1,4-alpha-glucan-branching enzyme

Overview
Name1,4-alpha-glucan-branching enzyme
Smed IDSMED30019711
Length (bp)1185
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 1,4-alpha-glucan-branching enzyme (SMED30019711) t-SNE clustered cells

Violin plots show distribution of expression levels for 1,4-alpha-glucan-branching enzyme (SMED30019711) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 1,4-alpha-glucan-branching enzyme (SMED30019711) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 1,4-alpha-glucan-branching enzyme (SMED30019711) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019711

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30019711SMESG000060455.1 dd_Smed_v4_2161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019711SMESG000060455.1 dd_Smed_v4_2161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019711SMESG000060455.1 dd_Smed_v4_2161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Human
Match: GBE1 (1,4-alpha-glucan branching enzyme 1 [Source:HGNC Symbol;Acc:HGNC:4180])

HSP 1 Score: 209.92 bits (533), Expect = 5.255e-61
Identity = 93/161 (57.76%), Postives = 123/161 (76.40%), Query Frame = 1
Query:  451 YPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFAKI 933
            + GNEFGHPEWLDFPR+GN  SYHYARRQ++L DD +L+YKFLNNFDR MN  EE++ WLAAPQAYVS K+EG+K+IA+ERAG+LF+FNFHP+ S+T Y++G   PG ++IVL+SD   +GG  RLD S  F ++    + R   L +Y+PSR A++   +
Sbjct:  497 FMGNEFGHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLNNFDRDMNRLEERYGWLAAPQAYVSEKHEGNKIIAFERAGLLFIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAEYGGHQRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNV 657          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Human
Match: GBE1 (1,4-alpha-glucan branching enzyme 1 [Source:HGNC Symbol;Acc:HGNC:4180])

HSP 1 Score: 209.534 bits (532), Expect = 1.082e-60
Identity = 93/159 (58.49%), Postives = 122/159 (76.73%), Query Frame = 1
Query:  457 GNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFAKI 933
            GNEFGHPEWLDFPR+GN  SYHYARRQ++L DD +L+YKFLNNFDR MN  EE++ WLAAPQAYVS K+EG+K+IA+ERAG+LF+FNFHP+ S+T Y++G   PG ++IVL+SD   +GG  RLD S  F ++    + R   L +Y+PSR A++   +
Sbjct:  540 GNEFGHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLNNFDRDMNRLEERYGWLAAPQAYVSEKHEGNKIIAFERAGLLFIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAEYGGHQRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNV 698          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Celegans
Match: T04A8.7 (Alpha-amylase [Source:UniProtKB/TrEMBL;Acc:Q86G92])

HSP 1 Score: 187.963 bits (476), Expect = 1.246e-53
Identity = 91/160 (56.88%), Postives = 112/160 (70.00%), Query Frame = 1
Query:  451 YPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFAK 930
            + GNEFGHPEWLDFPR GNG S+HYARRQ+NLVD   L+YKFLNN+DR M   EE+  +L    AY S K++GDK I +ER G++FV N HPT SF  Y IGV+TPG Y I LNSD   FGG +R+D S+KF T  + +  R + L +Y+  RTAIV  K
Sbjct:  444 FIGNEFGHPEWLDFPRVGNGESFHYARRQFNLVDAEYLRYKFLNNWDREMMLLEERTGFLHKGYAYTSWKHDGDKTIVFERGGLVFVINLHPTKSFADYSIGVNTPGRYRIALNSDESKFGGHNRIDNSIKFHTTDDGYAGRRHRLQVYITCRTAIVLEK 603          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Celegans
Match: T04A8.7 (Alpha-amylase [Source:UniProtKB/TrEMBL;Acc:Q86G92])

HSP 1 Score: 187.578 bits (475), Expect = 4.055e-53
Identity = 91/158 (57.59%), Postives = 111/158 (70.25%), Query Frame = 1
Query:  457 GNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFAK 930
            GNEFGHPEWLDFPR GNG S+HYARRQ+NLVD   L+YKFLNN+DR M   EE+  +L    AY S K++GDK I +ER G++FV N HPT SF  Y IGV+TPG Y I LNSD   FGG +R+D S+KF T  + +  R + L +Y+  RTAIV  K
Sbjct:  521 GNEFGHPEWLDFPRVGNGESFHYARRQFNLVDAEYLRYKFLNNWDREMMLLEERTGFLHKGYAYTSWKHDGDKTIVFERGGLVFVINLHPTKSFADYSIGVNTPGRYRIALNSDESKFGGHNRIDNSIKFHTTDDGYAGRRHRLQVYITCRTAIVLEK 678          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Fly
Match: AGBE (gene:FBgn0053138 transcript:FBtr0087732)

HSP 1 Score: 212.231 bits (539), Expect = 5.312e-62
Identity = 97/165 (58.79%), Postives = 128/165 (77.58%), Query Frame = 1
Query:  442 YKFYPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFAKIK 936
            Y  + GNEFGHPEWLDFPR GN +SYHYARRQWNLVDD +LKYK+LN FDRAMN  EE++ WL +  A+VS K+EGDK+IA+ERAG++FVFNFHP  SFT Y++G +  GTY+ VL+SD+  FGG +R+D + K  +  E +  R+N + +Y PSRTA+V+A++ 
Sbjct:  520 YLNFMGNEFGHPEWLDFPRVGNNDSYHYARRQWNLVDDDLLKYKYLNEFDRAMNEAEERYGWLHSGPAWVSWKHEGDKIIAFERAGLVFVFNFHPQQSFTGYRVGTNWAGTYQAVLSSDDPLFGGHNRIDANCKHPSNPEGYAGRSNFIEVYTPSRTAVVYARVS 684          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Zebrafish
Match: gbe1a (glucan (1,4-alpha-), branching enzyme 1a [Source:ZFIN;Acc:ZDB-GENE-110411-171])

HSP 1 Score: 179.874 bits (455), Expect = 3.196e-50
Identity = 83/159 (52.20%), Postives = 112/159 (70.44%), Query Frame = 1
Query:  451 YPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFA 927
            + GNEFGHPEWLDFPR+GN  SY+YARRQ+NLVD   L+Y+ L  FDR MN TE+K+ WL A QA V+  N+ DKVI +ERA +LF+FNFHP NS+T Y++  +  G Y+I LNSD   +GG  RL +  +F T+   ++ R+    +Y+P RTA++ A
Sbjct:  488 FMGNEFGHPEWLDFPRKGNNESYYYARRQFNLVDTEHLRYRQLYAFDRDMNLTEDKYSWLTAAQAAVTTLNQDDKVIVFERANLLFIFNFHPCNSYTDYRVAAEHAGKYKIKLNSDEVQYGGHGRLLQDTEFFTEPMTFNGRDQSFQIYIPCRTALILA 646          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Zebrafish
Match: gbe1a (glucan (1,4-alpha-), branching enzyme 1a [Source:ZFIN;Acc:ZDB-GENE-110411-171])

