SMED30019702

Overview
NameSMED30019702
Smed IDSMED30019702
Length (bp)846
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30019702 (SMED30019702) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30019702 (SMED30019702) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30019702 (SMED30019702) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30019702 (SMED30019702) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019702

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30019702SMESG000016033.1 SMESG000000571.1 SmedASXL_077445SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30019702SMESG000016033.1 SMESG000000571.1 SmedASXL_077445SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30019702SMESG000016033.1 SMESG000000571.1 dd_Smed_v4_661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30019702SMESG000016033.1 SMESG000000571.1 dd_Smed_v4_661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30019702SMESG000016033.1 SMESG000000571.1 dd_Smed_v4_661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30019702SMESG000016033.1 SMESG000000571.1 dd_Smed_v4_661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019702SMESG000016033.1 SMESG000000571.1 dd_Smed_v4_661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019702SMESG000016033.1 SMESG000000571.1 dd_Smed_v4_661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019702SMESG000016033.1 SMESG000000571.1 dd_Smed_v4_661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019702SMESG000016033.1 SMESG000000571.1 dd_Smed_v4_661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30019702SMESG000016033.1 SMESG000000571.1 dd_Smed_v4_661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019702SMESG000016033.1 SMESG000000571.1 dd_Smed_v4_661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30019702SMESG000016033.1 SMESG000000571.1 dd_Smed_v6_661_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30019702 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001733:37255..38677 -3860
v31.000007:63312..64229 +3255
v31.000007:188065..188982 -3237
v31.000007:121527..122423 -3217
v31.000553:18329..19136 +2669
v31.000553:108951..109897 +2648
Homology
BLAST of SMED30019702 vs. Ensembl Human
Match: SRSF10 (serine and arginine rich splicing factor 10 [Source:HGNC Symbol;Acc:HGNC:16713])

HSP 1 Score: 78.9518 bits (193), Expect = 2.335e-17
Identity = 36/67 (53.73%), Postives = 49/67 (73.13%), Query Frame = -1
Query:  604 RRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLD 804
            R  N+ LFVRN++D  R EDL + FG+YG I ++ +PLD+Y+ R +GF +V+FED RDAEDA   LD
Sbjct:    6 RPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLD 72          
BLAST of SMED30019702 vs. Ensembl Human
Match: SRSF10 (serine and arginine rich splicing factor 10 [Source:HGNC Symbol;Acc:HGNC:16713])

HSP 1 Score: 78.9518 bits (193), Expect = 2.462e-17
Identity = 36/67 (53.73%), Postives = 49/67 (73.13%), Query Frame = -1
Query:  604 RRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLD 804
            R  N+ LFVRN++D  R EDL + FG+YG I ++ +PLD+Y+ R +GF +V+FED RDAEDA   LD
Sbjct:    6 RPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLD 72          
BLAST of SMED30019702 vs. Ensembl Human
Match: SRSF10 (serine and arginine rich splicing factor 10 [Source:HGNC Symbol;Acc:HGNC:16713])

HSP 1 Score: 78.9518 bits (193), Expect = 2.474e-17
Identity = 36/67 (53.73%), Postives = 49/67 (73.13%), Query Frame = -1
Query:  604 RRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLD 804
            R  N+ LFVRN++D  R EDL + FG+YG I ++ +PLD+Y+ R +GF +V+FED RDAEDA   LD
Sbjct:    6 RPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLD 72          
BLAST of SMED30019702 vs. Ensembl Human
Match: SRSF10 (serine and arginine rich splicing factor 10 [Source:HGNC Symbol;Acc:HGNC:16713])

HSP 1 Score: 79.337 bits (194), Expect = 2.706e-17
Identity = 36/67 (53.73%), Postives = 49/67 (73.13%), Query Frame = -1
Query:  604 RRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLD 804
            R  N+ LFVRN++D  R EDL + FG+YG I ++ +PLD+Y+ R +GF +V+FED RDAEDA   LD
Sbjct:    6 RPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLD 72          
BLAST of SMED30019702 vs. Ensembl Human
Match: SRSF10 (serine and arginine rich splicing factor 10 [Source:HGNC Symbol;Acc:HGNC:16713])

HSP 1 Score: 78.9518 bits (193), Expect = 3.056e-17
Identity = 36/67 (53.73%), Postives = 49/67 (73.13%), Query Frame = -1
Query:  604 RRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLD 804
            R  N+ LFVRN++D  R EDL + FG+YG I ++ +PLD+Y+ R +GF +V+FED RDAEDA   LD
Sbjct:    6 RPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLD 72          
BLAST of SMED30019702 vs. Ensembl Celegans
Match: rsp-4 (Probable splicing factor, arginine/serine-rich 4 [Source:UniProtKB/Swiss-Prot;Acc:Q09511])

HSP 1 Score: 53.5286 bits (127), Expect = 6.394e-9
Identity = 32/74 (43.24%), Postives = 44/74 (59.46%), Query Frame = -1
Query:  571 SCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQLLAPAEMR 792
            + L + NLS +    DL + F +YG I ++ IP D YS + KGFGFV F + RDAE A  R D  +L+   E+R
Sbjct:   19 TSLKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSKGFGFVRFYERRDAEHALDRTD-GKLVDGRELR 91          
BLAST of SMED30019702 vs. Ensembl Celegans
Match: rsp-4 (Probable splicing factor, arginine/serine-rich 4 [Source:UniProtKB/Swiss-Prot;Acc:Q09511])

HSP 1 Score: 53.5286 bits (127), Expect = 1.986e-8
Identity = 32/74 (43.24%), Postives = 44/74 (59.46%), Query Frame = -1
Query:  571 SCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQLLAPAEMR 792
            + L + NLS +    DL + F +YG I ++ IP D YS + KGFGFV F + RDAE A  R D  +L+   E+R
Sbjct:   19 TSLKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSKGFGFVRFYERRDAEHALDRTD-GKLVDGRELR 91          
BLAST of SMED30019702 vs. Ensembl Celegans
Match: rsp-3 (Probable splicing factor, arginine/serine-rich 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9NEW6])

HSP 1 Score: 51.6026 bits (122), Expect = 1.746e-7
Identity = 29/56 (51.79%), Postives = 36/56 (64.29%), Query Frame = -1
Query:  619 LFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDA 786
            ++V NL   VR +++E +F KYGRI  + I     SGR   F FVEFED RDAEDA
Sbjct:   11 VYVGNLPGDVREKEVEDIFHKYGRIKYVDIK----SGRGPAFAFVEFEDHRDAEDA 62          
BLAST of SMED30019702 vs. Ensembl Celegans
Match: rsp-3 (Probable splicing factor, arginine/serine-rich 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9NEW6])

HSP 1 Score: 51.6026 bits (122), Expect = 1.746e-7
Identity = 29/56 (51.79%), Postives = 36/56 (64.29%), Query Frame = -1
Query:  619 LFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDA 786
            ++V NL   VR +++E +F KYGRI  + I     SGR   F FVEFED RDAEDA
Sbjct:   11 VYVGNLPGDVREKEVEDIFHKYGRIKYVDIK----SGRGPAFAFVEFEDHRDAEDA 62          
BLAST of SMED30019702 vs. Ensembl Celegans
Match: rsp-3 (Probable splicing factor, arginine/serine-rich 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9NEW6])

