEIAKHCGFKYRLKIVGDGKYGARDAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEYEDGQIQTNES-TNEFGIFNSLWFSLGAFMRQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIALFDKMWTYMRSAEPSVFVKTTAEGVLRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKNA 804          
BLAST of Glutamate receptor vs. Ensembl Cavefish
Match: GRIA2 (glutamate ionotropic receptor AMPA type subunit 2 [Source:NCBI gene;Acc:103039282])

HSP 1 Score: 541.191 bits (1393), Expect = 3.829e-178
Identity = 300/750 (40.00%), Postives = 460/750 (61.33%), Query Frame = 3
Query:  561 DISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSA-DARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKS---TRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFS--KNRTLRVSSILVPPFLMRVKDKN-GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGV----DTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            ++++SF +    C      V A+FG    ++V+TI S      + +IT S    +  + T +     II++RP +   ++  I    W +  YLYDS+  L  L+++ +    R+  ++A +       + D   + + +  +   ++ +ILD + ++ K+ I++Q+  + +    YHY++  +   +   S I  GG N + F  +D+ +P++++F   +W  E+  +   P + +     K+ Y +AL  D ++++  A +   K         N+GD + +P   P     E++ A+ +++  GLTGN+QF++ G R NY ++++E +    +K IG W+    +  +   KSDL   +    +N+T+ V++IL  P++M  K+ +   D   +EG+C DL  EIAK   F Y +  V D ++GA   ++  WNGM+GEL+  +AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW      D  ++ +   +NEF IFNS WFSL AFM+QG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +DSGS+KEFF  SKI +F KMW +M S  P VFVK  + G+ +V  S+ +YA++LES+MN+Y   ++PC+T KVG NLDS KGYGIATP GS LR+++NLAVL+L E+  + ++  +WW ++ +C
Sbjct:   19 EVANSFAVTNCFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPS----FPLDGTQQF----IIQMRPDIKGPLLSLIEYYKWDKFAYLYDSDRGLTTLQVVLDTAAERKWQVTAINVGNMKDERKDEAYRSLFQDLENKKERRVILDCEQDKVKD-IMEQIITIGRHVKGYHYIIANLGFVDGDLSKIQYGGANVSGFQIVDFEDPLVSKF-DQRW--EALEEKEYPGADS-----KIRYTSALTYDAVQVMTEAFRYLNKQHIDISRRANNGDCLANPAV-PWAQGVEIERALKQVRVEGLTGNIQFDQYGRRVNYTVNVMELKNNGPVK-IGYWNE---VDKMAVTKSDLFPNDTMGLENKTVIVTTILEAPYVMLKKNADLFMDNERYEGYCVDLAAEIAKHCGFKYRLKIVGDGKYGARDAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEYEDGQIQTNES-TNEFGIFNSLWFSLGAFMRQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIALFDKMWTYMRSAEPSVFVKTTAEGVLRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGEC 744          
BLAST of Glutamate receptor vs. Ensembl Cavefish
Match: gria2a (glutamate receptor 2-like [Source:NCBI gene;Acc:103028119])

HSP 1 Score: 541.576 bits (1394), Expect = 1.137e-177
Identity = 316/823 (38.40%), Postives = 486/823 (59.05%), Query Frame = 3
Query:  345 LLILSAILIPCQPEQLLRKRRQPIPNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVD--DISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSA-DARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKS---TRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDL--TLVNFSKNRTLRVSSILVPPFLMRVKDKN-GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVD---SKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            ++ LS  L+P     L        P++ + G      D+   EY+AF +      F  AE  +      ++D  ++++SF +    C      V A+FG    ++V+TI S  +   + +IT S    + ++  N+     ++++RP +   ++  +    W++  YLYDS+  L  L+ + +    R+  ++A +       + D   + + +  +   ++ +ILD + ++ K+ I++Q+  + +    YHY++      +   S I  GG N + F  +D+++P++ +F   +W  E+  +   P + +     K+ Y +AL  D ++++  A +   K         N+GD + +P   P     E++ A+ +++  GLTGN+QF++ G R NY ++I+E +    +K IG W+    +  +   KSDL        +N+T+ V++IL  P++M  K+     D   +EG+C DL  EIAK   F Y +  V D ++GA   ++  WNGM+GEL+  +AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  +   +     S+ +NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +D+GS+KEFF  SKI +F KMW +M+S  P VFVKN   G+ +V  S+ +YA++LES+MN+Y   ++PC+T KVG NLDS KGYGIATP GS LR  +NLAVL+L E+  + +M  +WW ++ +C
Sbjct:    6 MMSLSGFLLPA----LWGLALGGSPSVQIGGLFPRGADQ---EYSAFRVGMV--QFGTAEFRLTP----HIDNLEVANSFAITNCFCSQFSRGVYAIFGFYDKKSVNTITSFCETLHVSFITPS----FPADGLNQF----VLQMRPDIKGPLISLVEYYKWEKFAYLYDSDRGLSTLQAVLDTAAERKWQVTAINVGNLKDERKDEAYRSLFQDLENKKERRVILDCEQDKVKD-IMEQVITIGRHVKGYHYIIANFGFLDGDLSKIQYGGANVSGFQIVDFDDPLVAKF-DQRW--EALEEKEYPGADS-----KIRYTSALTYDAVKVMTEAFRFLHKQRIDISRRGNNGDCLANPAV-PWAQGVEIERALKQVRVDGLTGNIQFDQYGRRVNYSVNIMELKNSGPVK-IGYWNE---VDKMVVTKSDLFPNDTMGMENKTVIVTTILEAPYVMLKKNSELFTDNERYEGYCVDLAAEIAKHCGFKYQLKIVGDGKYGARDAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGQLGASESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDAGSTKEFFRRSKIALFDKMWQYMKSAEPSVFVKNTVEGVLRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRTPVNLAVLKLSEQGVLDKMKNKWWYDKGEC 792          
BLAST of Glutamate receptor vs. Ensembl Sea Lamprey
Match: gria1b (glutamate receptor, ionotropic, AMPA 1b [Source:ZFIN;Acc:ZDB-GENE-020125-2])

HSP 1 Score: 420.239 bits (1079), Expect = 2.382e-136
Identity = 212/410 (51.71%), Postives = 281/410 (68.54%), Query Frame = 3
Query: 1638 SKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS---------------------------NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFM-ESNPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            + NRT+ V++IL  P+ M  K+     G D  ++EG+C DL  EIA    F Y    V D  +GA   D+  WNGM+GEL+   AD+ +APLTI+  RE V+DFS PFM  G+S+M  KP   +P    F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  D   +V+   +                           NEF IFNS WFSL AFMQQG +ISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S +DLAKQ +I YG +DSGS+KEFF  SKI +++KMWLFM ++ P+VFV+  + G+++V  S+ +YA++LES+ N+Y   ++PC+T KVG NLDS KGYGIATP GS LRD++NLAVL+L E+  + ++  +WW ++ +C
Sbjct:   28 TGNRTVIVTTILDAPYFMLKKNHEQFEGND--KYEGYCVDLGQEIAIHEQFEYKWSVVPDGAYGARNPDTKVWNGMVGELVYGRADIAIAPLTISLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVISFLDPLAYEIWMCIIFAYIGVSVVLFLVSRFSPYEWQRDDDTDVEPNGNGGAGGGGGGGGSGGGAGGGSGGGGEPPNEFGIFNSLWFSLGAFMQQGCEISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIAYGTLDSGSTKEFFQRSKIGVYEKMWLFMKDAEPKVFVRTNADGVSRVRKSKGKYAYLLESTTNEYTEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRDAVNLAVLKLNEQGLLDKLKNKWWYDKGEC 434          
BLAST of Glutamate receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005084.1 (pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 gene:ENSPMAG00000004612.1 transcript:ENSPMAT00000005084.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 324.324 bits (830), Expect = 7.880e-103
Identity = 160/311 (51.45%), Postives = 214/311 (68.81%), Query Frame = 3
Query: 1869 NEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKV-SNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMESNPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKCKKQVESNENS 2798
            ++ADL VAPLTI   RE+ +DFS PFM  G+S+++ KP+   P  F F+ PLS DIWM I  AYLGVS VLF+++RF+PYEW    P   DS V  N FT+ NSFWF + A MQQG ++ P++L+ RIVGG+WWFFTLII+SSYTANLAA+LTVERM +PI S +DLAKQ +I+YG V  GS+  FF  SKI  ++KMW FM S     +KN   GI +V+ +  +YA ++ES+ N  Y  Q  C  T++G  +D+ KGYGI TP GS  RD I +A+L+L+E+ K+  M ++WW     C ++ +SNE S
Sbjct:    8 HKADLAVAPLTINYMREKAIDFSKPFMTLGISILYRKPNGTNPGIFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTMLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPISSADDLAKQTRIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQTALIKNNEEGIQRVLTT--DYAMLMEST-NIEYVTQRNCNLTQIGGLIDN-KGYGIGTPLGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNG-CPEE-DSNEAS 312          
BLAST of Glutamate receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002503.1 (pep scaffold:Pmarinus_7.0:GL492163:1:1446:1 gene:ENSPMAG00000002286.1 transcript:ENSPMAT00000002503.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.2 bits (487), Expect = 1.720e-56
Identity = 96/192 (50.00%), Postives = 130/192 (67.71%), Query Frame = 3
Query: 2097 FNPYEWGVDTPVEVDSKV-SNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMESNPE-VFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPG 2666
            F+PYEW    P   DS V  N FT+ NS WF + A MQQG ++ PR+L+ RIVGG+WWFFTLI++SSYTANLAA+LTVERM +PI S +DLAKQ KI+YG V  GS+  FF  S+I  ++KMW FM S  +   VKN   GI++ + +  ++A ++ES+  ++   Q  C  T++G  +DS KGYG+  P G
Sbjct:    1 FSPYEWKNPHPCNPDSDVLENNFTMLNSLWFGVGALMQQGSELMPRALSTRIVGGIWWFFTLILISSYTANLAAFLTVERMESPIGSADDLAKQTKIEYGAVRDGSTMTFFKKSRISTYEKMWAFMSSRHQTALVKNNEEGIHRALTT--DFAMLMESTTIEHVT-QRYCNLTQIGGLIDS-KGYGVGMPLG 188          
BLAST of Glutamate receptor vs. Ensembl Sea Lamprey
Match: GRIA4 (glutamate ionotropic receptor AMPA type subunit 4 [Source:HGNC Symbol;Acc:HGNC:4574])