HSP 1 Score: 179.874 bits (455), Expect = 5.759e-50
Identity = 83/159 (52.20%), Postives = 112/159 (70.44%), Query Frame = 1
Query:  451 YPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFA 927
            + GNEFGHPEWLDFPR+GN  SY+YARRQ+NLVD   L+Y+ L  FDR MN TE+K+ WL A QA V+  N+ DKVI +ERA +LF+FNFHP NS+T Y++  +  G Y+I LNSD   +GG  RL +  +F T+   ++ R+    +Y+P RTA++ A
Sbjct:  522 FMGNEFGHPEWLDFPRKGNNESYYYARRQFNLVDTEHLRYRQLYAFDRDMNLTEDKYSWLTAAQAAVTTLNQDDKVIVFERANLLFIFNFHPCNSYTDYRVAAEHAGKYKIKLNSDEVQYGGHGRLLQDTEFFTEPMTFNGRDQSFQIYIPCRTALILA 680          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Zebrafish
Match: gbe1a (glucan (1,4-alpha-), branching enzyme 1a [Source:ZFIN;Acc:ZDB-GENE-110411-171])

HSP 1 Score: 179.489 bits (454), Expect = 6.053e-50
Identity = 83/159 (52.20%), Postives = 112/159 (70.44%), Query Frame = 1
Query:  451 YPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFA 927
            + GNEFGHPEWLDFPR+GN  SY+YARRQ+NLVD   L+Y+ L  FDR MN TE+K+ WL A QA V+  N+ DKVI +ERA +LF+FNFHP NS+T Y++  +  G Y+I LNSD   +GG  RL +  +F T+   ++ R+    +Y+P RTA++ A
Sbjct:  521 FMGNEFGHPEWLDFPRKGNNESYYYARRQFNLVDTEHLRYRQLYAFDRDMNLTEDKYSWLTAAQAAVTTLNQDDKVIVFERANLLFIFNFHPCNSYTDYRVAAEHAGKYKIKLNSDEVQYGGHGRLLQDTEFFTEPMTFNGRDQSFQIYIPCRTALILA 679          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Zebrafish
Match: gbe1a (glucan (1,4-alpha-), branching enzyme 1a [Source:ZFIN;Acc:ZDB-GENE-110411-171])

HSP 1 Score: 168.703 bits (426), Expect = 2.336e-47
Identity = 80/156 (51.28%), Postives = 107/156 (68.59%), Query Frame = 1
Query:  451 YPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAI 918
            + GNEFGHPEWLDFPR+GN  SY+YARRQ+NLVD   L+Y+ L  FDR MN TE+K+ WL A QA V+  N+ DKVI +ERA +LF+FNFHP NS+T Y++  +  G Y+I LNSD   +GG  RL +  +F T+   ++ R+    +   S TA+
Sbjct:  301 FMGNEFGHPEWLDFPRKGNNESYYYARRQFNLVDTEHLRYRQLYAFDRDMNLTEDKYSWLTAAQAAVTTLNQDDKVIVFERANLLFIFNFHPCNSYTDYRVAAEHAGKYKIKLNSDEVQYGGHGRLLQDTEFFTEPMTFNGRDQSFQVSFVSTTAL 456          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Zebrafish
Match: gbe1b (glucan (1,4-alpha-), branching enzyme 1b [Source:ZFIN;Acc:ZDB-GENE-110914-16])

HSP 1 Score: 167.162 bits (422), Expect = 1.784e-45
Identity = 83/156 (53.21%), Postives = 106/156 (67.95%), Query Frame = 1
Query:  451 YPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGT---------YEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLF 891
            + GNEFGHPEWLDFPR GN  SYHYARRQ+NLVD   L+Y+ L  FDR MN TE+ + WLAAP AYVS K+EGDKVI +ERA ++F+FNFHP NS++ Y++ V   G          Y+I L+SD   +GG  RLD + +F T+    +NR N + 
Sbjct:  523 FMGNEFGHPEWLDFPRIGNNESYHYARRQYNLVDMDHLRYRQLYAFDRDMNRTEDNYGWLAAPPAYVSVKHEGDKVIVFERANLIFIFNFHPFNSYSDYRVAVGPAGKYPSLNSDYRYKIKLDSDEIQYGGHGRLDHNTEFFTEAMGLNNRPNSMM 678          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Xenopus
Match: alyref (Aly/REF export factor [Source:Xenbase;Acc:XB-GENE-973553])

HSP 1 Score: 199.904 bits (507), Expect = 2.883e-57
Identity = 88/161 (54.66%), Postives = 122/161 (75.78%), Query Frame = 1
Query:  451 YPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFAKI 933
            + GNEFGHPEWLDFPR+GNG SYHYARRQ++L+DD  L+Y+FL  FDR MN  EEKF WLAAPQAY+S K+E DK+IA+ERA +LF+FNFHP  SFT Y++GV+T G + I L++D   +GG  R++   +F T++  ++  ++ L +Y+P R A+V + +
Sbjct:  523 FIGNEFGHPEWLDFPRKGNGESYHYARRQFHLIDDNQLRYRFLYAFDRDMNKLEEKFGWLAAPQAYISAKHEDDKIIAFERANLLFIFNFHPYKSFTGYRVGVNTHGKFMIALDTDASEYGGHERINHKTEFFTEHSPYNGCSHSLLVYIPCRVALVLSNV 683          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Xenopus
Match: alyref (Aly/REF export factor [Source:Xenbase;Acc:XB-GENE-973553])

HSP 1 Score: 189.889 bits (481), Expect = 8.104e-54
Identity = 86/164 (52.44%), Postives = 120/164 (73.17%), Query Frame = 1
Query:  442 YKFYPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFAKI 933
            Y  + GNEFGHPEWLDFPR+GNG SYHYARRQ++L+DD  L+Y+FL  FDR MN  EEKF WLAAPQAY+S K+E DK+IA+ERA +LF+FNFHP  SFT Y++G+     + I L++D   +GG  R++   +F T++  ++  ++ L +Y+P R A+V + +
Sbjct:  469 YLNFIGNEFGHPEWLDFPRKGNGESYHYARRQFHLIDDNQLRYRFLYAFDRDMNKLEEKFGWLAAPQAYISAKHEDDKIIAFERANLLFIFNFHPYKSFTGYRVGIL---KFMIALDTDASEYGGHERINHKTEFFTEHSPYNGCSHSLLVYIPCRVALVLSNV 629          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Xenopus
Match: alyref (Aly/REF export factor [Source:Xenbase;Acc:XB-GENE-973553])