HSP 1 Score: 51.6026 bits (122), Expect = 1.746e-7
Identity = 29/56 (51.79%), Postives = 36/56 (64.29%), Query Frame = -1
Query:  619 LFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDA 786
            ++V NL   VR +++E +F KYGRI  + I     SGR   F FVEFED RDAEDA
Sbjct:   11 VYVGNLPGDVREKEVEDIFHKYGRIKYVDIK----SGRGPAFAFVEFEDHRDAEDA 62          
BLAST of SMED30019702 vs. Ensembl Fly
Match: SC35 (gene:FBgn0265298 transcript:FBtr0306252)

HSP 1 Score: 50.8322 bits (120), Expect = 2.198e-7
Identity = 31/73 (42.47%), Postives = 43/73 (58.90%), Query Frame = -1
Query:  571 CLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQLLAPAEMR 789
             L V NL+ R   EDL ++F + G + +I IP D Y+   +GF FV F D RDAEDA   +D  ++L   E+R
Sbjct:   24 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMD-GRMLDGRELR 95          
BLAST of SMED30019702 vs. Ensembl Fly
Match: SC35 (gene:FBgn0265298 transcript:FBtr0302910)

HSP 1 Score: 50.8322 bits (120), Expect = 2.198e-7
Identity = 31/73 (42.47%), Postives = 43/73 (58.90%), Query Frame = -1
Query:  571 CLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQLLAPAEMR 789
             L V NL+ R   EDL ++F + G + +I IP D Y+   +GF FV F D RDAEDA   +D  ++L   E+R
Sbjct:   24 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMD-GRMLDGRELR 95          
BLAST of SMED30019702 vs. Ensembl Fly
Match: SC35 (gene:FBgn0265298 transcript:FBtr0089899)

HSP 1 Score: 50.8322 bits (120), Expect = 2.198e-7
Identity = 31/73 (42.47%), Postives = 43/73 (58.90%), Query Frame = -1
Query:  571 CLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQLLAPAEMR 789
             L V NL+ R   EDL ++F + G + +I IP D Y+   +GF FV F D RDAEDA   +D  ++L   E+R
Sbjct:   24 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMD-GRMLDGRELR 95          
BLAST of SMED30019702 vs. Ensembl Fly
Match: Rsf1 (gene:FBgn0011305 transcript:FBtr0333411)

HSP 1 Score: 50.8322 bits (120), Expect = 2.305e-7
Identity = 28/78 (35.90%), Postives = 47/78 (60.26%), Query Frame = -1
Query:  586 LAVMSRRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQLLA 819
            ++ M  ++ + ++V NL+D+V+ +DLE  F KYG++ ++ I  +       GF FVEFE   DAE A   L+ ++LL 
Sbjct:    1 MSSMGDQRGTRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFN-----PPGFAFVEFEHRDDAEKACDILNGSELLG 73          
BLAST of SMED30019702 vs. Ensembl Fly
Match: Rsf1 (gene:FBgn0011305 transcript:FBtr0080079)

HSP 1 Score: 50.8322 bits (120), Expect = 2.305e-7
Identity = 28/78 (35.90%), Postives = 47/78 (60.26%), Query Frame = -1
Query:  586 LAVMSRRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQLLA 819
            ++ M  ++ + ++V NL+D+V+ +DLE  F KYG++ ++ I  +       GF FVEFE   DAE A   L+ ++LL 
Sbjct:    1 MSSMGDQRGTRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFN-----PPGFAFVEFEHRDDAEKACDILNGSELLG 73          
BLAST of SMED30019702 vs. Ensembl Zebrafish
Match: srsf10b (serine and arginine rich splicing factor 10b [Source:ZFIN;Acc:ZDB-GENE-040426-1415])

HSP 1 Score: 83.9593 bits (206), Expect = 9.656e-19
Identity = 39/67 (58.21%), Postives = 49/67 (73.13%), Query Frame = -1
Query:  604 RRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLD 804
            R  NS LFVRN+SD  R EDL + FG+YG I ++ IPLD+YS R +GF +++FED RDAEDA   LD
Sbjct:    6 RPPNSSLFVRNISDESRPEDLRREFGRYGPIVDVYIPLDFYSRRPRGFAYIQFEDVRDAEDALHNLD 72          
BLAST of SMED30019702 vs. Ensembl Zebrafish
Match: srsf10b (serine and arginine rich splicing factor 10b [Source:ZFIN;Acc:ZDB-GENE-040426-1415])

HSP 1 Score: 83.9593 bits (206), Expect = 9.656e-19
Identity = 39/67 (58.21%), Postives = 49/67 (73.13%), Query Frame = -1
Query:  604 RRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLD 804
            R  NS LFVRN+SD  R EDL + FG+YG I ++ IPLD+YS R +GF +++FED RDAEDA   LD
Sbjct:    6 RPPNSSLFVRNISDESRPEDLRREFGRYGPIVDVYIPLDFYSRRPRGFAYIQFEDVRDAEDALHNLD 72          
BLAST of SMED30019702 vs. Ensembl Zebrafish
Match: CR293507.1 (pep chromosome:GRCz11:16:52536999:52540056:-1 gene:ENSDARG00000112572.1 transcript:ENSDART00000188304.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR293507.1)

HSP 1 Score: 61.6178 bits (148), Expect = 2.409e-12
Identity = 27/59 (45.76%), Postives = 41/59 (69.49%), Query Frame = -1
Query:  643 LAVMSRRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFE 819
            +A   R  N+ LF+RN+SD  R EDL + FG+YG I ++ IP+D+YS R +GF +V++ 
Sbjct:    1 MARYMRPPNTSLFIRNISDDSRPEDLRREFGRYGPIVDVYIPVDFYSRRPRGFAYVQYP 59          
BLAST of SMED30019702 vs. Ensembl Zebrafish
Match: srsf2a (serine and arginine rich splicing factor 2a [Source:ZFIN;Acc:ZDB-GENE-040426-2706])

HSP 1 Score: 57.7658 bits (138), Expect = 2.883e-10
Identity = 31/67 (46.27%), Postives = 41/67 (61.19%), Query Frame = -1
Query:  592 SCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQL 792
            + L V NL+ R   E L ++F KYGR+ ++ IP D Y+   +GF FV F D RDAEDA   +D A L
Sbjct:   14 TSLKVDNLTYRTSPETLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGALL 80          
BLAST of SMED30019702 vs. Ensembl Zebrafish
Match: srsf2a (serine and arginine rich splicing factor 2a [Source:ZFIN;Acc:ZDB-GENE-040426-2706])

HSP 1 Score: 58.5362 bits (140), Expect = 4.693e-10
Identity = 31/67 (46.27%), Postives = 41/67 (61.19%), Query Frame = -1
Query:  592 SCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQL 792
            + L V NL+ R   E L ++F KYGR+ ++ IP D Y+   +GF FV F D RDAEDA   +D A L
Sbjct:   14 TSLKVDNLTYRTSPETLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGALL 80          
BLAST of SMED30019702 vs. Ensembl Xenopus
Match: srsf12 (serine/arginine-rich splicing factor 12 [Source:NCBI gene;Acc:493321])