HSP 1 Score: 187.578 bits (475), Expect = 3.025e-49
Identity = 197/809 (24.35%), Postives = 357/809 (44.13%), Query Frame = 3
Query:  426 VLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVD--DISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKS---DLTLVNFSKNRTLRVSSILVPPFLMRVKDK---NGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDR-EPEAFGFM-KPLSKDIWMCITFAYLGVSVVLFLVSRFNPYE-WG---VDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGV-VDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYY--NLQEPCE-TTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKCKKQ 2777
            VL+G +F    ++  E++AF         +  E ++     VY D  D+ +SF    A C      V A+F  +  R+  ++ S   A  +  +T S     A +     F   +I+L+P +   ++  I    W + +YLYD++  L+ L+ + +    R   + A + +     S+  L+ + R      +++I+LD +     + ++Q ++ +      +HY++  +   ++       GG N + F  +D   P +  F+  +W  +S      P S +        Y +AL  DG+ ++ +A + A+   RF      N+GD + +P   P     +++ A+  +   GLT N+QFNE G R NY + ++E R     K +G+    H    + R+++   D    +  +N+T+ V++IL  P+ M  K+     G D   FEG+C DL  EIA+ + F Y    V D  +G+   ++  WNGM+GEL+   A+  V PL    +    VD      E   S  F+K   +  P    F+ + L   +  C+ F +L +SV +F    +  YE W    V          +    +F+  WF   A  Q+  +  P+    R V  ++ F  +++VSS+   +  + T+  M+      +     N I   V + S S+ E+            W F    +P +  K+ +  +N V       A +L+   N +   + +E C+   KVG+  +  K YGI     S  R  +NLAVL+L E   + ++  +WW ++ +C  +
Sbjct:    1 VLLGGLFTR--QSDQEHSAFRFGILQHNSNLNESDVPFGLTVYTDTIDLPNSFTFTKAFCSQFSRGVFAMFSVLDRRSASSLTSFCAALHVSMVTPS-----APQEPPSPF---LIELQPPLGWPLLHLIDRYEWGKFVYLYDTDRGLWLLQSVVQEATRRGWAMMALSIE---GLSEEALRQLLRDLAVRGERNIVLDCETYRVTSTLLQVVN-VGNHVKGFHYIIANLGFLDVDLDVFRYGGANVSGFQMVDRMAPQVIAFL-DKWHKQSPH--VYPGSDSLH----FKYTSALAYDGVFVISQAFR-ALYKQRFDLHREGNAGDCLANPAV-PWGKGVDIQRALKNVHINGLTNNIQFNELGQRSNYTLGVMELRPTGPTK-LGSIMCVHPGGILVRHQALGEDGINSSLHQNKTVIVTTILDAPYFMYRKNYEQLTGND--RFEGYCADLGEEIARHVGFNYRWKLVPDGAYGSRDTETKIWNGMVGELVYGHAEQTVDPLCAILAFSVYVDLICSLTELA-STAFIKAIQKASPNVSMFLHRVLPLSVCTCMYFLHL-LSVCVFGKPYWRTYESWTAEQVSGSRGDGGGRTRAHALFSLAWF--HAVCQERRNYIPQVSVRRAVQAIYAFINMLLVSSFLPGIVFFFTLWSMSYQFSGCKSC--NNYIADAVGLRSSSTXEWPRKVTYPHCLNPWHFNRVLSPNIRSKSTAGQVNGVRKETGWIARLLDGCCNQWVQPHQRERCDPIKKVGNYFN--KTYGIYFTHFSTPRTRVNLAVLKLSELGTLDKLKNKWWYDKGECGAK 775          
BLAST of Glutamate receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000621.1 (pep scaffold:Pmarinus_7.0:GL479810:19620:30867:-1 gene:ENSPMAG00000000562.1 transcript:ENSPMAT00000000621.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.739 bits (356), Expect = 2.128e-38
Identity = 83/225 (36.89%), Postives = 128/225 (56.89%), Query Frame = 3
Query: 1680 PFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND-SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIK 2351
            PF+M  ++  GK   +F+GF  D+++ ++K L F+Y I    D  +G    D +W+GMIGEL+   AD+ ++ LTIT  RE VVDF+  +M++ + V   +P D     F  + PL    W C+  A   V ++++L++R  P      +P           ++  S W    +FMQQG ++S  SL+ R+V GVWW F  I+VSSYTA+L A LT+ RM+ PI+
Sbjct:    5 PFVMLAENVLGKPK-KFQGFSVDVMDALSKSLGFSYEIFMPADLSYGLPQADGTWSGMIGELLNKRADVAISALTITPERESVVDFTKRYMDYSVGVAARRPADSA-GLFALLSPLEPATWACLGLAVGLVGLLVYLLNRVTPRREPRHSP-----------SLPASLWLVYGSFMQQGPELSSSSLSARLVMGVWWLFAFIVVSSYTASLTALLTINRMDPPIR 216          
BLAST of Glutamate receptor vs. Ensembl Nematostella
Match: EDO41291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J5])

HSP 1 Score: 265.388 bits (677), Expect = 1.473e-79
Identity = 140/367 (38.15%), Postives = 228/367 (62.13%), Query Frame = 3
Query: 1680 PFLMRVKDKNG-KDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLG-VSVVLFLVSRFNPYEWGVDTPVEVDSK-VSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVER-MNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMESNPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            PF+M   + +  K    + GF KDL+  +++ LNF Y I   K+  +G+ V   W G+IGEL+R EAD+ + P+TIT+ RE V+DFS PF++F ++++  +P   E   F F+ P  + +W+  T   +G VS++++ + RF+P   G  T  E   +   +EF++ NS WF++++ +QQGGD +PRS +GR++   +W FTLI++S+YTANLAAY T ER + + I S EDL  Q+ +KYGV + GS   FF  SK++I+  M+  M+S  E FV     G+ K     + +A++ +    DYYN+++PC T  V + LD+ K Y +A    S+  + I++A+LEL+E+ +I +   +WW++ S+C
Sbjct:   10 PFMMIKPNASLLKGNDRYRGFSKDLMELLSRKLNFRYEICISKESSYGSKVEGQWQGLIGELVREEADIALGPITITAEREEVIDFSKPFLDFRIAMILQQPTGEEVNLFAFLLPFDEKLWLT-TLGVVGLVSLIVWFLDRFSPQ--GYKTQAEKSGEGEGDEFSLSNSLWFAVASILQQGGDNTPRSTSGRVLAAAFWLFTLILISTYTANLAAYFTGERGIRSKINSLEDLVSQSTVKYGVQEGGSLFTFFSESKVDIYATMFQQMKSQ-ETFVNGTQYGVLKA--RTQPFAYLTDQPSLDYYNMRKPCNTMLVKNLLDA-KSYALAMRRNSEWTNLISVAILELREEGEIEKSRLRWWDDSSEC 369          
BLAST of Glutamate receptor vs. Ensembl Nematostella
Match: EDO46633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPU4])