HSP 1 Score: 189.119 bits (479), Expect = 1.465e-53
Identity = 85/159 (53.46%), Postives = 118/159 (74.21%), Query Frame = 1
Query:  457 GNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFAKI 933
            GNEFGHPEWLDFPR+GNG SYHYARRQ++L+DD  L+Y+FL  FDR MN  EEKF WLAAPQAY+S K+E DK+IA+ERA +LF+FNFHP  SFT Y++G+     + I L++D   +GG  R++   +F T++  ++  ++ L +Y+P R A+V + +
Sbjct:  484 GNEFGHPEWLDFPRKGNGESYHYARRQFHLIDDNQLRYRFLYAFDRDMNKLEEKFGWLAAPQAYISAKHEDDKIIAFERANLLFIFNFHPYKSFTGYRVGIL---KFMIALDTDASEYGGHERINHKTEFFTEHSPYNGCSHSLLVYIPCRVALVLSNV 639          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Xenopus
Match: alyref (Aly/REF export factor [Source:Xenbase;Acc:XB-GENE-973553])

HSP 1 Score: 189.119 bits (479), Expect = 1.740e-53
Identity = 86/164 (52.44%), Postives = 120/164 (73.17%), Query Frame = 1
Query:  442 YKFYPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFAKI 933
            Y  + GNEFGHPEWLDFPR+GNG SYHYARRQ++L+DD  L+Y+FL  FDR MN  EEKF WLAAPQAY+S K+E DK+IA+ERA +LF+FNFHP  SFT Y++G+     + I L++D   +GG  R++   +F T++  ++  ++ L +Y+P R A+V + +
Sbjct:  490 YLNFIGNEFGHPEWLDFPRKGNGESYHYARRQFHLIDDNQLRYRFLYAFDRDMNKLEEKFGWLAAPQAYISAKHEDDKIIAFERANLLFIFNFHPYKSFTGYRVGIL---KFMIALDTDASEYGGHERINHKTEFFTEHSPYNGCSHSLLVYIPCRVALVLSNV 650          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Xenopus
Match: alyref (Aly/REF export factor [Source:Xenbase;Acc:XB-GENE-973553])

HSP 1 Score: 189.504 bits (480), Expect = 2.301e-53
Identity = 86/164 (52.44%), Postives = 120/164 (73.17%), Query Frame = 1
Query:  442 YKFYPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFAKI 933
            Y  + GNEFGHPEWLDFPR+GNG SYHYARRQ++L+DD  L+Y+FL  FDR MN  EEKF WLAAPQAY+S K+E DK+IA+ERA +LF+FNFHP  SFT Y++G+     + I L++D   +GG  R++   +F T++  ++  ++ L +Y+P R A+V + +
Sbjct:  527 YLNFIGNEFGHPEWLDFPRKGNGESYHYARRQFHLIDDNQLRYRFLYAFDRDMNKLEEKFGWLAAPQAYISAKHEDDKIIAFERANLLFIFNFHPYKSFTGYRVGIL---KFMIALDTDASEYGGHERINHKTEFFTEHSPYNGCSHSLLVYIPCRVALVLSNV 687          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Mouse
Match: Gbe1 (glucan (1,4-alpha-), branching enzyme 1 [Source:MGI Symbol;Acc:MGI:1921435])

HSP 1 Score: 204.527 bits (519), Expect = 5.454e-59
Identity = 91/159 (57.23%), Postives = 119/159 (74.84%), Query Frame = 1
Query:  457 GNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFAKI 933
            GNEFGHPEWLDFPR+GN  SYHYARRQ+NL DD +L+YKFLNNFDR MN  EE+  WL+APQAYVS K+E +K I +ERAG+LF+FNFHP+ S+T Y++G  TPGT++IVL+SD   +GG  RLD +  +  +    + R   L +Y+PSR A++   +
Sbjct:  540 GNEFGHPEWLDFPRKGNNESYHYARRQFNLTDDDLLRYKFLNNFDRDMNRLEERCGWLSAPQAYVSEKHEANKTITFERAGLLFIFNFHPSKSYTDYRVGTATPGTFKIVLDSDAAEYGGHQRLDHNTNYFAEAFEHNGRPYSLLVYIPSRVALILQNV 698          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Mouse
Match: Gbe1 (glucan (1,4-alpha-), branching enzyme 1 [Source:MGI Symbol;Acc:MGI:1921435])

HSP 1 Score: 204.527 bits (519), Expect = 5.454e-59
Identity = 91/159 (57.23%), Postives = 119/159 (74.84%), Query Frame = 1
Query:  457 GNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFAKI 933
            GNEFGHPEWLDFPR+GN  SYHYARRQ+NL DD +L+YKFLNNFDR MN  EE+  WL+APQAYVS K+E +K I +ERAG+LF+FNFHP+ S+T Y++G  TPGT++IVL+SD   +GG  RLD +  +  +    + R   L +Y+PSR A++   +
Sbjct:  540 GNEFGHPEWLDFPRKGNNESYHYARRQFNLTDDDLLRYKFLNNFDRDMNRLEERCGWLSAPQAYVSEKHEANKTITFERAGLLFIFNFHPSKSYTDYRVGTATPGTFKIVLDSDAAEYGGHQRLDHNTNYFAEAFEHNGRPYSLLVYIPSRVALILQNV 698          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Mouse
Match: Gbe1 (glucan (1,4-alpha-), branching enzyme 1 [Source:MGI Symbol;Acc:MGI:1921435])

HSP 1 Score: 202.601 bits (514), Expect = 3.233e-58
Identity = 90/159 (56.60%), Postives = 118/159 (74.21%), Query Frame = 1
Query:  457 GNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFAKI 933
            GNEFGHPEWLDFPR+GN  SYHYARRQ+NL DD +L+YKFLNNFDR MN  EE+  WL+APQAYVS K+E +K I +ERAG+LF+FNFHP+ S+T Y++G  TPG ++IVL+SD   +GG  RLD +  +  +    + R   L +Y+PSR A++   +
Sbjct:  540 GNEFGHPEWLDFPRKGNNESYHYARRQFNLTDDDLLRYKFLNNFDRDMNRLEERCGWLSAPQAYVSEKHEANKTITFERAGLLFIFNFHPSKSYTDYRVGTATPGKFKIVLDSDAAEYGGHQRLDHNTNYFAEAFEHNGRPYSLLVYIPSRVALILQNV 698          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Mouse
Match: Gbe1 (glucan (1,4-alpha-), branching enzyme 1 [Source:MGI Symbol;Acc:MGI:1921435])

