Tripartite motif-containing protein 3-like

Overview
NameTripartite motif-containing protein 3-like
Smed IDSMED30019696
Length (bp)1676
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tripartite motif-containing protein 3-like (SMED30019696) t-SNE clustered cells

Violin plots show distribution of expression levels for Tripartite motif-containing protein 3-like (SMED30019696) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tripartite motif-containing protein 3-like (SMED30019696) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tripartite motif-containing protein 3-like (SMED30019696) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019696

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30019696SMESG000029727.1 dd_Smed_v4_12812_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019696SMESG000029727.1 dd_Smed_v4_12812_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30019696SMESG000029727.1 dd_Smed_v4_12812_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30019696SMESG000029727.1 dd_Smed_v4_12812_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Human
Match: TRIM3 (tripartite motif containing 3 [Source:HGNC Symbol;Acc:HGNC:10064])

HSP 1 Score: 245.358 bits (625), Expect = 9.646e-73
Identity = 141/461 (30.59%), Postives = 236/461 (51.19%), Query Frame = 1
Query:  382 PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERGILDPKVHIELKNLARPHCDIFDREIPHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTLIGSVMPLNKP----------------------MVILKPSE-----------PTNLDYLYKIGSKGFKPCDFGNPQSI-ITSGDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            P EN   QL+   +++D + + +   G +  TS  A  +    +G+   L V +   +++  KD DG+LV   G  + +  I   +  R    + D +     +L       GE  L+V      ++GSPF  + ++ P + P                        + +PS            P   + ++++GS+G +  +F N Q +   S  RI+V DS N CIQ++S  G++   FG + +  G+L RP  +A  TNG  +V D++ + + ++   G + +  G   L+GPKG+ VD+ G IIV DNK   +  F+  GK + +      +D   AGPHF+ + +  +I+VTDF+NH VKV+  +G +  +FG HG+  G+FN PTG+      +I+V+DWGNSRI +F++       + +  EPL GPQG+ LT+ G  +++ D+GNHCFK ++Y
Sbjct:  171 PHENA--QLELV-LEVDGLRRSVLNLGALLTTSATAHETVATGEGLRQAL-VGQPASLTVTTKDKDGRLV-RTGSAELRAEITGPDGTRLPVPVVDHK-NGTYELVYTARTEGELLLSVLLYGQPVRGSPFR-VRALRPGDLPPSPDDVKRRVKSPGGPGSHVRQKAVRRPSSMYSTGGKRKDNPIEDELVFRVGSRGREKGEFTNLQGVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGVAVDTNGDIIVADYDNRWVSIFSPEGKFKTKIGAGRLMGPKGVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDSSGSFLSYINTSAEPLYGPQGLALTSDG-HVVVADAGNHCFKAYRY 623          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Human
Match: TRIM2 (tripartite motif containing 2 [Source:HGNC Symbol;Acc:HGNC:15974])

HSP 1 Score: 245.358 bits (625), Expect = 9.674e-72
Identity = 160/548 (29.20%), Postives = 269/548 (49.09%), Query Frame = 1
Query:  229 SFQMLHNALNVRQNQIL---------------SQLNNLMNSDN--ENEEGHERKWGNEGNETEI-----------------NFRL-PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLV-TERGILDPKVHIELKNLARPHCDIFDREI----PHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTL----IGSVMPLN---------------KPMVILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITSGD-RILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            +F  L   LNVR++ +L               SQL+ L+      ++      +  N G ETE+                 +F L P EN  +QL F  ++ + + K I   GTI  T+  A  +    +G+   + + + + +++  KD DG+L  T    L  +       L+ P   + D EI        +    + + G++ L+++  +  I+GSPF L       V P                 K   + +P+           P   D ++++G+KG    +F N Q +  S + +IL+ DS N C+QI+S  G++ + FG + +  G+L RP  +A   +G  ++ D++ K + ++   G + +  G   L+GPKG+ VD+ G IIV DNK   +  F+  GK + +       D + AGPHF  + S  +I++TDF+NH VKVF++ G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG+ LT+ G  +++ DSGNHCFKV++Y
Sbjct:  207 TFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPREN--DQLDFI-VETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTI-IGQPMSVTITTKDKDGELCKTGNAYLTAE-------LSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSSDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDG-HVVVADSGNHCFKVYRY 742          

HSP 2 Score: 66.2402 bits (160), Expect = 9.554e-11
Identity = 46/172 (26.74%), Postives = 77/172 (44.77%), Query Frame = 1
Query: 1168 KGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN-NRFMCTRI--LKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK*SF 1674
            +G+     G+I++AD+ +  +  F   G+F  +     RS  +L  P  + +  +GDI++ D+ N  V +F  +G ++ + G      G+   P G+       I+V D     + IF  N  + TR     + +    GP      NS  EI+I D  NH  KVF  +  F
Sbjct:  490 QGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSSDGKFKTKIGS-----GKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPH-FAAVNSNNEIIITDFHNHSVKVFNQEGEF 655          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Human
Match: TRIM3 (tripartite motif containing 3 [Source:HGNC Symbol;Acc:HGNC:10064])