HSP 1 Score: 236.884 bits (603), Expect = 5.559e-65
Identity = 159/537 (29.61%), Postives = 267/537 (49.72%), Query Frame = 3
Query: 1308 IVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTN----------PKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLV-------------NFSKNRTLRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGA--LVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEF-------TIFNSFWFSLSAFMQQGGDIS-PRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFME----SNPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDS----GKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKCKKQVESNEN 2795
            ++D + ++ +A++ AV++       GDQV S              P      L   I +++  G  G + F++ GF  N  IDII  +  E    +G W+T  GL       SD T+V             N   +RT+RV S    PF M V + +      FEG   DL++ ++++L+F YTI+   D + G    V  +W+G+I EL++  ADL V P+TITS R +V+DF+ PFM  G+ V+    +  +P  F F++P   D+W+ I  A LG+ VV +L S  +P+ +       ++ +V   +       +  NS W S + ++ QG D + P S +GR    VWWF   I+ ++YTAN+AA+LT  RM  PI+  EDL+ Q +I YG V++  ++ FF +S ++ ++ MW +M+      P+ +       I + +  +  YAFI ++ + +Y   +  C   K+    D+       YG A P  S   + +++ +L+L +      MI++W   ++ C    E+ E 
Sbjct:  256 VIDSVLVIAKAIQNAVQA-------GDQVTSGNAGLFCNLTRRNPPSISGITLNKYIQKVQTAGFMGFLSFSQDGFLANPSIDIINVKENE-FDKVGEWNTKDGLMM----DSDKTVVWMSGGPGTPRDSENVLADRTIRVVSFKGSPFTMPVGNVS-SSVDRFEGAVIDLLDRLSEILHFNYTIYMSPDGRVGVENPVTGNWDGVINELIQERADLAVGPITITSHRWKVIDFTQPFMTSGIGVVMGTENSPKPY-FRFLEPFKSDLWITIFGAVLGMGVVNWLFSVVSPFGFYGRCVQSINKRVKKSYLKQKYSLSFLNSIWSSAAYYLGQGPDGNHPVSASGRAAVAVWWFVITILGATYTANMAAFLTTTRMQTPIRRIEDLSSQTEIAYGCVENSLTQNFFQSSSVQRYQMMWEYMKLRRSLQPDTYT-----AIERTLKGK--YAFIHDAPILEYLARKTYCGRIKLIGGYDTRTFGNAHYGFALPKKSPYTNLLSVEILKLVQSGIAKTMIEEWMIERTPCAPLDEAEEQ 771          
BLAST of Glutamate receptor vs. Ensembl Nematostella
Match: EDO30203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1G4])

HSP 1 Score: 232.646 bits (592), Expect = 7.423e-64
Identity = 149/504 (29.56%), Postives = 261/504 (51.79%), Query Frame = 3
Query: 1407 TNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGL--------------TSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGE----FEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGAL--VNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPE-AFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEW------GVDTPVEVDS-KVSNEFTIFNSFWFSLSAFMQQGGD-ISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMESNPEVFVKNISMGINKVINSQREYAFILESSMNDYY-NLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKCKKQVESNENSITKNSVRFDD 2828
            T P+     L   I+++   G+   + F+ +    +   D++  R     + +G W+   GL                +P + + +      +NRTL+V +I   PF+      NG+  GE     EG+C +L+ ++++ML F + ++ V D+ FGA   V   WNG++ E++   ADL V  LTI+  R++V+DF+ P+M+ GL+V+ +KPD  E +  F  ++P   D+WM I    + V   L+L S F+P+ +         T +E    K+ +  ++  + W ++  ++ Q  D + P S +GRI   V+WF  LI++S+YTANLAA+LT++R  +PI S +DLA+Q  I YG V +   + FF ++ +  F  MW +M  +   FV N + GI KV+N    YAFI +S++ ++  + Q  C T     ++    GYG      S     ++ A+L+L+    +  + ++W +   KC    E+ E + ++N + F+D
Sbjct:  356 TEPRPDGATLLDYISQVNTTGVMNQLGFDSNRSPVDVAFDVVNLRAF-GFQKVGYWNVEEGLHLDNKKEIVWPSGRVYVPTDSTHIL-----ENRTLKVVTIAEAPFIFAQTQTNGQ--GETRVIIEGYCIELLRKLSEMLRFKFEVYLVPDNNFGAQDPVTKEWNGVVREVLNGRADLAVTSLTISPERQKVIDFTQPYMDLGLTVL-IKPDPTEEKNPFAILRPFRYDLWMAIGGTMIIVGFFLWLFSTFSPFGFYGRCVQKCHTKIEPRYLKLHDTLSLVRALWSTVVYYVGQSSDHLHPVSSSGRITVAVYWFAMLIVMSTYTANLAAFLTIKRFTSPISSVDDLARQKDISYGTVLNSQPQAFFESASVPSFVTMWQYMRYH-HTFVNNSAEGIEKVMN--ENYAFIWDSAVLEFVAHNQISCGTLITSGSVFGRIGYGFGLAKDSPYTKQLSNAILQLRHAGYMEFLDRKWLKANDKCA---EAAEKAKSENQLTFED 844          
BLAST of Glutamate receptor vs. Ensembl Nematostella
Match: EDO41293 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J7])

HSP 1 Score: 188.348 bits (477), Expect = 1.957e-53
Identity = 97/265 (36.60%), Postives = 159/265 (60.00%), Query Frame = 3
Query: 2004 FGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMESNPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC--KKQVESNE 2792
            F F+ P  KD+W C       V+++++++ RF+PY +  +     + +  +EF++ NS WF+  + +QQGGD +PRS +GR++   +W FTLI++S+YTANLAA+ T +   + I S EDL  Q+  KYGV   GS   FF  SK+ I+KKM+  M S    FVK    G+N+  +    +A++ +    DYYN ++PC T  V + LD+ K Y +     S+  D I++A+L+L+E+ ++ ++  +WW+  S+C  K  V SN+
Sbjct:    2 FAFLMPFQKDLWACCCLVVGAVTILMWILDRFSPYGFRAEAKNTGEGE-GDEFSLPNSLWFATGSILQQGGDNTPRSGSGRVLAASFWLFTLILISTYTANLAAFFTAQNSKSTINSLEDLVAQDVFKYGVQQGGSLFSFFEKSKVRIYKKMFGKM-STLNTFVKGTDEGVNR--SRTTPFAYLTDQPSLDYYNQRKPCNTMLVKNLLDA-KSYALGLQRNSEWTDGISVAILQLREEGEVERIRYKWWDAMSECNLKDAVVSNQ 261          
BLAST of Glutamate receptor vs. Ensembl Nematostella
Match: EDO35545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL56])

HSP 1 Score: 193.356 bits (490), Expect = 1.022e-50
Identity = 154/525 (29.33%), Postives = 255/525 (48.57%), Query Frame = 3
Query: 1329 LKRALKVAVKSTRFHTNSGDQVCSPVTNPK-----YCADELKPAITRIKF-MGLTGNVQFNESGFRHNYKIDIIEARVKES--LKTIGNWSTSHGLTSI------PRNKSDLTLVNFSKNRTLRVSSILVPPFLM--------RVKDKN----------GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGAL--VNDS----WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQG-GDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIK---YGVVDSGSSKEFFLNSKIEIFKKMWLFMESNPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKCKKQ 2777
            LK A  ++  + +   N+G  + +P  + +         EL  A+  +    G TG + FN  G R N    ++  R   S  +  +G +   H   SI      P N +      F  N  LRV +++  PF+         R  D +          G  +    GFC DL+  + + +NFTY++   +D  +G+L  VN S    WNGM+GE+++ +ADL+VA LTI + R   ++FS PF   GL+++ +K +++      F++P    +W+ +  +   V+V+L+L+ RF+P+       +    K      + ++ WFS    +  G G+ +PRS + R++G VW  F +IIV+SYTANLAA+L ++R    +   +D   +N  K   Y  V + SS + +   ++E+   M+ FME      VK    GI KV N + + AFI +S +  YY   + C  T  G  L    GYGI  P GS   ++I+LA+L   E   + ++ +  W + SKC  +
Sbjct:  277 LKDATVISATALQNLANAGKTLTTPTASCRETQQWSSGQELFNALVNVSLPRGTTGPIAFNSDGDRKNAVYRLMNRRQSSSDAVDVVGLYENGH--VSINESIIWPGNLNTTPTGVFLSNH-LRVVTLVGEPFVYVKPIPTSGRCSDLDTNTAKHVLCTGTVSDTDSGFCMDLLIRLGEKVNFTYSVSLSEDGSYGSLRRVNGSDTKQWNGMVGEVIQGKADLIVAALTINNERAEWIEFSKPFKYQGLTIL-VKKNEQSNSLDSFLRPFQIHLWLLVLLSVHIVAVILYLLDRFSPFG---RFKLARKEKEETALNLSSAMWFSWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPKAVVSGIDDPNLRNPSKQFIYATV-ANSSVDAYFRRQVEL-SSMYTFMEG---YNVKTAKEGIEKVKNGELK-AFIWDSPV-LYYEASKDCTLTTAG-ELFGRSGYGIGMPKGSPWSNAISLAILNFHESGVMEEL-ETTWIDASKCNTE 785          
BLAST of Glutamate receptor vs. Ensembl Medaka
Match: gria4a (glutamate receptor 4 [Source:NCBI gene;Acc:101163507])