HSP 1 Score: 169.474 bits (428), Expect = 2.526e-46
Identity = 75/118 (63.56%), Postives = 92/118 (77.97%), Query Frame = 1
Query:  442 YKFYPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNS 795
            Y  + GNEFGHPEWLDFPR+GN  SYHYARRQ+NL DD +L+YKFLNNFDR MN  EE+  WL+APQAYVS K+E +K I +ERAG+LF+FNFHP+ S+T Y++G  TPG Y  +   
Sbjct:  535 YLNFMGNEFGHPEWLDFPRKGNNESYHYARRQFNLTDDDLLRYKFLNNFDRDMNRLEERCGWLSAPQAYVSEKHEANKTITFERAGLLFIFNFHPSKSYTDYRVGTATPGKYPFLCQC 652          
BLAST of 1,4-alpha-glucan-branching enzyme vs. UniProt/SwissProt
Match: sp|Q6CCT1|GLGB_YARLI (1,4-alpha-glucan-branching enzyme OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GLC3 PE=3 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 1.412e-64
Identity = 100/164 (60.98%), Postives = 126/164 (76.83%), Query Frame = 1
Query:  442 YKFYPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLD-ESVKFTTQYENWDNRNNCLFLYLPSRTAIVFAK 930
            Y  + GNEFGHPEWLDFPREGNG+S+HY RRQW +VDD +L+Y+ LN FD AM H  + + WL+A QAYVS KNE DKV+ YERAG++FVFNFHP  SFT Y+IGVD PGTY +VL+SD+  FGGF R+D E  +  T+   W+ R NC+ +Y+PSR A+VFA+
Sbjct:  521 YLNFEGNEFGHPEWLDFPREGNGSSFHYCRRQWPVVDDKLLRYQHLNEFDAAMQHRGDHYGWLSADQAYVSLKNEDDKVVVYERAGLVFVFNFHPNKSFTDYRIGVDQPGTYTLVLDSDSPEFGGFGRIDHEKTRCHTEPLEWNGRANCMHIYIPSRVALVFAR 684          
BLAST of 1,4-alpha-glucan-branching enzyme vs. UniProt/SwissProt
Match: sp|Q6FJV0|GLGB_CANGA (1,4-alpha-glucan-branching enzyme OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=GLC3 PE=3 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 6.384e-63
Identity = 103/163 (63.19%), Postives = 125/163 (76.69%), Query Frame = 1
Query:  442 YKFYPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFAK 930
            Y  + GNEFGHPEWLDFPR GN +SYHYARRQ+NLVDD +L+Y+ LN FD AM + E K +WL  PQAYVS K+E DKVIA+ER G LFVFNFHPT SFT Y+IGVD  GTY+IVLN+D   FGG +R+DE+ +F T    W+NR N + +Y+PSRTAIV  +
Sbjct:  542 YLNFEGNEFGHPEWLDFPRVGNNDSYHYARRQFNLVDDDLLRYRHLNEFDAAMQNCESKHQWLNTPQAYVSLKHEVDKVIAFERNGHLFVFNFHPTQSFTDYRIGVDVAGTYKIVLNTDRAEFGGHNRIDEAQEFFTTDLEWNNRRNFIQVYIPSRTAIVLTR 704          
BLAST of 1,4-alpha-glucan-branching enzyme vs. UniProt/SwissProt
Match: sp|Q6CX53|GLGB_KLULA (1,4-alpha-glucan-branching enzyme OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GLC3 PE=3 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 5.039e-62
Identity = 109/206 (52.91%), Postives = 141/206 (68.45%), Query Frame = 1
Query:  313 DVFLSCDYTILISTNPSFYSKNNRLLIYFHFVD*ILVLFPFK*YKFYPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDES-VKFTTQYENWDNRNNCLFLYLPSRTAIVFA 927
            D  +  D TIL  + P      +R +     +  I      + Y  + GNEFGHPEWLDFP   NG+SYHYARRQ+NLVDDP+L+Y++L  FD+AM  TE+ +KWL  PQAYVS K+E DKVIA+ER G+LF+FNFHPT SFT Y+IGV+ PG Y IVLNSD   +GG+ R+DES  K+ T    W+ RNN + +Y+P+RTA+V A
Sbjct:  509 DAAMYTDMTILKESTPVV----DRGIALHKLIRLITHSLGGEAYLNFEGNEFGHPEWLDFPNVNNGDSYHYARRQFNLVDDPLLRYQYLYQFDKAMQTTEKNYKWLNTPQAYVSLKHEVDKVIAFERNGLLFIFNFHPTESFTDYRIGVNEPGCYRIVLNSDKHEYGGWDRIDESQSKYFTTDLKWNERNNFIQVYIPNRTALVLA 710          
BLAST of 1,4-alpha-glucan-branching enzyme vs. UniProt/SwissProt
Match: sp|Q96VA4|GLGB_ASPOR (1,4-alpha-glucan-branching enzyme OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gbeA PE=2 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 1.407e-61
Identity = 99/162 (61.11%), Postives = 129/162 (79.63%), Query Frame = 1
Query:  442 YKFYPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFA 927
            Y  + GNEFGHPEWLDFPR+GN NS+ YARRQ NL +D +L+YKFLN+FDRAM  TEEK+ WL +PQAYVS KNE DKV+ +ERAG+L++FNFHPTNSFT Y++GV+  GTY IVL++D+ AFGG +R  +  +F T   +W+ R+N L +Y+P+RTA+V A
Sbjct:  523 YLNFEGNEFGHPEWLDFPRDGNNNSFWYARRQLNLTEDHLLRYKFLNDFDRAMQLTEEKYGWLHSPQAYVSLKNETDKVLVFERAGLLWIFNFHPTNSFTDYRVGVEQSGTYRIVLDTDDPAFGGLNRNLKETRFFTTDLSWNGRSNFLQVYIPTRTALVLA 684          
BLAST of 1,4-alpha-glucan-branching enzyme vs. UniProt/SwissProt
Match: sp|Q6BXN1|GLGB_DEBHA (1,4-alpha-glucan-branching enzyme OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GLC3 PE=3 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 4.975e-61
Identity = 101/168 (60.12%), Postives = 128/168 (76.19%), Query Frame = 1
Query:  442 YKFYPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDES-------VKFTTQYENWDNRNNCLFLYLPSRTAIVF 924
            Y  + GNEFGHPEWLDFPR+GNG SY YARRQ+NL++D +L+YKFL  FD AM H + K+  L + QAYVS KNE DKVI +ER G+LF+FNFHPTNS+  YKIGV+TPG Y+IVLNSD+ +FGG  R++E+       ++F T  E W++R+N LF Y+PSRTAIV 
Sbjct:  537 YLNFEGNEFGHPEWLDFPRKGNGESYAYARRQFNLIEDDLLRYKFLFAFDGAMQHLDTKYGILLSSQAYVSLKNENDKVIVFERNGLLFIFNFHPTNSYADYKIGVETPGVYQIVLNSDSLSFGGHGRIEETNKETGEKLQFFTNNERWNDRSNALFCYIPSRTAIVL 704          
BLAST of 1,4-alpha-glucan-branching enzyme vs. TrEMBL
Match: A0A3P8GUD0 (Alpha-amylase_C domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS20266 PE=4 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 8.812e-86
Identity = 123/160 (76.88%), Postives = 137/160 (85.62%), Query Frame = 1
Query:  448 FYPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFA 927
            ++ GNEFGHPEWLDFPR GN +SYHYARRQWNLVDDP+L+YK+LNNFDRAM H EEK+ WLAAPQAYVSRKNEGDKVIA+ERAGVLF FNFHPT SFT YKIGVDTPG Y IVL+SD E FGGF R+D+SV   T+ E WDNR NC+FLYLPSRT +  A
Sbjct:    3 WFIGNEFGHPEWLDFPRAGNNSSYHYARRQWNLVDDPLLRYKYLNNFDRAMQHLEEKYGWLAAPQAYVSRKNEGDKVIAFERAGVLFAFNFHPTQSFTDYKIGVDTPGQYHIVLDSDQEEFGGFKRIDQSVDVFTRNEPWDNRRNCVFLYLPSRTCMALA 162          
BLAST of 1,4-alpha-glucan-branching enzyme vs. TrEMBL
Match: A0A183Q0Y0 (Alpha-amylase_C domain-containing protein OS=Schistosoma mattheei OX=31246 PE=4 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 1.119e-85
Identity = 123/160 (76.88%), Postives = 137/160 (85.62%), Query Frame = 1
Query:  448 FYPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFA 927
            ++ GNEFGHPEWLDFPR GN +SYHYARRQWNLVDDP+L+YK+LNNFDRAM H EEK+ WLAAPQAYVSRKNEGDKVIA+ERAGVLF FNFHPT SFT YKIGVDTPG Y IVL+SD E FGGF R+D+SV   T+ E WDNR NC+FLYLPSRT +  A
Sbjct:    3 WFIGNEFGHPEWLDFPRAGNNSSYHYARRQWNLVDDPLLRYKYLNNFDRAMQHLEEKYGWLAAPQAYVSRKNEGDKVIAFERAGVLFAFNFHPTQSFTDYKIGVDTPGQYHIVLDSDQEEFGGFKRIDQSVDVFTRNEPWDNRRNCVFLYLPSRTCMALA 162          
BLAST of 1,4-alpha-glucan-branching enzyme vs. TrEMBL
Match: A0A3Q0KJC9 (Putative starch branching enzyme II OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 2.305e-82
Identity = 123/162 (75.93%), Postives = 138/162 (85.19%), Query Frame = 1
Query:  442 YKFYPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFA 927
            Y  + GNEFGHPEWLDFPR GN +SYHYARRQWNLVDDP+L+YK+LNNFDRAM H EE++ WLAAPQAYVSRKNEGDKVIA+ERAGVLFVFNFHPT SFT YKIGV+TPG Y IVL+SD E FGGF R+D+SV   T+ E WDNR NC+FLYLPSRT +  A
Sbjct:  298 YLNFMGNEFGHPEWLDFPRAGNNSSYHYARRQWNLVDDPLLRYKYLNNFDRAMQHLEERYGWLAAPQAYVSRKNEGDKVIAFERAGVLFVFNFHPTQSFTDYKIGVETPGQYHIVLDSDQEEFGGFKRIDQSVDVFTRNEPWDNRRNCVFLYLPSRTCMALA 459          
BLAST of 1,4-alpha-glucan-branching enzyme vs. TrEMBL
Match: Q5BYN9 (SJCHGC09260 protein (Fragment) OS=Schistosoma japonicum OX=6182 PE=2 SV=2)