HSP 1 Score: 80.8777 bits (198), Expect = 2.250e-17
Identity = 34/67 (50.75%), Postives = 50/67 (74.63%), Query Frame = -1
Query:  619 LAVMSRRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDA 819
            ++  SR  N+ LFVRN++D  R EDL + FG+YG I ++ +PLD+Y+ R +GF +++FED RDAEDA
Sbjct:    1 MSRYSRPPNTSLFVRNVADATRPEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYIQFEDVRDAEDA 67          
BLAST of SMED30019702 vs. Ensembl Xenopus
Match: srsf2 (serine/arginine-rich splicing factor 2 [Source:NCBI gene;Acc:394953])

HSP 1 Score: 58.5362 bits (140), Expect = 9.778e-10
Identity = 31/67 (46.27%), Postives = 41/67 (61.19%), Query Frame = -1
Query:  592 SCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQL 792
            + L V NL+ R   E L ++F KYGR+ ++ IP D Y+   +GF FV F D RDAEDA   +D A L
Sbjct:   14 TSLKVDNLTYRTSPETLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVL 80          
BLAST of SMED30019702 vs. Ensembl Xenopus
Match: srsf2 (serine/arginine-rich splicing factor 2 [Source:NCBI gene;Acc:394953])

HSP 1 Score: 58.5362 bits (140), Expect = 1.213e-9
Identity = 31/67 (46.27%), Postives = 41/67 (61.19%), Query Frame = -1
Query:  592 SCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQL 792
            + L V NL+ R   E L ++F KYGR+ ++ IP D Y+   +GF FV F D RDAEDA   +D A L
Sbjct:   14 TSLKVDNLTYRTSPETLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVL 80          
BLAST of SMED30019702 vs. Ensembl Xenopus
Match: srsf12 (serine/arginine-rich splicing factor 12 [Source:NCBI gene;Acc:493321])

HSP 1 Score: 53.1434 bits (126), Expect = 1.178e-7
Identity = 25/58 (43.10%), Postives = 38/58 (65.52%), Query Frame = -1
Query:  619 LFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFE--DFRDAEDA 786
             F  N +   R EDL + FG+YG I ++ +PLD+Y+ R +GF ++++   D RDAEDA
Sbjct:    4 CFKYNNTSIYRPEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYIQYPLFDVRDAEDA 61          
BLAST of SMED30019702 vs. Ensembl Xenopus
Match: hmgn2 (high mobility group nucleosomal binding domain 2 [Source:Xenbase;Acc:XB-GENE-1015271])

HSP 1 Score: 52.7582 bits (125), Expect = 3.418e-7
Identity = 25/47 (53.19%), Postives = 29/47 (61.70%), Query Frame = -1
Query:  646 LFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEF 786
            LFVRNL      +DLEKLF KYG I  I  P+D  + + KGF FV F
Sbjct:  388 LFVRNLPYTCNEDDLEKLFSKYGPISEIHFPIDSLTKKPKGFAFVTF 434          
BLAST of SMED30019702 vs. Ensembl Mouse
Match: Srsf12 (serine/arginine-rich splicing factor 12 [Source:MGI Symbol;Acc:MGI:2661424])

HSP 1 Score: 82.4185 bits (202), Expect = 4.819e-18
Identity = 36/67 (53.73%), Postives = 50/67 (74.63%), Query Frame = -1
Query:  619 LAVMSRRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDA 819
            ++  +R  N+ LFVRN++D  R EDL + FG+YG I ++ IPLD+YS R +GF +V+FED RDAEDA
Sbjct:    1 MSRYTRPPNTSLFVRNVADATRPEDLRREFGRYGPIVDVYIPLDFYSRRPRGFAYVQFEDVRDAEDA 67          
BLAST of SMED30019702 vs. Ensembl Mouse
Match: Srsf10 (serine/arginine-rich splicing factor 10 [Source:MGI Symbol;Acc:MGI:1333805])

HSP 1 Score: 79.337 bits (194), Expect = 1.858e-17
Identity = 36/67 (53.73%), Postives = 49/67 (73.13%), Query Frame = -1
Query:  604 RRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLD 804
            R  N+ LFVRN++D  R EDL + FG+YG I ++ +PLD+Y+ R +GF +V+FED RDAEDA   LD
Sbjct:    6 RPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLD 72          
BLAST of SMED30019702 vs. Ensembl Mouse
Match: Srsf10 (serine/arginine-rich splicing factor 10 [Source:MGI Symbol;Acc:MGI:1333805])

HSP 1 Score: 78.9518 bits (193), Expect = 2.098e-17
Identity = 36/67 (53.73%), Postives = 49/67 (73.13%), Query Frame = -1
Query:  604 RRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLD 804
            R  N+ LFVRN++D  R EDL + FG+YG I ++ +PLD+Y+ R +GF +V+FED RDAEDA   LD
Sbjct:    6 RPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLD 72          
BLAST of SMED30019702 vs. Ensembl Mouse
Match: Srsf10 (serine/arginine-rich splicing factor 10 [Source:MGI Symbol;Acc:MGI:1333805])

HSP 1 Score: 80.1073 bits (196), Expect = 3.744e-17
Identity = 36/67 (53.73%), Postives = 49/67 (73.13%), Query Frame = -1
Query:  604 RRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLD 804
            R  N+ LFVRN++D  R EDL + FG+YG I ++ +PLD+Y+ R +GF +V+FED RDAEDA   LD
Sbjct:    6 RPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLD 72          
BLAST of SMED30019702 vs. Ensembl Mouse
Match: Srsf10 (serine/arginine-rich splicing factor 10 [Source:MGI Symbol;Acc:MGI:1333805])