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 316/798 (39.60%), Postives = 475/798 (59.52%), Query Frame = 3
Query:  417 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDI--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKD---KNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS------NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            P+ V +G +F  +     EYTAF L       S          V +VD+I  ++SF +  A C      V A+FG    R+V+T+ S   A  +  +T S    + +E      G+  ++LRP +  A++  +   +W R ++LYD++     L+ I E        +SA   +   S +D   + +     R  ++  ++DL+ E  ++ I+ Q   + K    YHY++  +  ++I     ++GG N T F  +D++ P++ + ++ +W  +  ++ Y  S +  +    L Y+  L++   E  +   +  +  +R   N+GD + +P   P     +++ A+ +++  GLTGN+QF+  G R NY +D+ E R     + IG W+    L  +    S L   +  +NRT+ V++I+  P++M  K+     G D  +FEG+C DL +EIAK +   Y I  V D ++GA   ++  WNGM+GEL+  +A++ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P E  ++        NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +DSGS+KEFF  SKI +++KMW +M+S  P VF K  + G+ +V  S+ +YAF+LES+MN+Y   ++PC+T KVG NLDS KGYGIATP GS LR+++NLAVL+L E+  + ++  +WW ++ +C
Sbjct:   30 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNATEAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVNTLTSFCGALHISLVTPS----FPTEGE----GQFTLQLRPSIRGALLSLLDHYDWNRFVFLYDTDRGYAILQAIMERAGQNAWQVSAICVE---SFNDAAYRRLLEDLDRRQERKYVIDLEPERLQS-ILDQAVSVGKHVKGYHYIIANLGFKDISLERFMHGGANVTGFQLVDFSKPIVIKLMQ-RW-NKLDQREYPGSESPPKYTSSLTYDGVLVM--AEAFRSLRRQKIDISR-RGNAGDCLANPAA-PWNQGIDMERALKQVRIQGLTGNIQFDHYGRRVNYTMDVFELR-SNGPRKIGYWNDIDKLVLVQNENSLLNDSSAMENRTVVVTTIMEGPYVMLKKNWELYEGND--QFEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHAEEPEEGATEPGPTDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDS-KGYGIATPKGSQLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGEC 803          
BLAST of Glutamate receptor vs. Ensembl Medaka
Match: gria4a (glutamate receptor 4 [Source:NCBI gene;Acc:101163507])

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 316/798 (39.60%), Postives = 475/798 (59.52%), Query Frame = 3
Query:  417 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDI--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKD---KNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS------NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            P+ V +G +F  +     EYTAF L       S          V +VD+I  ++SF +  A C      V A+FG    R+V+T+ S   A  +  +T S    + +E      G+  ++LRP +  A++  +   +W R ++LYD++     L+ I E        +SA   +   S +D   + +     R  ++  ++DL+ E  ++ I+ Q   + K    YHY++  +  ++I     ++GG N T F  +D++ P++ + ++ +W  +  ++ Y  S +  +    L Y+  L++   E  +   +  +  +R   N+GD + +P   P     +++ A+ +++  GLTGN+QF+  G R NY +D+ E R     + IG W+    L  +    S L   +  +NRT+ V++I+  P++M  K+     G D  +FEG+C DL +EIAK +   Y I  V D ++GA   ++  WNGM+GEL+  +A++ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P E  ++        NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +DSGS+KEFF  SKI +++KMW +M+S  P VF K  + G+ +V  S+ +YAF+LES+MN+Y   ++PC+T KVG NLDS KGYGIATP GS LR+++NLAVL+L E+  + ++  +WW ++ +C
Sbjct:   30 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNATEAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVNTLTSFCGALHISLVTPS----FPTEGE----GQFTLQLRPSIRGALLSLLDHYDWNRFVFLYDTDRGYAILQAIMERAGQNAWQVSAICVE---SFNDAAYRRLLEDLDRRQERKYVIDLEPERLQS-ILDQAVSVGKHVKGYHYIIANLGFKDISLERFMHGGANVTGFQLVDFSKPIVIKLMQ-RW-NKLDQREYPGSESPPKYTSSLTYDGVLVM--AEAFRSLRRQKIDISR-RGNAGDCLANPAA-PWNQGIDMERALKQVRIQGLTGNIQFDHYGRRVNYTMDVFELR-SNGPRKIGYWNDIDKLVLVQNENSLLNDSSAMENRTVVVTTIMEGPYVMLKKNWELYEGND--QFEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHAEEPEEGATEPGPTDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDS-KGYGIATPKGSQLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGEC 803          
BLAST of Glutamate receptor vs. Ensembl Medaka
Match: gria4a (glutamate receptor 4 [Source:NCBI gene;Acc:101163507])

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 316/798 (39.60%), Postives = 472/798 (59.15%), Query Frame = 3
Query:  417 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDI--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKD---KNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS------NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            P+ V +G +F  +     EYTAF L       S          V +VD+I  ++SF +  A C      V A+FG    R+V+T+ S   A  +  +T S    + +E      G+  ++LRP +  A++  +   +W R ++LYD++     L+ I E        +SA   +   S +D   + +     R  ++  ++DL+ E  ++ I+ Q   + K    YHY++  +  ++I     ++GG N T F  +D++ P++ + ++ +W  +  ++ Y  S +  +    L Y+  L++   E  +   +  +  +R   N+GD + +P   P     +++ A+ +++  GLTGN+QF+  G R NY +D+ E R     + IG W+    L  +    S L   +  +NRT+ V++I+  P++M  K+     G D  +FEG+C DL +EIAK +   Y I  V D ++GA   ++  WNGM+GEL+  +A++ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P E  ++        NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +DSGS+KEFF  SKI +++KMW +M+S  P VF K  + G+ +V  S+ +YAF+LES+MN+Y   ++PC+T KVG NLDS KGYGIATP GS LR  +NLAVL+L E   + ++  +WW ++ +C
Sbjct:   30 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNATEAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVNTLTSFCGALHISLVTPS----FPTEGE----GQFTLQLRPSIRGALLSLLDHYDWNRFVFLYDTDRGYAILQAIMERAGQNAWQVSAICVE---SFNDAAYRRLLEDLDRRQERKYVIDLEPERLQS-ILDQAVSVGKHVKGYHYIIANLGFKDISLERFMHGGANVTGFQLVDFSKPIVIKLMQ-RW-NKLDQREYPGSESPPKYTSSLTYDGVLVM--AEAFRSLRRQKIDISR-RGNAGDCLANPAA-PWNQGIDMERALKQVRIQGLTGNIQFDHYGRRVNYTMDVFELR-SNGPRKIGYWNDIDKLVLVQNENSLLNDSSAMENRTVVVTTIMEGPYVMLKKNWELYEGND--QFEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHAEEPEEGATEPGPTDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDS-KGYGIATPKGSQLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGEC 803          
BLAST of Glutamate receptor vs. Ensembl Medaka
Match: gria2b (glutamate ionotropic receptor AMPA type subunit 2 [Source:NCBI gene;Acc:101168274])

HSP 1 Score: 545.043 bits (1403), Expect = 6.370e-179
Identity = 303/751 (40.35%), Postives = 462/751 (61.52%), Query Frame = 3
Query:  561 DISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSA-DARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKS----TRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHG--LTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN-GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGV----DTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            ++++SF +    C      V A+FG    ++V+TI S      + +IT S          N++F   II++RP +   ++  I    W +  YLYDS+  L  L+++ +    ++  ++A +       + D   + + +  +   ++ +ILD + ++ K+ I+ Q+  + +    YHY++  +   +   S I  GG N + F  +D+++P++++F   +W  E+  +   P + +     K+ Y +AL  D ++++  A +   K     TR   N+GD + +P   P     E++ A+ +++  GLTGN+QF++ G R NY ++I+E +    +K IG W+      LT +    +D T +   +N+T+ V++IL  P++M  K+ +   D   +EG+C DL  EIAK   F Y +  V D ++GA   ++  WNGM+GEL+  +AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW      D  ++ +   +NEF IFNS WFSL AFM+QG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +DSGS+KEFF  SKI +F KMW +M S  P VFVK  + G+ +V  S+ +YA++LES+MN+Y   ++PC+T KVG NLDS KGYGIATP GS LR+++NLAVL+L E+  + ++  +WW ++ +C
Sbjct:   65 EVANSFAVTNCFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPS-----FPLDGNQQF---IIQMRPDIKGPLLSLIEYYKWDKFAYLYDSDRGLTTLQVVLDTAAEKKWQVTAINVGNLKDERKDEAYRSLFQDLENKKERRVILDCEQDKVKD-IMDQVITIGRHVKGYHYIIANLGFVDGDLSKIQYGGANVSGFQIVDFDDPLVSKF-DQRW--EALEEKEYPGADS-----KIRYTSALTYDAVQVMTEAFRYLHKQRIDFTR-RANTGDCLANPAV-PWAQGVEIERALKQVRVEGLTGNIQFDQHGKRVNYSVNIMELKNNGPVK-IGYWNEVDKMVLTKLGEPSNDTTGM---ENKTVIVTTILEAPYVMLKKNADLFVDNERYEGYCVDLAAEIAKHCGFKYQLKIVGDGKYGARDAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEYEDGQIQTNES-TNEFGIFNSLWFSLGAFMRQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIALFDKMWTYMRSAEPSVFVKTTAEGVQRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGEC 790          
BLAST of Glutamate receptor vs. Ensembl Medaka
Match: gria4b (glutamate receptor 4 [Source:NCBI gene;Acc:101175340])