HSP 1 Score: 256.529 bits (654), Expect = 1.805e-81
Identity = 117/159 (73.58%), Postives = 133/159 (83.65%), Query Frame = 1
Query:  451 YPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFA 927
            + GNEFGHPEWLDFPR GN +SYHYARRQWNLVDDP+L+YK+LNNFD+AM H EE++ WLAAPQA+VSRKNEGDKVIA+ERAGVLFVFNFHPT SFT YKIGV+  G Y IVL+SD E FGGF R+D+SV   T  E WDNR  C+FLYLPSRT +  A
Sbjct:   15 FMGNEFGHPEWLDFPRAGNNSSYHYARRQWNLVDDPLLRYKYLNNFDKAMQHLEERYGWLAAPQAFVSRKNEGDKVIAFERAGVLFVFNFHPTQSFTDYKIGVEVSGRYRIVLDSDQEEFGGFKRIDQSVDVFTHDEPWDNRRCCVFLYLPSRTCLALA 173          
BLAST of 1,4-alpha-glucan-branching enzyme vs. TrEMBL
Match: A0A183KBQ0 (Aamy domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS12438 PE=4 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 7.768e-81
Identity = 124/157 (78.98%), Postives = 135/157 (85.99%), Query Frame = 1
Query:  457 GNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFA 927
            GNEFGHPEWLDFPR GN +SYHYARRQWNLVDDP+L+YK+LNNFDRAM H EEK+ WLAAPQAYVSRKNEGDKVIA+ERAGVLF FNFHPT SFT YKIGVDTPG Y IVLNSD E FGGF R+D+SV   T+ E WDNR NC+FLYLPSRT +  A
Sbjct:  534 GNEFGHPEWLDFPRAGNNSSYHYARRQWNLVDDPLLRYKYLNNFDRAMQHLEEKYGWLAAPQAYVSRKNEGDKVIAFERAGVLFAFNFHPTQSFTDYKIGVDTPGQYHIVLNSDQEEFGGFKRIDQSVDVFTRNEPWDNRQNCVFLYLPSRTCMALA 690          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Cavefish
Match: gbe1b (1,4-alpha-glucan branching enzyme 1 [Source:NCBI gene;Acc:103031248])

HSP 1 Score: 192.586 bits (488), Expect = 1.035e-54
Identity = 89/157 (56.69%), Postives = 117/157 (74.52%), Query Frame = 1
Query:  457 GNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFA 927
            GNEFGHPEWLDFPR GN  SYHYARRQ+NL+D   L+Y+ L  FDR MN TE+K+ WLAAP AYV+ K+EGDKVI +ER  V+F+FNFHP NS++SY++ V+  G Y+I L+SD   +GG  RLD + +F T+   ++ R N + +Y+P RTA+V A
Sbjct:  525 GNEFGHPEWLDFPRVGNNESYHYARRQFNLLDTDHLRYRQLYLFDRDMNRTEDKYGWLAAPPAYVTAKHEGDKVIIFERGNVIFIFNFHPVNSYSSYRVAVEAAGKYKIKLDSDEVQYGGHGRLDHNTEFFTESIPFNGRANSMQVYIPCRTAVVLA 681          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Cavefish
Match: gbe1a (1,4-alpha-glucan-branching enzyme-like [Source:NCBI gene;Acc:103047293])