HSP 1 Score: 80.1073 bits (196), Expect = 3.802e-17
Identity = 36/67 (53.73%), Postives = 49/67 (73.13%), Query Frame = -1
Query:  604 RRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLD 804
            R  N+ LFVRN++D  R EDL + FG+YG I ++ +PLD+Y+ R +GF +V+FED RDAEDA   LD
Sbjct:    6 RPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLD 72          
BLAST of SMED30019702 vs. UniProt/SwissProt
Match: sp|Q8WXF0|SRS12_HUMAN (Serine/arginine-rich splicing factor 12 OS=Homo sapiens OX=9606 GN=SRSF12 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.549e-16
Identity = 34/67 (50.75%), Postives = 50/67 (74.63%), Query Frame = -1
Query:  619 LAVMSRRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDA 819
            ++  +R  N+ LF+RN++D  R EDL + FG+YG I ++ IPLD+Y+ R +GF +V+FED RDAEDA
Sbjct:    1 MSRYTRPPNTSLFIRNVADATRPEDLRREFGRYGPIVDVYIPLDFYTRRPRGFAYVQFEDVRDAEDA 67          
BLAST of SMED30019702 vs. UniProt/SwissProt
Match: sp|Q9R0U0|SRS10_MOUSE (Serine/arginine-rich splicing factor 10 OS=Mus musculus OX=10090 GN=Srsf10 PE=1 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 2.619e-16
Identity = 36/67 (53.73%), Postives = 49/67 (73.13%), Query Frame = -1
Query:  604 RRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLD 804
            R  N+ LFVRN++D  R EDL + FG+YG I ++ +PLD+Y+ R +GF +V+FED RDAEDA   LD
Sbjct:    6 RPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLD 72          
BLAST of SMED30019702 vs. UniProt/SwissProt
Match: sp|O75494|SRS10_HUMAN (Serine/arginine-rich splicing factor 10 OS=Homo sapiens OX=9606 GN=SRSF10 PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 2.619e-16
Identity = 36/67 (53.73%), Postives = 49/67 (73.13%), Query Frame = -1
Query:  604 RRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLD 804
            R  N+ LFVRN++D  R EDL + FG+YG I ++ +PLD+Y+ R +GF +V+FED RDAEDA   LD
Sbjct:    6 RPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLD 72          
BLAST of SMED30019702 vs. UniProt/SwissProt
Match: sp|Q9SEU4|SRC33_ARATH (Serine/arginine-rich SC35-like splicing factor SCL33 OS=Arabidopsis thaliana OX=3702 GN=SCL33 PE=1 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 2.975e-11
Identity = 35/74 (47.30%), Postives = 45/74 (60.81%), Query Frame = -1
Query:  586 SRRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQLLA 807
            SR   + L VRNL    R EDL K F ++G + +I +P DYY+G  +GFGFV+F D  DA DAK  +D   LL 
Sbjct:   31 SRDLPTSLLVRNLRHDCRQEDLRKSFEQFGPVKDIYLPRDYYTGDPRGFGFVQFMDPADAADAKHHMDGYLLLG 104          
BLAST of SMED30019702 vs. UniProt/SwissProt
Match: sp|Q9LHP2|SL30A_ARATH (Serine/arginine-rich SC35-like splicing factor SCL30A OS=Arabidopsis thaliana OX=3702 GN=SCL30A PE=1 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 5.199e-10
Identity = 30/69 (43.48%), Postives = 44/69 (63.77%), Query Frame = -1
Query:  586 SCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQLLA 792
            + L VRNL    R EDL + F ++G + +I +P DYY+G  +GFGF++F D  DA +AK ++D   LL 
Sbjct:   37 TSLLVRNLRHDCRQEDLRRPFEQFGPVKDIYLPRDYYTGDPRGFGFIQFMDPADAAEAKHQMDGYLLLG 105          
BLAST of SMED30019702 vs. TrEMBL
Match: A0A0X3NKY1 (Serine/arginine-rich splicing factor 12 (Fragment) OS=Schistocephalus solidus OX=70667 GN=SRS12 PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 2.082e-19
Identity = 48/99 (48.48%), Postives = 64/99 (64.65%), Query Frame = -1
Query:  559 VMSRRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQLL--------------APAEMRDKGK 813
            +M RR +S L++RN+ D  R+EDL + FG++G I ++ IP DYYSGRMKGF FVEFED RDAEDA   +D ++ L               PAEMRD+ +
Sbjct:   43 IMPRRGSS-LYIRNIPDSCRHEDLRRTFGRFGPIVDVTIPTDYYSGRMKGFAFVEFEDPRDAEDAHRNMDHSRFLGRRIEVEFTRGVRKTPAEMRDRDR 140          
BLAST of SMED30019702 vs. TrEMBL
Match: A0A3M7RMD8 (Serine arginine-rich splicing factor 12 OS=Brachionus plicatilis OX=10195 GN=BpHYR1_048613 PE=4 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 2.460e-19
Identity = 41/70 (58.57%), Postives = 56/70 (80.00%), Query Frame = -1
Query:  586 NSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQLLA 795
            ++ L++RN+SDRVRY+DL +LF KYGR+ ++ IPLDYYSG  KGF FVE+ED RDAE+A+ R+D  +L  
Sbjct:    9 STTLYIRNISDRVRYDDLRRLFAKYGRVLDVTIPLDYYSGLPKGFCFVEYEDPRDAEEAQYRMDRQRLFG 78          
BLAST of SMED30019702 vs. TrEMBL
Match: A0A5K3F0B4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.119e-18
Identity = 42/92 (45.65%), Postives = 59/92 (64.13%), Query Frame = -1
Query:  565 KNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQLLA--------------PAEMRDK 798
            +   +++RN+ D  R+EDL + FG++G + ++ IP DYYSGRMKGF FVEFED RDAEDA+  +D ++ L               PAEMRD+
Sbjct:    3 RRCSIYIRNIPDSCRHEDLRRTFGRFGPVVDVTIPTDYYSGRMKGFAFVEFEDPRDAEDAQRSMDHSRFLGRRIEVEFTRGYRKTPAEMRDR 94          
BLAST of SMED30019702 vs. TrEMBL
Match: A0A4S2M8F8 (RRM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001993 PE=4 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.411e-18
Identity = 48/94 (51.06%), Postives = 60/94 (63.83%), Query Frame = -1
Query:  571 MSRRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQLLA--------------PAEMR 810
            M RR NS L+VR+L D  R+EDL + FG+YGRI +I IPLD+ +GRMKGF F+EFED RDAEDA   +D  + +               PAEMR
Sbjct:    1 MPRRANS-LYVRHLPDSCRHEDLRRAFGRYGRIIDITIPLDFNTGRMKGFAFIEFEDPRDAEDAHYNMDHTRFMGRDIEVEFTRGYRKTPAEMR 93          
BLAST of SMED30019702 vs. TrEMBL
Match: A0A0V0J7Y2 (Serine/arginine-rich splicing factor 10 (Fragment) OS=Schistocephalus solidus OX=70667 GN=SRS10 PE=4 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 4.688e-18
Identity = 49/112 (43.75%), Postives = 65/112 (58.04%), Query Frame = -1
Query:  559 VMSRRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQLL---------------------------APAEMRDKGK 813
            +M RR +S L++RN+ D  R+EDL + FG++G I ++ IP DYYSGRMKGF FVEFED RDAEDA   +D ++ L                           APAEMRD+ +
Sbjct:   43 IMPRRGSS-LYIRNIPDSCRHEDLRRTFGRFGPIVDVTIPTDYYSGRMKGFAFVEFEDPRDAEDAHRNMDHSRFLGRRIEVEFTRGVRKSKNVSFPSYLNLPAPAEMRDRDR 153          
BLAST of SMED30019702 vs. Ensembl Cavefish
Match: srsf10b (serine/arginine-rich splicing factor 10-like [Source:NCBI gene;Acc:103044580])

HSP 1 Score: 88.1965 bits (217), Expect = 4.245e-20
Identity = 40/72 (55.56%), Postives = 52/72 (72.22%), Query Frame = -1
Query:  604 LAVMSRRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLD 819
            +A   R +NS LF+RN+SD  R EDL + FG+YG I ++ IPLDY+S R +GF +V+FED RDAEDA   LD
Sbjct:    1 MAKYMRAQNSSLFIRNISDDSRPEDLRREFGRYGPITDVYIPLDYHSRRPRGFAYVQFEDVRDAEDAMHSLD 72          
BLAST of SMED30019702 vs. Ensembl Cavefish
Match: ENSAMXT00000041856.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000064.1:767504:770050:1 gene:ENSAMXG00000031867.1 transcript:ENSAMXT00000041856.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 5.342e-12
Identity = 26/59 (44.07%), Postives = 41/59 (69.49%), Query Frame = -1
Query:  643 LAVMSRRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFE 819
            +A   R  N+ LF+RN+SD  R EDL + FG+YG I ++ IP+D+YS R +GF ++++ 
Sbjct:    1 MARYLRPPNTSLFIRNISDESRPEDLRREFGRYGPIVDVYIPVDFYSRRPRGFAYIQYP 59          
BLAST of SMED30019702 vs. Ensembl Cavefish
Match: srsf2a (serine/arginine-rich splicing factor 2-like [Source:NCBI gene;Acc:103027270])