HSP 1 Score: 542.347 bits (1396), Expect = 1.966e-178
Identity = 302/744 (40.59%), Postives = 450/744 (60.48%), Query Frame = 3
Query:  579 QMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSI---PRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKD---KNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE-VDSKVS----NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMES-NPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKC 2768
            Q+   +C      V A+FG    R+VHT+ S   A  +  IT S      S+ T        ++LRP +  A++  +   +W + ++LYD++     L+ I E        +SA   +   + +D   + +     R  +K  ++DL+ E  +N +++Q+  + K    YHY++  +  ++I     ++GG N T F  +D++NP++ + ++ +W  +  ++ Y  S    +    L Y+  +++   E  +   +  V  +R   N+GD + +P   P     +++  + +++  GLTGNVQF+  G R NY +D+ E +     + IG W+ +  L  I   P   +D T +   +NRT+ V++I+  P++M  K+     G D  ++EG+C DL +EIAK +   Y I  V D ++GA   ++  WNGM+GEL+  +A++ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P E  D + S    NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ  I YG +DSGS+KEFF  SKI +++KMW +M+S  P VF K  + G+ +V  S+ +YAF+LES+MN+Y   ++PC+T KVG NLDS KGYG+ATP GS LR  +NLAVL+L E   + ++  +WW ++ +C
Sbjct:   16 QLETLLCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFT--------LQLRPPIRGALLSLLDHYDWNKFVFLYDTDRGYAILQAIMEKAGQNNWQISAICVE---NFNDANYRRLLEDLDRRQEKKFVIDLEAERLQN-MLEQIVSVGKHVKGYHYIMANLGFKDINLERFMHGGANVTGFQLVDFSNPMVIKLMQ-RW-NKLDQREYPGSDAPPKYTSALTYDGVMVM--AEAFRNLRRQKVDISR-RGNAGDCLANPAA-PWNQGIDMERTLKQVRLQGLTGNVQFDHYGRRVNYTMDVFELK-NNGPRRIGYWNDADKLVLIQDSPLLPNDTTGI---ENRTVIVTTIMEGPYVMLKKNWEMYEGND--QYEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEEGTDGQPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTDIAYGTLDSGSTKEFFRRSKIAVYEKMWGYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDS-KGYGVATPKGSQLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGEC 734          
BLAST of Glutamate receptor vs. Planmine SMEST
Match: SMESG000073268.1 (SMESG000073268.1)

HSP 1 Score: 1649.8 bits (4271), Expect = 0.000e+0
Identity = 820/893 (91.83%), Postives = 852/893 (95.41%), Query Frame = 3
Query:  327 MEVRFGLLILSAILIPCQPEQLLRKRRQPIPNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMESNPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKCKKQVESNENSITKNSVRFDDXXXXXXXXXXXXXXXXXXXXXXXVYKCTLESKRKSKSFMVTFKELVDQSKKREQNYDDI 3005
            MEVRFGLLILSAILIPCQPEQLLRKRRQPIPNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVV+SGSSKEFF NS+IEIF+KMW FMESNP+VFV N+++G +KV  S+REYAFILESSMN+YYN  +PC TTK+G NLDSGKGYGIATPPGS+ RDSINLAVLELKEKN+IP+  + WW+N+S+C   V+S EN I++ SV+  DIRGLF LL GGLALG+ LS+ EL YKC LES+RK K F   F+ ++  S ++ Q   +I
Sbjct:    1 MEVRFGLLILSAILIPCQPEQLLRKRRQPIPNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKS-ENDISQTSVKLRDIRGLFYLLTGGLALGLMLSVFELFYKCALESRRKKKRFWSVFRIMMHHSVEKSQMNSEI 892          
BLAST of Glutamate receptor vs. Planmine SMEST
Match: SMESG000073268.1 (SMESG000073268.1)

HSP 1 Score: 1630.15 bits (4220), Expect = 0.000e+0
Identity = 787/830 (94.82%), Postives = 809/830 (97.47%), Query Frame = 3
Query:  327 MEVRFGLLILSAILIPCQPEQLLRKRRQPIPNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMESNPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKCKKQVESNENSITKNSV 2816
            MEVRFGLLILSAILIPCQPEQLLRKRRQPIPNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVV+SGSSKEFF NS+IEIF+KMW FMESNP+VFV N+++G +KV  S+REYAFILESSMN+YYN  +PC TTK+G NLDSGKGYGIATPPGS+ RDSINLAVLELKEKN+IP+  + WW+N+S+C   V+S EN I++ S 
Sbjct:    1 MEVRFGLLILSAILIPCQPEQLLRKRRQPIPNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKS-ENDISQTSA 829          
BLAST of Glutamate receptor vs. Planmine SMEST
Match: SMESG000073692.1 (SMESG000073692.1)

HSP 1 Score: 1110.52 bits (2871), Expect = 0.000e+0
Identity = 579/888 (65.20%), Postives = 696/888 (78.38%), Query Frame = 3
Query:  426 VLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDN--IIKTKVVYVDDISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQ---KLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIP-RNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDT-GEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWG---VDTPVEVDSKV--SNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMESNPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKCKKQVESNENSITKNSVRFDDXXXXXXXXXXXXXXXXXXXXXXXVYKCTLESKRKSKSFMVTFKELVDQSKKREQNYDDIHSFSKIKGESRVMFAI 3053
            + +GAIF   D NS  Y A+  K A     N  D+      K V+VDD SDSFQ++GAICQLLV   +A+ GPIH RT++ I+SLT+   ++Y+T SD H Y+SE+ + +    IIKLRP VA A+ DFI  + W R+LY+YDS +ALFRLRM+FE TN+   +L+ADAR +       ++ YI+ +SK+ ++K I+LDL  +ESK + + Q+     +R+D+HY++T  D  E+  S++I GG+NFT FS +DY N V+ EF++  W     +   +  S  S  L     L  +AALI+DG+ +LK+ L+ ++   +   +  D+ C+P TNPK+ A +L P   +I + GLTGNV FN +GFRH + ++I E+RVK++L  IGNW+  +GL  I    +  ++     +N+T  V+ ILVPPFL +VKD NGK   G++EGFC DL+ EIA+ +NF++ I +V+D  +G+LVN +WNGMIGEL+  +ADL VAPLTITSSRERVVDFSTPFMEFGLSVMFL+   + PE FGFMKPLS+DIWMCI +AYLGVSVVLF+VSRFNP+EW    +DT    + K+  SNEF+IFNSFWFSLSAFMQQGGD+SPRSL+GRIVGGVWWFFTLIIVSSYTANLAAYLTVERM++PIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMESNPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKCKKQVESNENSITKNSVRFDDIRGLFILLLGGLALGISLSILELVYKCTLESKRKSKSFMVTFKELVDQSKKREQNYDDIHSFSKIKGESRVMFAI
Sbjct:   32 ITIGAIFGGGDENSATYAAY--KWATMNSENLRDDRYFYNFKTVFVDDTSDSFQISGAICQLLVDSAVAIIGPIHRRTMNIIRSLTNHYDILYLTISDPHIYSSETEHSKKALKIIKLRPTVAEALADFIFEQKWSRMLYIYDSEDALFRLRMLFELTNANNYELNADARMFPNDAKTELINYIDVQSKKYAKKQIVLDLDNQESKRKTLDQLKNTISNRLDFHYVLTNSDFLELNHSYLIYGGVNFTAFSLIDYENDVVLEFLEKHWKNNIYKSHIKKESLFSDTLSFNDILQADAALIIDGIYVLKKVLQSSIPHQKPTQSISDEPCTPETNPKWTATQLLPKFYKIVYQGLTGNVSFNSTGFRHKFTLNIQESRVKQNLMKIGNWTQEYGLHRIDISAEHSISGQPLRRNKTRIVTGILVPPFLSKVKDSNGKPIPGKYEGFCVDLITEIARDVNFSFIIREVEDGAYGSLVNGTWNGMIGELISKKADLAVAPLTITSSRERVVDFSTPFMEFGLSVMFLQAQQKPPEIFGFMKPLSRDIWMCIAYAYLGVSVVLFMVSRFNPHEWSDKNMDTNDNKERKINTSNEFSIFNSFWFSLSAFMQQGGDLSPRSLSGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMSSPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMESNPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKCKKQVESNENSITKNSVRFDDIRGLFILLLGGLALGISLSILELVYKCTLESKRKSKSFMVTFKELVDQSKKREQNYDDIHSFSKIKGESRVMFAI 917          
BLAST of Glutamate receptor vs. Planmine SMEST
Match: SMESG000013939.1 (SMESG000013939.1)