HSP 1 Score: 173.326 bits (438), Expect = 7.182e-48
Identity = 81/159 (50.94%), Postives = 109/159 (68.55%), Query Frame = 1
Query:  451 YPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFA 927
            + GNEFGHPEWLDFPR+GN  SY YARRQ+NLVD   L+Y+ L  FDR MN TE+K+ WL++  A VS  ++ DKVI +ERA +LF+FNFHP+ SF+ Y++ V   G Y+I LNSD   +GG  R+    +F T+   + N+     +Y+P RTA+V A
Sbjct:  486 FMGNEFGHPEWLDFPRKGNEESYRYARRQYNLVDTEHLRYRQLYAFDRDMNQTEDKYGWLSSGPAVVSTLDQADKVIVFERAKLLFIFNFHPSASFSHYRVAVQHAGKYKIQLNSDEVRYGGHGRIQSDTEFFTEPMAFRNQLRSFLIYIPCRTALVLA 644          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Cavefish
Match: gbe1a (1,4-alpha-glucan-branching enzyme-like [Source:NCBI gene;Acc:103047293])

HSP 1 Score: 172.94 bits (437), Expect = 1.395e-47
Identity = 81/159 (50.94%), Postives = 109/159 (68.55%), Query Frame = 1
Query:  451 YPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFA 927
            + GNEFGHPEWLDFPR+GN  SY YARRQ+NLVD   L+Y+ L  FDR MN TE+K+ WL++  A VS  ++ DKVI +ERA +LF+FNFHP+ SF+ Y++ V   G Y+I LNSD   +GG  R+    +F T+   + N+     +Y+P RTA+V A
Sbjct:  523 FMGNEFGHPEWLDFPRKGNEESYRYARRQYNLVDTEHLRYRQLYAFDRDMNQTEDKYGWLSSGPAVVSTLDQADKVIVFERAKLLFIFNFHPSASFSHYRVAVQHAGKYKIQLNSDEVRYGGHGRIQSDTEFFTEPMAFRNQLRSFLIYIPCRTALVLA 681          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Cavefish
Match: gbe1a (1,4-alpha-glucan-branching enzyme-like [Source:NCBI gene;Acc:103047293])

HSP 1 Score: 156.762 bits (395), Expect = 5.632e-42
Identity = 74/138 (53.62%), Postives = 97/138 (70.29%), Query Frame = 1
Query:  442 YKFYPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQ 855
            Y  + GNEFGHPEWLDFPR+GN  SY YARRQ+NLVD   L+Y+ L  FDR MN TE+K+ WL++  A VS  ++ DKVI +ERA +LF+FNFHP+ SF+ Y++ V   G Y+I LNSD   +GG  R+    +F T+
Sbjct:  496 YLNFMGNEFGHPEWLDFPRKGNEESYRYARRQYNLVDTEHLRYRQLYAFDRDMNQTEDKYGWLSSGPAVVSTLDQADKVIVFERAKLLFIFNFHPSASFSHYRVAVQHAGKYKIQLNSDEVRYGGHGRIQSDTEFFTE 633          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Yeast
Match: GLC3 (Glycogen branching enzyme, involved in glycogen accumulation; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern; relocalizes from nucleus to cytoplasmic foci upon DNA replication stress; glycogen accumulation defect of the null mutant is functionally complemented by human GBE1, which is associated with glycogen storage disease [Source:SGD;Acc:S000000737])

HSP 1 Score: 203.756 bits (517), Expect = 1.043e-59
Identity = 94/159 (59.12%), Postives = 121/159 (76.10%), Query Frame = 1
Query:  451 YPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFA 927
            + GNEFGHPEWLDFP   NG+SY YARRQ+NL DDP+L+Y+ LN FDR+M   E++ KWL   QAYVS K+EGDK+I +ER  +LF+FNFHPTNS++ Y++GV+  GTY IVLNSD   FGG +R++ES +F T    W+NR N L +Y+PSR A+V A
Sbjct:  543 FEGNEFGHPEWLDFPNVNNGDSYKYARRQFNLADDPLLRYQNLNEFDRSMQLCEKRHKWLNTKQAYVSLKHEGDKMIVFERNNLLFIFNFHPTNSYSDYRVGVEKAGTYHIVLNSDRAEFGGHNRINESSEFFTTDLEWNNRKNFLQVYIPSRVALVLA 701          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Nematostella
Match: EDO42370 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1S6])

HSP 1 Score: 196.052 bits (497), Expect = 1.767e-56
Identity = 87/157 (55.41%), Postives = 113/157 (71.97%), Query Frame = 1
Query:  457 GNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFA 927
            GNEFGHPEWLDFPR GN  SYHYARRQW+LVDD +L+YK+L  FD AM H E K+ WL+  QAYVS K+E DK+IA+ER  +L++FNFHPT SF  Y++GV+  G + +VL++D E FGG  R+D   ++  +   W NR   L +Y+P R A+V A
Sbjct:  521 GNEFGHPEWLDFPRAGNNISYHYARRQWHLVDDELLRYKYLYRFDMAMQHLEAKYGWLSTEQAYVSNKHEDDKIIAFERGNLLWIFNFHPTKSFPDYRVGVNRAGKFNLVLSTDAEEFGGHRRVDPDCRYYVESRPWHNRAFSLLVYIPCRCALVLA 677          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Nematostella
Match: EDO27132 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TA40])

HSP 1 Score: 86.6557 bits (213), Expect = 3.021e-21
Identity = 38/84 (45.24%), Postives = 56/84 (66.67%), Query Frame = 1
Query:  643 AYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFL 894
            AYVS K+E DK+IA+ER  +L++FNFHPT SF  Y++GV+  G + +VL++D E FGG  R+D   ++  +   W NR   L +
Sbjct:    1 AYVSNKHEDDKIIAFERGNLLWIFNFHPTKSFPDYRVGVNRAGKFNLVLSTDAEEFGGHRRVDPDCRYYVESRPWHNRAFSLLV 84          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Medaka
Match: gbe1b (1,4-alpha-glucan branching enzyme 1 [Source:NCBI gene;Acc:101172672])