HSP 1 Score: 58.151 bits (139), Expect = 8.967e-10
Identity = 31/67 (46.27%), Postives = 41/67 (61.19%), Query Frame = -1
Query:  592 SCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQL 792
            + L V NL+ R   E L ++F KYGR+ ++ IP D Y+   +GF FV F D RDAEDA   +D A L
Sbjct:   14 TSLKVDNLTYRTSPETLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGALL 80          
BLAST of SMED30019702 vs. Ensembl Cavefish
Match: elavl3 (ELAV like RNA binding protein 3 [Source:NCBI gene;Acc:103029670])

HSP 1 Score: 51.9878 bits (123), Expect = 2.413e-7
Identity = 23/62 (37.10%), Postives = 36/62 (58.06%), Query Frame = -1
Query:  604 CLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLD 789
            C+FV NLS       L +LFG +G + N+K+  D+ + + KGFGFV   ++ +A  A   L+
Sbjct:  270 CIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLN 331          

HSP 2 Score: 50.447 bits (119), Expect = 8.631e-7
Identity = 25/74 (33.78%), Postives = 44/74 (59.46%), Query Frame = -1
Query:  577 KNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQLLAPAE 798
            +++ L+V  L   +  +D+E+LF +YGRI   +I +D  +G  +G GF+ F+   +AE+A   L+  + L  AE
Sbjct:  122 RDANLYVSGLPKTMSQKDMEQLFSQYGRIITSRILVDQVTGISRGVGFIRFDKRNEAEEAIKGLNGQKPLGAAE 195          
BLAST of SMED30019702 vs. Ensembl Cavefish
Match: elavl3 (ELAV like RNA binding protein 3 [Source:NCBI gene;Acc:103029670])

HSP 1 Score: 51.9878 bits (123), Expect = 2.577e-7
Identity = 23/62 (37.10%), Postives = 36/62 (58.06%), Query Frame = -1
Query:  604 CLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLD 789
            C+FV NLS       L +LFG +G + N+K+  D+ + + KGFGFV   ++ +A  A   L+
Sbjct:  283 CIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLN 344          

HSP 2 Score: 50.447 bits (119), Expect = 9.288e-7
Identity = 25/74 (33.78%), Postives = 44/74 (59.46%), Query Frame = -1
Query:  577 KNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQLLAPAE 798
            +++ L+V  L   +  +D+E+LF +YGRI   +I +D  +G  +G GF+ F+   +AE+A   L+  + L  AE
Sbjct:  122 RDANLYVSGLPKTMSQKDMEQLFSQYGRIITSRILVDQVTGISRGVGFIRFDKRNEAEEAIKGLNGQKPLGAAE 195          
BLAST of SMED30019702 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002832.1 (pep scaffold:Pmarinus_7.0:GL476732:699988:701739:-1 gene:ENSPMAG00000002585.1 transcript:ENSPMAT00000002832.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 1.257e-8
Identity = 23/67 (34.33%), Postives = 41/67 (61.19%), Query Frame = -1
Query:  586 LFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQLLA 786
            LFV  + +  + +D+   FG++G I N+ + LD  +G +KG+  VE+E F++A+ A   L+ A +L 
Sbjct:   12 LFVTGVHEEAQEDDMHDKFGEFGEIKNVHLNLDRRTGFLKGYALVEYETFKEAQAAMEGLNGADILG 78          
BLAST of SMED30019702 vs. Ensembl Sea Lamprey
Match: tra2b (transformer 2 beta homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1094])

HSP 1 Score: 51.9878 bits (123), Expect = 3.692e-8
Identity = 25/68 (36.76%), Postives = 42/68 (61.76%), Query Frame = -1
Query:  592 NSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQL 795
            N+CL V  LS      DL ++FG+YG + ++ +  D  SGR +GF FV  ++  D+++AK R++  +L
Sbjct:  105 NTCLGVFGLSLYTTEHDLREVFGRYGPVADVNVVYDQQSGRPRGFAFVYMQNMEDSKEAKERVNGMEL 172          
BLAST of SMED30019702 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000820.1 (pep scaffold:Pmarinus_7.0:GL483865:282:6617:-1 gene:ENSPMAG00000000738.1 transcript:ENSPMAT00000000820.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 6.249e-8
Identity = 25/73 (34.25%), Postives = 42/73 (57.53%), Query Frame = -1
Query:  592 MSRRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQL 810
            M+      L+V  L++ V  + L   F  +G I +I++PLDY + + +GFGFVEFE   D+  A   ++ ++L
Sbjct:    1 MAASNKRILYVGGLAEEVDEKVLHAAFIPFGDIVDIQMPLDYETEKHRGFGFVEFEAAEDSAAAIDNMNESEL 73          
BLAST of SMED30019702 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007448.1 (pep scaffold:Pmarinus_7.0:GL479027:131562:138944:-1 gene:ENSPMAG00000006727.1 transcript:ENSPMAT00000007448.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 6.455e-8
Identity = 24/67 (35.82%), Postives = 36/67 (53.73%), Query Frame = -1
Query:  586 LFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQLLA 786
            L++R L      +DL KL   YG+I + K  LD  + + KG+GFV+F+    A+ A T L    + A
Sbjct:   57 LYIRGLPPHTSDQDLVKLCHPYGKIVSTKAILDKTTNQCKGYGFVDFDSPTAAQKAVTALKATGIQA 123          
BLAST of SMED30019702 vs. Ensembl Sea Lamprey
Match: SRSF5 (serine and arginine rich splicing factor 5 [Source:HGNC Symbol;Acc:HGNC:10787])

HSP 1 Score: 50.8322 bits (120), Expect = 1.119e-7
Identity = 28/65 (43.08%), Postives = 39/65 (60.00%), Query Frame = -1
Query:  592 LFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQL 786
            +F+  L   VR +D+EK F  YG+I +I I          GFGFVEF+D RDA+DA + L+  +L
Sbjct:    7 VFIARLGPHVRTKDVEKFFKGYGKIRDIDI--------KAGFGFVEFDDCRDADDAVSDLNGREL 63          
BLAST of SMED30019702 vs. Ensembl Yeast
Match: MRD1 (Essential conserved small ribosomal subunit (40s) synthesis factor; component of the 90S preribosome; required for production of 18S rRNA and small ribosomal subunit; contains five consensus RNA-binding domains and binds to the pre-rRNA at two sites within the 18S region [Source:SGD;Acc:S000006316])