HSP 1 Score: 432.565 bits (1111), Expect = 1.157e-135
Identity = 270/802 (33.67%), Postives = 434/802 (54.11%), Query Frame = 3
Query:  570 DSFQMAGAIC-QLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHH--YASESTNERFGKN-------IIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRR--IDLSADARQYS---FSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVT-----EMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKL--PYEAALIVDGLELLKRAL------KVAVKSTRFHTNSGDQV-CSPVTNP-----------KYCADELKPAITRIKF---------MGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFL-MRVKDKNGKDTG--EFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS------WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQN-KIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMESNPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKCKKQVESNENS 2798
            DS ++   IC Q  V +V+A+FG       + IQ + D  +++ I +    H  Y S+ TN +F K+       +I + P + +++VD++    W    Y+ ++ + L+RL+   +  +S++  ++L+ D R  S    +  D  L+ ++     + +K +++D+   ++ + I+ ++  +  +R +Y +++      E+D  E K S +   G    I     Y N       K  WL         P   NS+ L      YE AL+VD L++   A+       V+ K    + N  D   C  V  P           +Y  + +  ++ +I            GLTG ++F E+G R ++ + I++ ++++    IGNWS   G+  I      +      KN+T+RV +I + PFL ++   +N K  G   +EGFC DL+N  A  L F Y IH V D+ FG  +  +      WNG+IGE++   AD+VVAPLTI+ SR RVV FS PF+ FGLSV+  KP  ++   F F +PLS  +W C   A L VS  L++++R +PYEW ++ P +   K++ +FT FN  WFS++AF+QQG D++P+S   RI+  VWWFFTLI+++ YTANLAA+LT+  M  PI  + DL      I+YG ++SGS+K FF+ + +E F+ M LFM+ NP VF K I  G+ KV +S+  YAF+LES MN+Y+N + PC+T  VG+      GYGIATP    L ++I  A+L+L+EK ++ ++ K+WW  + +C     +N NS
Sbjct:   70 DSTEVMSKICNQTSVEKVVAIFGN---NLSYIIQEIRDLTQILQIPFFTTDHVIYESDKTN-KFSKSFKPKTNYLIHMHPPILDSMVDYLIKHEWYTFSYICNTGQGLYRLQNTIKIIHSKKDYVELNVDVRYISDPRLATKD--LRNLDAYLSSHHEKRVLIDIDTPKNLDLILHRIVLMGMNRPEYQFVILTASMDEIDLTEFKYSGVEIIGFKILIDQSQKYFN------FKKIWL---------PWINNSRPLMSSYSMYEVALMVDALQIFTSAMDRIIENPVSRKHLLSYLNKEDTTNCYTVRTPGRRKIIGYHNRRY--EIINSSLGQIILEKILNENYQSGLTGTLKFEENGLRKDFSVQILKVKLEKGPVKIGNWSMKKGVV-IDNLYEKVYTKEMIKNQTVRVVTIALKPFLQLKTPKENEKLEGNERYEGFCVDLLNLTASFLGFKYEIHLVNDNSFGVKIGQNPNGTEIWNGLIGEILNGTADMVVAPLTISLSRARVVHFSEPFLTFGLSVIIKKPGKKKAGIFSFFRPLSYPVWGCYFAACLVVSCGLYIIARMSPYEWNINNPYDPHQKITRDFTFFNCVWFSIAAFVQQGVDVAPKSPGARILSSVWWFFTLIMIAYYTANLAAFLTISLMIPPINDWPDLVSPGVGIEYGTINSGSTKNFFMTTNLEPFRTMGLFMKQNPHVFRKTIEEGVKKVRSSKGNYAFLLESRMNEYFNNRYPCDTMMVGTPYGD-NGYGIATPKNYSLNENITDAILKLREKQELTKLYKKWWIEKGECNDD-NANSNS 845          
BLAST of Glutamate receptor vs. Planmine SMEST
Match: SMESG000014610.1 (SMESG000014610.1)