HSP 1 Score: 196.823 bits (499), Expect = 4.358e-56
Identity = 92/157 (58.60%), Postives = 115/157 (73.25%), Query Frame = 1
Query:  457 GNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFA 927
            GNEFGHPEWLDFPREGN  SYHYARRQ+NL+D   L+Y  L  FDR MN  E+K+ WLAAP A+VS K+EGDKVI ++RA VLF+FNFHP  SF  Y++GV+  G Y+I L+SD   +GG  RLD S  F T+   ++ R+N + +Y+P RTAIV A
Sbjct:  553 GNEFGHPEWLDFPREGNNQSYHYARRQFNLLDTDHLRYCQLYAFDRDMNRAEDKYGWLAAPPAFVSAKHEGDKVIVFDRANVLFIFNFHPNRSFQDYRVGVEAAGKYKIKLDSDEVQYGGHGRLDHSTDFFTEPHPFNGRSNSMLVYIPCRTAIVLA 709          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Medaka
Match: gbe1b (1,4-alpha-glucan branching enzyme 1 [Source:NCBI gene;Acc:101172672])

HSP 1 Score: 179.104 bits (453), Expect = 5.477e-50
Identity = 85/154 (55.19%), Postives = 110/154 (71.43%), Query Frame = 1
Query:  451 YPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRT 912
            + GNEFGHPEWLDFPREGN  SYHYARRQ+NL+D   L+Y  L  FDR MN  E+K+ WLAAP A+VS K+EGDKVI ++RA VLF+FNFHP  SF  Y++GV+  G Y+I L+SD   +GG  RLD S  F T+   ++ R+N + + + + T
Sbjct:  498 FIGNEFGHPEWLDFPREGNNQSYHYARRQFNLLDTDHLRYCQLYAFDRDMNRAEDKYGWLAAPPAFVSAKHEGDKVIVFDRANVLFIFNFHPNRSFQDYRVGVEAAGKYKIKLDSDEVQYGGHGRLDHSTDFFTEPHPFNGRSNSMLVNISNMT 651          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Medaka
Match: gbe1b (1,4-alpha-glucan branching enzyme 1 [Source:NCBI gene;Acc:101172672])

HSP 1 Score: 97.0561 bits (240), Expect = 1.776e-21
Identity = 45/74 (60.81%), Postives = 53/74 (71.62%), Query Frame = 1
Query:  442 YKFYPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKN 663
            Y  + GNEFGHPEWLDFPREGN  SYHYARRQ+NL+D   L+Y  L  FDR MN  E+K+ WLAAP  Y+  + 
Sbjct:  548 YLNFIGNEFGHPEWLDFPREGNNQSYHYARRQFNLLDTDHLRYCQLYAFDRDMNRAEDKYGWLAAPPVYIPCRT 621          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Planmine SMEST
Match: SMESG000060455.1 (SMESG000060455.1)

HSP 1 Score: 335.88 bits (860), Expect = 3.546e-109
Identity = 160/162 (98.77%), Postives = 161/162 (99.38%), Query Frame = 1
Query:  451 YPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFAKIK 936
            + GNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFAKIK
Sbjct:  524 FMGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTAIVFAKIK 685          
BLAST of 1,4-alpha-glucan-branching enzyme vs. Planmine SMEST
Match: SMESG000005023.1 (SMESG000005023.1)