HSP 1 Score: 49.6766 bits (117), Expect = 2.578e-7
Identity = 25/72 (34.72%), Postives = 41/72 (56.94%), Query Frame = -1
Query:  604 LAVMSRRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLD 819
            LA+    +   LF+RN+    + ED  KLF  +G +  + + LD  +G+ KGF +V F+D ++A +A   LD
Sbjct:  336 LAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELD 407          
BLAST of SMED30019702 vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 46.595 bits (109), Expect = 2.281e-6
Identity = 28/69 (40.58%), Postives = 39/69 (56.52%), Query Frame = -1
Query:  613 LAVMSRRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKT 819
            L  M++ +   LFV+NL D V  E LE+ F  YG I + K+ +   +G+ KGFGFV F    +A  A T
Sbjct:  313 LEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKV-MRTENGKSKGFGFVCFSTPEEATKAIT 380          

HSP 2 Score: 44.669 bits (104), Expect = 9.714e-6
Identity = 23/67 (34.33%), Postives = 39/67 (58.21%), Query Frame = -1
Query:  592 SCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQL 792
            + L+V+N++     E  ++LF K+G I +  +  D   G++KGFGFV +E   DA  A   L+ ++L
Sbjct:  219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDA-DGKLKGFGFVNYEKHEDAVKAVEALNDSEL 284          
BLAST of SMED30019702 vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 45.4394 bits (106), Expect = 4.822e-6
Identity = 24/65 (36.92%), Postives = 38/65 (58.46%), Query Frame = -1
Query:  595 CLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQ 789
             LF+ NLS     + + +LF K+G + +++IP    + + KGFG+V+F +    EDAK  LD  Q
Sbjct:  268 TLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNM---EDAKKALDALQ 329          
BLAST of SMED30019702 vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 45.0542 bits (105), Expect = 6.921e-6
Identity = 22/53 (41.51%), Postives = 34/53 (64.15%), Query Frame = -1
Query:  643 KNSC-LFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFE 798
            K SC +F+  L+     ++L + FGKYG + ++KI  D  +GR +GFGF+ FE
Sbjct:  156 KESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFE 208          
BLAST of SMED30019702 vs. Ensembl Nematostella
Match: EDO49282 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH27])

HSP 1 Score: 77.0258 bits (188), Expect = 4.223e-18
Identity = 40/76 (52.63%), Postives = 51/76 (67.11%), Query Frame = -1
Query:  586 SRRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFG--FVEFEDFRDAEDAKTRLDVAQLLA 807
            SR  NS ++VRNL    R +DL ++FGKYGRI ++ IPLDYY+   +GF   ++ FED RDAEDA   LD A LL 
Sbjct:    5 SRPPNSSIYVRNLHPDTRPDDLRRMFGKYGRITDVYIPLDYYTREPRGFCYIYITFEDIRDAEDALYYLDRAMLLG 80          
BLAST of SMED30019702 vs. Ensembl Nematostella
Match: EDO30149 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1M0])

HSP 1 Score: 56.225 bits (134), Expect = 1.729e-10
Identity = 25/67 (37.31%), Postives = 43/67 (64.18%), Query Frame = -1
Query:  586 LFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQLLA 786
            LFV N+ +  + +D+ +LF  YG I N+ + LD  +G +KG+  VE+E F++A+ A   L+ A++L 
Sbjct:    7 LFVTNIHEEAQEDDIHELFSDYGEIKNLHVNLDRRTGFIKGYALVEYETFKEAQSALEALNGAEMLG 73          
BLAST of SMED30019702 vs. Ensembl Nematostella
Match: EDO45702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS89])

HSP 1 Score: 56.6102 bits (135), Expect = 2.645e-10
Identity = 25/68 (36.76%), Postives = 43/68 (63.24%), Query Frame = -1
Query:  586 CLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQLLA 789
             LFV N+ +  + +D+ +LF  YG I N+ + LD  +G +KG+  VE+E F++A+ A   L+ A++L 
Sbjct:   39 ILFVTNIHEEAQEDDIHELFSDYGEIKNLHVNLDRRTGFIKGYALVEYETFKEAQSALEALNGAEMLG 106          
BLAST of SMED30019702 vs. Ensembl Nematostella
Match: EDO47928 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKL6])

HSP 1 Score: 55.4546 bits (132), Expect = 2.692e-10
Identity = 25/67 (37.31%), Postives = 43/67 (64.18%), Query Frame = -1
Query:  586 LFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQLLA 786
            LFV N+ +  + +D+ +LF  YG I N+ + LD  +G +KG+  VE+E F++A+ A   L+ A++L 
Sbjct:    7 LFVTNIHEEAQEDDIHELFSDYGEIKNLHVNLDRRTGFIKGYALVEYETFKEAQSALEALNGAEMLG 73          
BLAST of SMED30019702 vs. Ensembl Nematostella
Match: EDO44802 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUS7])

HSP 1 Score: 54.299 bits (129), Expect = 5.868e-9
Identity = 30/66 (45.45%), Postives = 39/66 (59.09%), Query Frame = -1
Query:  592 CLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQL 789
            CL V  LS      DL  +F KYG +  I+I  D+ +GR +GFGFV +ED +DAE AK R    +L
Sbjct:   96 CLGVFGLSLYTTERDLRPVFEKYGPVEAIQIVYDHQTGRSRGFGFVYYEDTKDAEVAKERTTGIEL 161          
BLAST of SMED30019702 vs. Ensembl Medaka
Match: srsf10b (serine and arginine rich splicing factor 10 [Source:NCBI gene;Acc:101171844])

HSP 1 Score: 80.4925 bits (197), Expect = 1.573e-17
Identity = 37/72 (51.39%), Postives = 51/72 (70.83%), Query Frame = -1
Query:  604 LAVMSRRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLD 819
            +A   R  N+ LFVRN+SD  R EDL + FG+YG I ++ IPLD+Y+ + +GF +++FED RDAEDA   LD
Sbjct:    1 MARYMRPPNTSLFVRNISDESRPEDLRREFGRYGPIVDVYIPLDFYTRQPRGFAYIQFEDVRDAEDALHSLD 72          
BLAST of SMED30019702 vs. Ensembl Medaka
Match: srsf2a (serine/arginine-rich splicing factor 2 [Source:NCBI gene;Acc:100049528])

HSP 1 Score: 57.3806 bits (137), Expect = 1.906e-9
Identity = 32/67 (47.76%), Postives = 41/67 (61.19%), Query Frame = -1
Query:  592 SCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQL 792
            + L V NL+ R   E L ++F KYGR+ ++ IP D YS   +GF FV F D RDAEDA   +D A L
Sbjct:   14 TSLKVDNLTYRTSPETLRRVFEKYGRVGDVYIPRDRYSKESRGFAFVRFFDKRDAEDAMDAMDGALL 80          
BLAST of SMED30019702 vs. Ensembl Medaka
Match: srsf2a (serine/arginine-rich splicing factor 2 [Source:NCBI gene;Acc:100049528])