HSP 1 Score: 427.557 bits (1098), Expect = 6.595e-134
Identity = 263/772 (34.07%), Postives = 420/772 (54.40%), Query Frame = 3
Query:  594 IC-QLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGK--NIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRR--IDLSADARQYS---FSQSDGVLQYINRKSKRNSQ-KHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLEL-------------LKRAL-----------KVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGK---DTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALV------NDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDS-KVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQN-KIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMESNPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKCKKQ 2777
            IC Q    ++IA FG         I  ++    L +   +D  +Y   S N+   K   I +L     + +V+F+  + W    Y+ +  + L RL+ + E  +SR+  I+L+ D R  S    +  D  L+ +N      SQ K I++D+  +E+   ++ ++  +  +R +Y+Y++T ++  ++  +     G+N T F  ++        F  ++W ++S        STN + +     +AAL+ D ++L             L++AL           ++  K   +   SG       T  K  A+ +   ++  +  GLTGN++F + G+R N+ +  +   +   L  IG+W+   GL    R+ + +T V   KN+T+RV SI+ PPFL   + KNG+       FEGFC D++N+ A+ML F Y+IH V D+ FG ++       + WNG++GE++   AD+ VAPLTI  +R RVV FS P++ FG+SVM  KP  + P  F FM+PL+ ++W     A L VS  L++++R +PYEW +    E D  ++   FT +NS WFS +A +QQG D++P+S   RI+  VWWFFTLI+ + YTANL A+LT+  M  PI  + DL K    I++G +DSGS+KEFFL + +E F++M + M+ NP VF K +  G+ +V+ S+ +YAF+LES MN+YYN +EPCET  VGS     KGYGIAT     ++D IN AVL+L+E   +  + K WW  +  C  +
Sbjct:   71 ICEQASHHKLIAFFGGNFSYVSQDINDISSILNLPFFI-TDDRNYKFTSFNQSLRKPNYIFQLSFPTTDPLVEFLIQQKWVTFSYICNCGQCLHRLQRLIEKIHSRKDYIELNVDVRYISDVRLASKD--LRNLNAYLDSVSQHKRILIDMDTQENLELLLYRIVLMGMNRPEYYYVITNVELEDLDLTDFKYSGVNITGFKIINREEKAFRSF-HNEWNSQSK-------STNLRTVT----QAALMQDAMDLFTGTIEKMLQSPSLRKALLNPNYMNCYTLRMPDKRKIYGYQSGTYEIKRSTVGKMIAEAI---LSGTRKEGLTGNIEFTDQGYRKNFNVTFMTMEMDVGLIPIGHWNDKVGLNLSNRDGNKVT-VEMIKNQTIRVVSIISPPFLQLKQPKNGETLEGNDRFEGFCVDMLNQTAQMLGFKYSIHLVNDNSFGQVIRYLSNKTEIWNGIVGEILNGTADMAVAPLTINLARARVVSFSEPYLTFGISVMIKKPGRKNPGIFSFMRPLADNVWGSYFAACLIVSCGLYVITRLSPYEW-ITYETETDGVRIKRNFTFYNSVWFSFAALVQQGVDLAPKSPGARILSSVWWFFTLIMTAYYTANLVAFLTISLMITPINDFGDLIKPGIGIEFGSLDSGSTKEFFLTTSLEPFRQMGIIMKRNPMVFTKTVDEGVKRVLKSKGKYAFLLESRMNEYYNNREPCETMVVGSPFGD-KGYGIATSLDYPMKDEINDAVLKLRENQYLDTLYKHWWIQKGGCSDE 821          
The following BLAST results are available for this feature:
BLAST of Glutamate receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIA10.000e+039.10glutamate ionotropic receptor AMPA type subunit 1 ... [more]
GRIA10.000e+039.10glutamate ionotropic receptor AMPA type subunit 1 ... [more]
GRIA40.000e+039.16glutamate ionotropic receptor AMPA type subunit 4 ... [more]
GRIA40.000e+039.16glutamate ionotropic receptor AMPA type subunit 4 ... [more]
GRIA14.537e-18040.27glutamate ionotropic receptor AMPA type subunit 1 ... [more]
back to top
BLAST of Glutamate receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glr-11.072e-13633.63Glutamate receptor 1 [Source:UniProtKB/Swiss-Prot... [more]
glr-29.933e-12434.90Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot... [more]
glr-21.961e-11135.01Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot... [more]
glr-34.758e-10832.84GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-44.961e-9941.48GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
back to top
BLAST of Glutamate receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GluRIA4.707e-14833.82gene:FBgn0004619 transcript:FBtr0076982[more]
KaiR1D4.544e-14334.21gene:FBgn0038837 transcript:FBtr0083987[more]
CG111557.760e-12634.72gene:FBgn0039927 transcript:FBtr0333701[more]
CG111557.760e-12634.72gene:FBgn0039927 transcript:FBtr0089195[more]
Ekar9.699e-11933.58gene:FBgn0039916 transcript:FBtr0110906[more]
back to top
BLAST of Glutamate receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gria4a0.000e+039.27glutamate receptor, ionotropic, AMPA 4a [Source:ZF... [more]
gria4b2.962e-18039.17glutamate receptor, ionotropic, AMPA 4b [Source:ZF... [more]
gria4b1.999e-17939.15glutamate receptor, ionotropic, AMPA 4b [Source:ZF... [more]
gria4b1.999e-17939.15glutamate receptor, ionotropic, AMPA 4b [Source:ZF... [more]
gria2a3.767e-17838.32glutamate receptor, ionotropic, AMPA 2a [Source:ZF... [more]
back to top
BLAST of Glutamate receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf3ip20.000e+039.58TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB... [more]
traf3ip20.000e+040.90TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB... [more]
traf3ip20.000e+040.50TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB... [more]
traf3ip20.000e+040.84TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB... [more]
traf3ip21.731e-17941.01TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of Glutamate receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gria10.000e+039.22glutamate receptor, ionotropic, AMPA1 (alpha 1) [S... [more]
Gria10.000e+039.22glutamate receptor, ionotropic, AMPA1 (alpha 1) [S... [more]
Gria40.000e+039.28glutamate receptor, ionotropic, AMPA4 (alpha 4) [S... [more]
Gria40.000e+039.28glutamate receptor, ionotropic, AMPA4 (alpha 4) [S... [more]
Gria41.284e-18039.28glutamate receptor, ionotropic, AMPA4 (alpha 4) [S... [more]
back to top
BLAST of Glutamate receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P19490|GRIA1_RAT0.000e+039.35Glutamate receptor 1 OS=Rattus norvegicus OX=10116... [more]
sp|P23818|GRIA1_MOUSE0.000e+039.22Glutamate receptor 1 OS=Mus musculus OX=10090 GN=G... [more]
sp|Q38PU8|GRIA1_MACFA0.000e+039.10Glutamate receptor 1 OS=Macaca fascicularis OX=954... [more]
sp|P42261|GRIA1_HUMAN0.000e+039.10Glutamate receptor 1 OS=Homo sapiens OX=9606 GN=GR... [more]
sp|Q9Z2W8|GRIA4_MOUSE8.983e-18039.28Glutamate receptor 4 OS=Mus musculus OX=10090 GN=G... [more]
back to top
BLAST of Glutamate receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GZ970.000e+046.08Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A158R8F80.000e+043.96Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A267ENE60.000e+044.16Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267FKB20.000e+044.06Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267F5K30.000e+045.04Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Glutamate receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gria4a1.778e-18039.38glutamate receptor, ionotropic, AMPA 4a [Source:ZF... [more]
gria4b1.413e-17939.60glutamate receptor 4 [Source:NCBI gene;Acc:1030350... [more]
GRIA23.817e-17839.61glutamate ionotropic receptor AMPA type subunit 2 ... [more]
GRIA23.829e-17840.00glutamate ionotropic receptor AMPA type subunit 2 ... [more]
gria2a1.137e-17738.40glutamate receptor 2-like [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Glutamate receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gria1b2.382e-13651.71glutamate receptor, ionotropic, AMPA 1b [Source:ZF... [more]
ENSPMAT00000005084.17.880e-10351.45pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 ... [more]
ENSPMAT00000002503.11.720e-5650.00pep scaffold:Pmarinus_7.0:GL492163:1:1446:1 gene:E... [more]
GRIA43.025e-4924.35glutamate ionotropic receptor AMPA type subunit 4 ... [more]
ENSPMAT00000000621.12.128e-3836.89pep scaffold:Pmarinus_7.0:GL479810:19620:30867:-1 ... [more]
back to top
BLAST of Glutamate receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamate receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO412911.473e-7938.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466335.559e-6529.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302037.423e-6429.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412931.957e-5336.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355451.022e-5029.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutamate receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gria4a0.000e+039.60glutamate receptor 4 [Source:NCBI gene;Acc:1011635... [more]
gria4a0.000e+039.60glutamate receptor 4 [Source:NCBI gene;Acc:1011635... [more]
gria4a0.000e+039.60glutamate receptor 4 [Source:NCBI gene;Acc:1011635... [more]
gria2b6.370e-17940.35glutamate ionotropic receptor AMPA type subunit 2 ... [more]
gria4b1.966e-17840.59glutamate receptor 4 [Source:NCBI gene;Acc:1011753... [more]
back to top
BLAST of Glutamate receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073268.10.000e+091.83SMESG000073268.1[more]
SMESG000073268.10.000e+094.82SMESG000073268.1[more]
SMESG000073692.10.000e+065.20SMESG000073692.1[more]
SMESG000013939.11.157e-13533.67SMESG000013939.1[more]
SMESG000014610.16.595e-13434.07SMESG000014610.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019712 ID=SMED30019712|Name=Glutamate receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=3101bp
ATTGAAATACAAATTATATTAAACAGAGATTACATCTTTATTCTTTTTCA
ACAATTTCAATTTTACTGCAAGTTGCTATTTTTGTTTATTTTAGTGGATG
TTAAAATAATTTCAAACAATTCCAAGTGCGCTCAGATCGAAGCTGTAGTA
TTAACAGAGAAAAATTGTTAAATGATTGAATCAGAAATATTACGTATCTG
CTGACATTAAACTAATGAAACATCAATAAAGTGGATAGGAAAATTTTGCT
GTCTTTACAAATAACAAATCAAGATGAGATTGAGTCGTTTTGAAGTACAA
GAAATCGTTAAATATTGATTTTTTCTATGGAAGTTCGGTTTGGATTGCTT
ATCTTATCGGCCATATTGATACCATGTCAACCAGAACAATTGCTGAGAAA
ACGTCGACAACCAATACCGAATATCGTCCTTGTTGGTGCTATTTTCGATT
CCTTGGATAGAAACTCACCTGAATACACTGCATTTAATCTAAAAAGTGCA
GGAAAAACATTCAGCAATGCGGAAGACAACATTATTAAGACTAAAGTGGT
ATATGTCGACGATATATCAGATAGTTTTCAAATGGCTGGAGCAATTTGTC
AACTTTTAGTAAGTGAAGTAATAGCCGTTTTCGGGCCAATTCATCCAAGA
ACAGTTCATACTATACAAAGTTTAACAGATGCCAACCGTTTGATATACAT
TACATACAGCGATGCTCATCATTATGCTAGTGAAAGCACAAACGAAAGAT
TCGGAAAGAATATCATTAAATTGCGACCATTAGTTGCAAATGCTGTGGTA
GATTTCATTCATTCAGAAAATTGGCAAAGGATTCTTTACCTATATGATTC
TAATGAAGCTTTATTTCGATTACGAATGATATTTGAGCATACAAATTCAA
GACGGATTGATCTAAGTGCCGATGCTAGGCAGTATTCCTTCAGTCAGTCT
GATGGAGTTTTGCAGTATATAAATCGTAAAAGCAAAAGAAATTCTCAGAA
ACATATAATTTTGGATTTAAAGGGAGAAGAATCCAAAAATAGAATCATTC
AACAAATGGATGAGTTGAAAAAAGATAGAGTTGATTATCATTATCTTGTT
ACTGAAATGGATGCCAGAGAAATTAAAAGTTCTTTCATTATCAATGGAGG
CATGAATTTCACTATATTTTCCCCATTGGATTATAATAACCCAGTTCTTA
ATGAGTTTATCAAATCTCAGTGGCTCACAGAAAGCAGTAGAAAATCATAT
CAACCTTCATCCACTAATTCTCAACGATTACAAAAATTGCCATATGAAGC
AGCGTTAATAGTTGACGGTCTTGAATTACTAAAAAGAGCTTTGAAAGTCG
CCGTAAAGAGTACGCGCTTTCACACAAATTCCGGAGACCAGGTTTGCAGT
CCAGTGACCAATCCAAAATACTGTGCTGATGAATTAAAACCAGCCATAAC
AAGAATAAAATTTATGGGACTAACGGGTAATGTTCAATTTAACGAATCCG
GTTTTAGGCACAATTACAAAATTGATATAATCGAAGCAAGAGTTAAGGAA
TCTTTAAAAACGATCGGAAATTGGAGTACGAGCCATGGTTTAACATCCAT
CCCAAGAAATAAATCAGATCTTACATTAGTCAATTTCTCTAAGAATCGAA
CTTTGCGAGTTTCCAGTATTCTTGTTCCTCCATTTCTTATGAGAGTCAAA
GATAAAAATGGAAAAGATACCGGAGAATTCGAAGGGTTTTGCAAAGATTT
AGTGAATGAAATCGCAAAAATGTTGAATTTTACTTATACAATTCATCAAG
TGAAAGATGACCAATTTGGGGCTTTGGTCAATGACAGCTGGAATGGTATG
ATTGGAGAGTTGATGCGTAATGAAGCCGATTTGGTAGTAGCTCCTTTAAC
AATTACATCAAGTAGAGAAAGAGTGGTCGATTTTTCAACTCCATTTATGG
AATTCGGACTTAGTGTCATGTTTTTAAAACCAGATGATCGTGAGCCAGAA
GCTTTCGGATTCATGAAACCACTCAGCAAGGACATTTGGATGTGCATTAC
CTTTGCCTACTTAGGTGTCAGTGTTGTTTTGTTTTTAGTGAGTCGCTTTA
ATCCGTATGAATGGGGAGTTGACACCCCTGTCGAGGTTGATTCAAAAGTA
TCGAATGAATTTACTATTTTTAATAGTTTTTGGTTTTCTCTTAGTGCATT
TATGCAACAAGGCGGAGATATTTCTCCTAGATCGTTAGCTGGGAGAATAG
TTGGCGGTGTTTGGTGGTTTTTCACGCTGATAATTGTCAGCTCATACACC
GCAAACCTAGCCGCATATCTTACGGTTGAGAGAATGAATAACCCCATAAA
ATCTTATGAAGATTTAGCTAAACAAAATAAAATTAAATATGGTGTTGTAG
ACTCAGGATCTTCTAAAGAATTTTTTTTGAATTCAAAAATCGAGATTTTT
AAAAAAATGTGGTTGTTTATGGAATCAAATCCTGAAGTTTTTGTTAAAAA
TATTTCTATGGGAATCAACAAAGTCATCAACTCACAAAGAGAATATGCGT
TTATTTTAGAGTCTTCCATGAATGATTATTATAATCTTCAAGAACCATGT
GAAACGACAAAAGTTGGTTCAAATCTAGATAGTGGAAAGGGATATGGAAT
AGCAACTCCACCTGGGTCGGATTTAAGAGATTCGATTAATTTGGCAGTTC
TGGAATTAAAAGAAAAAAATAAAATTCCTCAAATGATTAAACAATGGTGG
GAAAACCAGTCAAAGTGTAAAAAGCAAGTTGAATCAAACGAAAATTCAAT
AACAAAAAATTCCGTTAGATTTGATGATATCCGAGGACTGTTTATTCTTT
TACTTGGAGGACTCGCTTTAGGAATTTCTCTTTCTATACTCGAATTAGTA
TATAAATGCACTCTTGAATCAAAACGGAAAAGTAAATCTTTTATGGTTAC
TTTTAAAGAATTGGTAGACCAGTCTAAAAAACGAGAACAGAATTATGATG
ACATCCACTCGTTTTCTAAGATCAAAGGTGAATCCAGAGTGATGTTTGCC
ATATAAATAAACCAAAATGTAGTGTAGTTTTTTAAATTTATAGTTTAAAT
A
back to top