HSP 1 Score: 179.874 bits (455), Expect = 2.851e-50
Identity = 92/192 (47.92%), Postives = 124/192 (64.58%), Query Frame = 1
Query:  352 TNPSFYSKNN----RLLIYFHFVD*ILVLFPFK*YKFYPGNEFGHPEWLDFPREGNGNSYHYARRQWNLVDDPILKYKFLNNFDRAMNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSYKIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLYLPSRTA 915
            T+ S +S +N    R L++   +  I  +   + Y  + GNEFGHPEWLDFPR  N  SY YARRQWNLVDD  LKYKFL  FD+ +N  E ++KWL++P+A +      +K+I + RA ++F+FNF+  NSF SYK+G+  PG Y  +LN+DN  FGG SRLDESV   +Q   W ++   L +YLPSRT 
Sbjct:  472 THMSIFSSSNLVVDRGLVFHMMIRMITHVLGGESYLNFIGNEFGHPEWLDFPRLENKWSYTYARRQWNLVDDVDLKYKFLAKFDKRLNEIEAEYKWLSSPKATILHLCNTNKIICFVRAEMIFLFNFNEENSFESYKVGITIPGKYRCILNTDNSDFGGLSRLDESVCHFSQPGIWQDQQQYLSVYLPSRTG 663          
The following BLAST results are available for this feature:
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
GBE15.255e-6157.761,4-alpha-glucan branching enzyme 1 [Source:HGNC S... [more]
GBE11.082e-6058.491,4-alpha-glucan branching enzyme 1 [Source:HGNC S... [more]
back to top
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
T04A8.71.246e-5356.88Alpha-amylase [Source:UniProtKB/TrEMBL;Acc:Q86G92... [more]
T04A8.74.055e-5357.59Alpha-amylase [Source:UniProtKB/TrEMBL;Acc:Q86G92... [more]
back to top
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
AGBE5.312e-6258.79gene:FBgn0053138 transcript:FBtr0087732[more]
back to top
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gbe1a3.196e-5052.20glucan (1,4-alpha-), branching enzyme 1a [Source:Z... [more]
gbe1a5.759e-5052.20glucan (1,4-alpha-), branching enzyme 1a [Source:Z... [more]
gbe1a6.053e-5052.20glucan (1,4-alpha-), branching enzyme 1a [Source:Z... [more]
gbe1a2.336e-4751.28glucan (1,4-alpha-), branching enzyme 1a [Source:Z... [more]
gbe1b1.784e-4553.21glucan (1,4-alpha-), branching enzyme 1b [Source:Z... [more]
back to top
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alyref2.883e-5754.66Aly/REF export factor [Source:Xenbase;Acc:XB-GENE-... [more]
alyref8.104e-5452.44Aly/REF export factor [Source:Xenbase;Acc:XB-GENE-... [more]
alyref1.465e-5353.46Aly/REF export factor [Source:Xenbase;Acc:XB-GENE-... [more]
alyref1.740e-5352.44Aly/REF export factor [Source:Xenbase;Acc:XB-GENE-... [more]
alyref2.301e-5352.44Aly/REF export factor [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Gbe15.454e-5957.23glucan (1,4-alpha-), branching enzyme 1 [Source:MG... [more]
Gbe15.454e-5957.23glucan (1,4-alpha-), branching enzyme 1 [Source:MG... [more]
Gbe13.233e-5856.60glucan (1,4-alpha-), branching enzyme 1 [Source:MG... [more]
Gbe12.526e-4663.56glucan (1,4-alpha-), branching enzyme 1 [Source:MG... [more]
back to top
BLAST of 1,4-alpha-glucan-branching enzyme vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6CCT1|GLGB_YARLI1.412e-6460.981,4-alpha-glucan-branching enzyme OS=Yarrowia lipo... [more]
sp|Q6FJV0|GLGB_CANGA6.384e-6363.191,4-alpha-glucan-branching enzyme OS=Candida glabr... [more]
sp|Q6CX53|GLGB_KLULA5.039e-6252.911,4-alpha-glucan-branching enzyme OS=Kluyveromyces... [more]
sp|Q96VA4|GLGB_ASPOR1.407e-6161.111,4-alpha-glucan-branching enzyme OS=Aspergillus o... [more]
sp|Q6BXN1|GLGB_DEBHA4.975e-6160.121,4-alpha-glucan-branching enzyme OS=Debaryomyces ... [more]
back to top
BLAST of 1,4-alpha-glucan-branching enzyme vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P8GUD08.812e-8676.88Alpha-amylase_C domain-containing protein OS=Schis... [more]
A0A183Q0Y01.119e-8576.88Alpha-amylase_C domain-containing protein OS=Schis... [more]
A0A3Q0KJC92.305e-8275.93Putative starch branching enzyme II OS=Schistosoma... [more]
Q5BYN91.805e-8173.58SJCHGC09260 protein (Fragment) OS=Schistosoma japo... [more]
A0A183KBQ07.768e-8178.98Aamy domain-containing protein OS=Schistosoma cura... [more]
back to top
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gbe1b1.035e-5456.691,4-alpha-glucan branching enzyme 1 [Source:NCBI g... [more]
gbe1a7.182e-4850.941,4-alpha-glucan-branching enzyme-like [Source:NCB... [more]
gbe1a1.395e-4750.941,4-alpha-glucan-branching enzyme-like [Source:NCB... [more]
gbe1a5.632e-4253.621,4-alpha-glucan-branching enzyme-like [Source:NCB... [more]
back to top
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GLC31.043e-5959.12Glycogen branching enzyme, involved in glycogen ac... [more]
back to top
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO423701.767e-5655.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO271323.021e-2145.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 1,4-alpha-glucan-branching enzyme vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gbe1b4.358e-5658.601,4-alpha-glucan branching enzyme 1 [Source:NCBI g... [more]
gbe1b5.477e-5055.191,4-alpha-glucan branching enzyme 1 [Source:NCBI g... [more]
gbe1b1.776e-2160.811,4-alpha-glucan branching enzyme 1 [Source:NCBI g... [more]
back to top
BLAST of 1,4-alpha-glucan-branching enzyme vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000060455.13.546e-10998.77SMESG000060455.1[more]
SMESG000005023.12.851e-5047.92SMESG000005023.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019711 ID=SMED30019711|Name=1,4-alpha-glucan-branching enzyme|organism=Schmidtea mediterranea sexual|type=transcript|length=1185bp
TTAATACAAAAGAATCTCATCCAATAAAATTTTAATAAAAAAATAGATTT
TGTCCCGATCTTGACATTTCTTATTGCTAATTTTGTGCTGTGATGTTCTT
GAACTCTCTTACTCGACAAGGGGAAACAGTAGACTCCTCGTGCTTTTTCA
AAAACCAACTTTTTCCACGCACACTTCCTAAAACTTTATCTAAAGGTAAT
CGTCTCCCGTGGTTACGGCTCTGGTAATAATATTTCTGCACTATGAAGGA
TAAGTGAAGCATCTTACAGAAAGATTTTGATAATAAACGAAATTTTGCTT
AACTATATTCGTGATGTATTTCTTTCTTGTGATTACACAATATTGATCTC
GACCAATCCAAGCTTCTATTCTAAAAATAATCGTTTATTGATTTATTTTC
ATTTCGTCGACTGAATTTTAGTTTTATTCCCATTTAAATGATATAAATTT
TATCCAGGTAACGAATTTGGTCATCCGGAATGGTTAGATTTCCCCCGAGA
AGGCAACGGTAACAGTTACCATTATGCTCGACGCCAATGGAATCTTGTGG
ATGATCCAATTTTGAAATATAAATTCTTGAATAATTTCGATAGAGCAATG
AATCACACGGAAGAAAAATTCAAATGGCTAGCAGCGCCACAGGCATATGT
CAGTAGGAAAAATGAAGGCGACAAAGTGATCGCTTATGAGCGTGCAGGTG
TTTTGTTTGTGTTCAATTTTCATCCAACGAACAGTTTTACGTCCTACAAA
ATCGGTGTCGATACTCCTGGAACATACGAAATCGTCCTCAATTCCGACAA
CGAGGCATTCGGTGGATTCTCTCGACTTGACGAGTCCGTGAAATTTACGA
CTCAATACGAAAATTGGGACAATAGAAACAATTGTTTGTTTCTCTACTTG
CCATCTCGAACGGCAATTGTGTTTGCCAAAATTAAATGATCATTGTTTTT
ATTTTATTAGTCTTAGTCACTTCATGATTGATCAATAATTATTTTTCTAT
TTGATTTTCATTAATATATTTTGTTGAGTAAGTAGTCTTTTGAGTGTTGA
TCATTTTATCTTTCAATACTGGTTTTGGATATTTTGTGACTGGTGATGTT
TCATATAGAAATTCGATCAATTTTGATGGTTAGATTGAATCTATTTTTAG
TAACTGTAAATCTATCAGCATTAGCCAGATCGGAA
back to top

protein sequence of SMED30019711-orf-1

>SMED30019711-orf-1 ID=SMED30019711-orf-1|Name=SMED30019711-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=114bp
MNHTEEKFKWLAAPQAYVSRKNEGDKVIAYERAGVLFVFNFHPTNSFTSY
KIGVDTPGTYEIVLNSDNEAFGGFSRLDESVKFTTQYENWDNRNNCLFLY
LPSRTAIVFAKIK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR037439Branching_enzy
IPR006048A-amylase/branching_C
IPR013780Glyco_hydro_b
IPR017853Glycoside_hydrolase_SF
Vocabulary: molecular function
TermDefinition
GO:0043169cation binding
GO:0003824catalytic activity
GO:00038441,4-alpha-glucan branching enzyme activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
GO:0005978glycogen biosynthetic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006048Alpha-amylase/branching enzyme, C-terminal all betaPFAMPF02806Alpha-amylase_Ccoord: 17..110
e-value: 1.9E-27
score: 95.6
IPR013780Glycosyl hydrolase, all-betaGENE3DG3DSA:2.60.40.1180coord: 13..113
e-value: 5.7E-42
score: 143.6
IPR0374391,4-alpha-glucan-branching enzymePANTHERPTHR43651FAMILY NOT NAMEDcoord: 1..111
NoneNo IPR availablePANTHERPTHR43651:SF31,4-ALPHA-GLUCAN-BRANCHING ENZYMEcoord: 1..111
NoneNo IPR availableSUPERFAMILYSSF51011Glycosyl hydrolase domaincoord: 14..110