HSP 1 Score: 57.3806 bits (137), Expect = 1.906e-9
Identity = 32/67 (47.76%), Postives = 41/67 (61.19%), Query Frame = -1
Query:  592 SCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQL 792
            + L V NL+ R   E L ++F KYGR+ ++ IP D YS   +GF FV F D RDAEDA   +D A L
Sbjct:   14 TSLKVDNLTYRTSPETLRRVFEKYGRVGDVYIPRDRYSKESRGFAFVRFFDKRDAEDAMDAMDGALL 80          
BLAST of SMED30019702 vs. Ensembl Medaka
Match: ENSORLT00000001514.2 (serine/arginine-rich splicing factor 2 [Source:NCBI gene;Acc:101163660])

HSP 1 Score: 56.9954 bits (136), Expect = 2.040e-9
Identity = 32/67 (47.76%), Postives = 40/67 (59.70%), Query Frame = -1
Query:  592 SCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQL 792
            + L V NL+ R   E L  +F KYGR+ +I IP D Y+   +GF FV F D RDAEDA   +D A L
Sbjct:   14 TSLKVDNLTYRTSPETLRYVFEKYGRVGDIYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGALL 80          
BLAST of SMED30019702 vs. Ensembl Medaka
Match: srsf5a (serine and arginine rich splicing factor 5 [Source:NCBI gene;Acc:101161448])

HSP 1 Score: 52.373 bits (124), Expect = 1.305e-7
Identity = 30/69 (43.48%), Postives = 40/69 (57.97%), Query Frame = -1
Query:  586 SCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQLLA 792
            S +F+  LS + R  D+EK F  YGRI  I +          GFGFVEF+D RDA+DA   L+  +LL+
Sbjct:    4 SRVFIGRLSPQARERDVEKFFKGYGRIREINL--------KNGFGFVEFDDHRDADDAVYELNGKELLS 64          
BLAST of SMED30019702 vs. Planmine SMEST
Match: SMESG000016033.1 (SMESG000016033.1)

HSP 1 Score: 155.606 bits (392), Expect = 3.098e-47
Identity = 81/100 (81.00%), Postives = 81/100 (81.00%), Query Frame = -1
Query:  553 MSRRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQLLA--------------PAEMRDKGKTT 810
            MSRRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGF  FEDFRDAEDAKTRLD AQLL               PAEMRDK KTT
Sbjct:    1 MSRRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFCTFEDFRDAEDAKTRLDGAQLLGREIGVEFTNGYKKTPAEMRDKEKTT 100          
BLAST of SMED30019702 vs. Planmine SMEST
Match: SMESG000078309.1 (SMESG000078309.1)

HSP 1 Score: 68.9366 bits (167), Expect = 8.428e-15
Identity = 30/65 (46.15%), Postives = 47/65 (72.31%), Query Frame = -1
Query:  607 RKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRL 801
            R  + ++V N+ + +R ++L+++FG+YG I    +P+DYYSG  KGF FV+FED RDAE++  RL
Sbjct:    3 RSTTTIYVGNIPEDLRRDELKRIFGRYGNIVAATLPVDYYSGIPKGFAFVQFEDIRDAEESFDRL 67          
BLAST of SMED30019702 vs. Planmine SMEST
Match: SMESG000052090.1 (SMESG000052090.1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.381e-8
Identity = 26/67 (38.81%), Postives = 40/67 (59.70%), Query Frame = -1
Query:  586 LFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAKTRLDVAQLLA 786
            L++  L+D V  E L+  F K+G I NI IP+DY + + +GFGF+E+E   DA  A   ++  +L  
Sbjct:   20 LYIGGLADEVTEEILQNNFIKFGDITNISIPIDYSTQKHRGFGFIEYELVEDAAAAIDNMNDGELCG 86          
BLAST of SMED30019702 vs. Planmine SMEST
Match: SMESG000031644.1 (SMESG000031644.1)

HSP 1 Score: 53.5286 bits (127), Expect = 3.242e-8
Identity = 24/62 (38.71%), Postives = 42/62 (67.74%), Query Frame = -1
Query:  616 RKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAK 801
            + ++C+ V  LS +   +DL ++F KYG I ++++ LD Y+GR +GFGF+ +E+   A +AK
Sbjct:   85 KPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAK 146          
BLAST of SMED30019702 vs. Planmine SMEST
Match: SMESG000031644.1 (SMESG000031644.1)