protein sequence of SMED30019712-orf-1

>SMED30019712-orf-1 ID=SMED30019712-orf-1|Name=SMED30019712-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=910bp
MEVRFGLLILSAILIPCQPEQLLRKRRQPIPNIVLVGAIFDSLDRNSPEY
TAFNLKSAGKTFSNAEDNIIKTKVVYVDDISDSFQMAGAICQLLVSEVIA
VFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLR
PLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADA
RQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKD
RVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWL
TESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHT
NSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKID
IIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILV
PPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGAL
VNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFL
KPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDT
PVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFT
LIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVDSGSSKEFF
LNSKIEIFKKMWLFMESNPEVFVKNISMGINKVINSQREYAFILESSMND
YYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKI
PQMIKQWWENQSKCKKQVESNENSITKNSVRFDDIRGLFILLLGGLALGI
SLSILELVYKCTLESKRKSKSFMVTFKELVDQSKKREQNYDDIHSFSKIK
GESRVMFAI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015276ligand-gated ion channel activity
GO:0038023signaling receptor activity
GO:0005216ion channel activity
GO:0004872receptor activity
GO:0004970ionotropic glutamate receptor activity
GO:0005234extracellular-glutamate-gated ion channel activity
GO:0001965G-protein alpha-subunit binding
GO:0004971AMPA glutamate receptor activity
GO:0005515protein binding
GO:0008179adenylate cyclase binding
GO:0019901protein kinase binding
GO:0019904protein domain specific binding
GO:0030165PDZ domain binding
GO:0031267small GTPase binding
GO:0031489myosin V binding
GO:0031681G-protein beta-subunit binding
GO:0031698beta-2 adrenergic receptor binding
GO:0042802identical protein binding
GO:0042803protein homodimerization activity
GO:0051018protein kinase A binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001508Iono_rcpt_met
IPR001320Iontro_rcpt
IPR019594Glu/Gly-bd
IPR001828ANF_lig-bd_rcpt
IPR028082Peripla_BP_I
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005769early endosome
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0005829cytosol
GO:0005886plasma membrane
GO:0008328ionotropic glutamate receptor complex
GO:0009986cell surface
GO:0014069postsynaptic density
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0030425dendrite
GO:0031594neuromuscular junction
GO:0032279asymmetric synapse
GO:0032281AMPA glutamate receptor complex
GO:0042995cell projection
GO:0043005neuron projection
GO:0043025neuronal cell body
GO:0043197dendritic spine
GO:0043198dendritic shaft
GO:0043234protein complex
GO:0044309neuron spine
GO:0045202synapse
GO:0045211postsynaptic membrane
GO:0060076excitatory synapse
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0001919regulation of receptor recycling
GO:0006810transport
GO:0007616long-term memory
GO:0009636response to toxic substance
GO:0010226response to lithium ion
GO:0014070response to organic cyclic compound
GO:0019228neuronal action potential
GO:0021510spinal cord development
GO:0031623receptor internalization
GO:0032355response to estradiol
GO:0034220ion transmembrane transport
GO:0035235ionotropic glutamate receptor signaling pathway
GO:0035249synaptic transmission, glutamatergic
GO:0042220response to cocaine
GO:0042493response to drug
GO:0043434response to peptide hormone
GO:0045838positive regulation of membrane potential
GO:0046685response to arsenic-containing substance
GO:0048167regulation of synaptic plasticity
GO:0050804modulation of synaptic transmission
GO:0050806positive regulation of synaptic transmission
GO:0051602response to electrical stimulus
GO:0060079excitatory postsynaptic potential
GO:0060992response to fungicide
GO:0071230cellular response to amino acid stimulus
GO:0071359cellular response to dsRNA
GO:0071363cellular response to growth factor stimulus
GO:0071375cellular response to peptide hormone stimulus
GO:0071407cellular response to organic cyclic compound
GO:0071418cellular response to amine stimulus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001508Ionotropic glutamate receptor, metazoaPRINTSPR00177NMDARECEPTORcoord: 570..595
score: 30.77
coord: 641..668
score: 60.71
coord: 485..513
score: 27.59
IPR001320Ionotropic glutamate receptorSMARTSM00079GluR_14coord: 442..634
e-value: 1.9E-14
score: 64.0
IPR001320Ionotropic glutamate receptorPFAMPF00060Lig_chancoord: 567..685
e-value: 4.1E-48
score: 163.0
IPR019594Ionotropic glutamate receptor, L-glutamate and glycine-binding domainSMARTSM00918Lig_chan_Glu_bd_2coord: 452..514
e-value: 2.7E-24
score: 96.7
IPR019594Ionotropic glutamate receptor, L-glutamate and glycine-binding domainPFAMPF10613Lig_chan-Glu_bdcoord: 442..552
e-value: 1.8E-38
score: 131.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 149..417
e-value: 3.4E-69
score: 235.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 37..395
e-value: 3.4E-69
score: 235.9
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 558..704
e-value: 6.6E-56
score: 190.5
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 438..557
e-value: 4.1E-39
score: 135.6
NoneNo IPR availablePANTHERPTHR18966IONOTROPIC GLUTAMATE RECEPTORcoord: 94..702
NoneNo IPR availablePANTHERPTHR18966:SF157GLUTAMATE RECEPTOR 1coord: 94..702
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.588
NoneNo IPR availableSUPERFAMILYSSF53850Periplasmic binding protein-like IIcoord: 439..703
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 568..669
NoneNo IPR availableTMHMMTMhelixcoord: 645..667
NoneNo IPR availableTMHMMTMhelixcoord: 570..589
IPR001828Receptor, ligand binding regionPFAMPF01094ANF_receptorcoord: 75..404
e-value: 1.6E-30
score: 106.4
IPR028082Periplasmic binding protein-like ISUPERFAMILYSSF53822Periplasmic binding protein-like Icoord: 73..427