HSP 1 Score: 53.5286 bits (127), Expect = 3.369e-8
Identity = 24/62 (38.71%), Postives = 42/62 (67.74%), Query Frame = -1
Query:  616 RKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFVEFEDFRDAEDAK 801
            + ++C+ V  LS +   +DL ++F KYG I ++++ LD Y+GR +GFGF+ +E+   A +AK
Sbjct:   84 KPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAK 145          
The following BLAST results are available for this feature:
BLAST of SMED30019702 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SRSF102.335e-1753.73serine and arginine rich splicing factor 10 [Sourc... [more]
SRSF102.462e-1753.73serine and arginine rich splicing factor 10 [Sourc... [more]
SRSF102.474e-1753.73serine and arginine rich splicing factor 10 [Sourc... [more]
SRSF102.706e-1753.73serine and arginine rich splicing factor 10 [Sourc... [more]
SRSF103.056e-1753.73serine and arginine rich splicing factor 10 [Sourc... [more]
back to top
BLAST of SMED30019702 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rsp-46.394e-943.24Probable splicing factor, arginine/serine-rich 4 ... [more]
rsp-41.986e-843.24Probable splicing factor, arginine/serine-rich 4 ... [more]
rsp-31.746e-751.79Probable splicing factor, arginine/serine-rich 3 ... [more]
rsp-31.746e-751.79Probable splicing factor, arginine/serine-rich 3 ... [more]
rsp-31.746e-751.79Probable splicing factor, arginine/serine-rich 3 ... [more]
back to top
BLAST of SMED30019702 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SC352.198e-742.47gene:FBgn0265298 transcript:FBtr0306252[more]
SC352.198e-742.47gene:FBgn0265298 transcript:FBtr0302910[more]
SC352.198e-742.47gene:FBgn0265298 transcript:FBtr0089899[more]
Rsf12.305e-735.90gene:FBgn0011305 transcript:FBtr0333411[more]
Rsf12.305e-735.90gene:FBgn0011305 transcript:FBtr0080079[more]
back to top
BLAST of SMED30019702 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
srsf10b9.656e-1958.21serine and arginine rich splicing factor 10b [Sour... [more]
srsf10b9.656e-1958.21serine and arginine rich splicing factor 10b [Sour... [more]
CR293507.12.409e-1245.76pep chromosome:GRCz11:16:52536999:52540056:-1 gene... [more]
srsf2a2.883e-1046.27serine and arginine rich splicing factor 2a [Sourc... [more]
srsf2a4.693e-1046.27serine and arginine rich splicing factor 2a [Sourc... [more]
back to top
BLAST of SMED30019702 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
srsf122.250e-1750.75serine/arginine-rich splicing factor 12 [Source:NC... [more]
srsf29.778e-1046.27serine/arginine-rich splicing factor 2 [Source:NCB... [more]
srsf21.213e-946.27serine/arginine-rich splicing factor 2 [Source:NCB... [more]
srsf121.178e-743.10serine/arginine-rich splicing factor 12 [Source:NC... [more]
hmgn23.418e-753.19high mobility group nucleosomal binding domain 2 [... [more]
back to top
BLAST of SMED30019702 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Srsf124.819e-1853.73serine/arginine-rich splicing factor 12 [Source:MG... [more]
Srsf101.858e-1753.73serine/arginine-rich splicing factor 10 [Source:MG... [more]
Srsf102.098e-1753.73serine/arginine-rich splicing factor 10 [Source:MG... [more]
Srsf103.744e-1753.73serine/arginine-rich splicing factor 10 [Source:MG... [more]
Srsf103.802e-1753.73serine/arginine-rich splicing factor 10 [Source:MG... [more]
back to top
BLAST of SMED30019702 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8WXF0|SRS12_HUMAN1.549e-1650.75Serine/arginine-rich splicing factor 12 OS=Homo sa... [more]
sp|Q9R0U0|SRS10_MOUSE2.619e-1653.73Serine/arginine-rich splicing factor 10 OS=Mus mus... [more]
sp|O75494|SRS10_HUMAN2.619e-1653.73Serine/arginine-rich splicing factor 10 OS=Homo sa... [more]
sp|Q9SEU4|SRC33_ARATH2.975e-1147.30Serine/arginine-rich SC35-like splicing factor SCL... [more]
sp|Q9LHP2|SL30A_ARATH5.199e-1043.48Serine/arginine-rich SC35-like splicing factor SCL... [more]
back to top
BLAST of SMED30019702 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3NKY12.082e-1948.48Serine/arginine-rich splicing factor 12 (Fragment)... [more]
A0A3M7RMD82.460e-1958.57Serine arginine-rich splicing factor 12 OS=Brachio... [more]
A0A5K3F0B41.119e-1845.65Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A4S2M8F81.411e-1851.06RRM domain-containing protein OS=Opisthorchis feli... [more]
A0A0V0J7Y24.688e-1843.75Serine/arginine-rich splicing factor 10 (Fragment)... [more]
back to top
BLAST of SMED30019702 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
srsf10b4.245e-2055.56serine/arginine-rich splicing factor 10-like [Sour... [more]
ENSAMXT00000041856.15.342e-1244.07pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
srsf2a8.967e-1046.27serine/arginine-rich splicing factor 2-like [Sourc... [more]
elavl32.413e-737.10ELAV like RNA binding protein 3 [Source:NCBI gene;... [more]
elavl32.577e-737.10ELAV like RNA binding protein 3 [Source:NCBI gene;... [more]
back to top
BLAST of SMED30019702 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002832.11.257e-834.33pep scaffold:Pmarinus_7.0:GL476732:699988:701739:-... [more]
tra2b3.692e-836.76transformer 2 beta homolog [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000000820.16.249e-834.25pep scaffold:Pmarinus_7.0:GL483865:282:6617:-1 gen... [more]
ENSPMAT00000007448.16.455e-835.82pep scaffold:Pmarinus_7.0:GL479027:131562:138944:-... [more]
SRSF51.119e-743.08serine and arginine rich splicing factor 5 [Source... [more]
back to top
BLAST of SMED30019702 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
MRD12.578e-734.72Essential conserved small ribosomal subunit (40s) ... [more]
PAB12.281e-640.58Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
NSR14.822e-636.92Nucleolar protein that binds nuclear localization ... [more]
HRP16.921e-641.51Subunit of cleavage factor I; cleavage factor I is... [more]
back to top
BLAST of SMED30019702 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO492824.223e-1852.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301491.729e-1037.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457022.645e-1036.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479282.692e-1037.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448025.868e-945.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30019702 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
srsf10b1.573e-1751.39serine and arginine rich splicing factor 10 [Sourc... [more]
srsf2a1.906e-947.76serine/arginine-rich splicing factor 2 [Source:NCB... [more]
srsf2a1.906e-947.76serine/arginine-rich splicing factor 2 [Source:NCB... [more]
ENSORLT00000001514.22.040e-947.76serine/arginine-rich splicing factor 2 [Source:NCB... [more]
srsf5a1.305e-743.48serine and arginine rich splicing factor 5 [Source... [more]
back to top
BLAST of SMED30019702 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016033.13.098e-4781.00SMESG000016033.1[more]
SMESG000078309.18.428e-1546.15SMESG000078309.1[more]
SMESG000052090.11.381e-838.81SMESG000052090.1[more]
SMESG000031644.13.242e-838.71SMESG000031644.1[more]
SMESG000031644.13.369e-838.71SMESG000031644.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019702 ID=SMED30019702|Name=SMED30019702|organism=Schmidtea mediterranea sexual|type=transcript|length=846bp
ACTTTGACTTAATGCTATTGCAATTCAGAATGGTATTGTTTGATCCGTTG
CTAAGCAACCAGTAGACTAATACAGCTCAACACGCACTAAATAGCCAACC
AAATCTCACTCATTATCGCAACATCAGCGGAAAGGTGCAATTCACTGTCT
AGCTGACAACAATAACCATTGACAACCTCAATATAAAATAACAACAACTC
ATCATCAATATAGGTAAATGGCATTCATAATTGAATAAATTTCATTCTAG
CAAAACTCAAGAAACAAGTGAAAATTACAACGCAAAACACGGCTAAAATC
GGCTAAATTGAATATTTCACTTTTGACTGCACTCAAAATCATAAATGCTT
TAATATTTATTAATAACAAATGAGCAAATAACTAGAAATATTATTGAGAA
GGAGAACGAGAATAATCACTTCTGCTGTTACGGGAATTCCTTCTGGGAGA
GTCACGTCTACGGCGGACAGGACTACTGCGGCGGGGAGAATAAGACCTTG
GGCGGTTGTTACGAGATCTTGACATGGAACGACTTCGTCCTCTGCTACGT
TTGGTGGTTTTTCCTTTGTCTCTCATTTCAGCTGGGGCTAAAAGCTGTGC
AACATCTAATCGTGTCTTAGCATCTTCTGCGTCTCTAAAATCTTCAAACT
CAACAAAGCCAAAGCCTTTCATTCGTCCCGAGTAATAATCAAGAGGAATC
TTAATATTATATATTCTTCCATATTTACCAAATAATTTTTCCAAGTCTTC
ATATCGAACTCGATCTGATAAATTCCTAACGAACAAACATGAATTTTTTC
TCCTAGACATTACAGCAAGAATAGTAAACACAAGTTAATATATTTA
back to top

protein sequence of SMED30019702-orf-1

>SMED30019702-orf-1 ID=SMED30019702-orf-1|Name=SMED30019702-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=140bp
MSRRKNSCLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGF
GFVEFEDFRDAEDAKTRLDVAQLLAPAEMRDKGKTTKRSRGRSRSMSRSR
NNRPRSYSPRRSSPVRRRRDSPRRNSRNSRSDYSRSPSQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 8..77
e-value: 2.3E-17
score: 73.7
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 9..73
e-value: 4.3E-19
score: 68.1
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 7..91
score: 17.148
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 1..141
e-value: 1.6E-21
score: 78.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 69..143
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 89..128
NoneNo IPR availablePANTHERPTHR23147:SF95AT22957Pcoord: 2..116
NoneNo IPR availablePANTHERPTHR23147SERINE/ARGININE RICH SPLICING FACTORcoord: 2..116
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 4..116