HSP 1 Score: 244.588 bits (623), Expect = 1.073e-71
Identity = 141/461 (30.59%), Postives = 236/461 (51.19%), Query Frame = 1
Query:  382 PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERGILDPKVHIELKNLARPHCDIFDREIPHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTLIGSVMPLNKP----------------------MVILKPSE-----------PTNLDYLYKIGSKGFKPCDFGNPQSI-ITSGDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            P EN   QL+   +++D + + +   G +  TS  A  +    +G+   L V +   +++  KD DG+LV   G  + +  I   +  R    + D +     +L       GE  L+V      ++GSPF  + ++ P + P                        + +PS            P   + ++++GS+G +  +F N Q +   S  RI+V DS N CIQ++S  G++   FG + +  G+L RP  +A  TNG  +V D++ + + ++   G + +  G   L+GPKG+ VD+ G IIV DNK   +  F+  GK + +      +D   AGPHF+ + +  +I+VTDF+NH VKV+  +G +  +FG HG+  G+FN PTG+      +I+V+DWGNSRI +F++       + +  EPL GPQG+ LT+ G  +++ D+GNHCFK ++Y
Sbjct:  249 PHENA--QLELV-LEVDGLRRSVLNLGALLTTSATAHETVATGEGLRQAL-VGQPASLTVTTKDKDGRLV-RTGSAELRAEITGPDGTRLPVPVVDHK-NGTYELVYTARTEGELLLSVLLYGQPVRGSPFR-VRALRPGDLPPSPDDVKRRVKSPGGPGSHVRQKAVRRPSSMYSTGGKRKDNPIEDELVFRVGSRGREKGEFTNLQGVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGVAVDTNGDIIVADYDNRWVSIFSPEGKFKTKIGAGRLMGPKGVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDSSGSFLSYINTSAEPLYGPQGLALTSDG-HVVVADAGNHCFKAYRY 701          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Human
Match: TRIM2 (tripartite motif containing 2 [Source:HGNC Symbol;Acc:HGNC:15974])

HSP 1 Score: 245.358 bits (625), Expect = 1.434e-71
Identity = 160/548 (29.20%), Postives = 269/548 (49.09%), Query Frame = 1
Query:  229 SFQMLHNALNVRQNQIL---------------SQLNNLMNSDN--ENEEGHERKWGNEGNETEI-----------------NFRL-PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLV-TERGILDPKVHIELKNLARPHCDIFDREI----PHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTL----IGSVMPLN---------------KPMVILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITSGD-RILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            +F  L   LNVR++ +L               SQL+ L+      ++      +  N G ETE+                 +F L P EN  +QL F  ++ + + K I   GTI  T+  A  +    +G+   + + + + +++  KD DG+L  T    L  +       L+ P   + D EI        +    + + G++ L+++  +  I+GSPF L       V P                 K   + +P+           P   D ++++G+KG    +F N Q +  S + +IL+ DS N C+QI+S  G++ + FG + +  G+L RP  +A   +G  ++ D++ K + ++   G + +  G   L+GPKG+ VD+ G IIV DNK   +  F+  GK + +       D + AGPHF  + S  +I++TDF+NH VKVF++ G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG+ LT+ G  +++ DSGNHCFKV++Y
Sbjct:  234 TFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPREN--DQLDFI-VETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTI-IGQPMSVTITTKDKDGELCKTGNAYLTAE-------LSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSSDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDG-HVVVADSGNHCFKVYRY 769          

HSP 2 Score: 66.6254 bits (161), Expect = 8.545e-11
Identity = 46/172 (26.74%), Postives = 77/172 (44.77%), Query Frame = 1
Query: 1168 KGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN-NRFMCTRI--LKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK*SF 1674
            +G+     G+I++AD+ +  +  F   G+F  +     RS  +L  P  + +  +GDI++ D+ N  V +F  +G ++ + G      G+   P G+       I+V D     + IF  N  + TR     + +    GP      NS  EI+I D  NH  KVF  +  F
Sbjct:  517 QGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSSDGKFKTKIGS-----GKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPH-FAAVNSNNEIIITDFHNHSVKVFNQEGEF 682          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Human
Match: TRIM3 (tripartite motif containing 3 [Source:HGNC Symbol;Acc:HGNC:10064])

HSP 1 Score: 243.432 bits (620), Expect = 5.717e-71
Identity = 141/461 (30.59%), Postives = 236/461 (51.19%), Query Frame = 1
Query:  382 PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERGILDPKVHIELKNLARPHCDIFDREIPHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTLIGSVMPLNKP----------------------MVILKPSE-----------PTNLDYLYKIGSKGFKPCDFGNPQSI-ITSGDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            P EN   QL+   +++D + + +   G +  TS  A  +    +G+   L V +   +++  KD DG+LV   G  + +  I   +  R    + D +     +L       GE  L+V      ++GSPF  + ++ P + P                        + +PS            P   + ++++GS+G +  +F N Q +   S  RI+V DS N CIQ++S  G++   FG + +  G+L RP  +A  TNG  +V D++ + + ++   G + +  G   L+GPKG+ VD+ G IIV DNK   +  F+  GK + +      +D   AGPHF+ + +  +I+VTDF+NH VKV+  +G +  +FG HG+  G+FN PTG+      +I+V+DWGNSRI +F++       + +  EPL GPQG+ LT+ G  +++ D+GNHCFK ++Y
Sbjct:  290 PHENA--QLELV-LEVDGLRRSVLNLGALLTTSATAHETVATGEGLRQAL-VGQPASLTVTTKDKDGRLV-RTGSAELRAEITGPDGTRLPVPVVDHK-NGTYELVYTARTEGELLLSVLLYGQPVRGSPFR-VRALRPGDLPPSPDDVKRRVKSPGGPGSHVRQKAVRRPSSMYSTGGKRKDNPIEDELVFRVGSRGREKGEFTNLQGVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGVAVDTNGDIIVADYDNRWVSIFSPEGKFKTKIGAGRLMGPKGVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDSSGSFLSYINTSAEPLYGPQGLALTSDG-HVVVADAGNHCFKAYRY 742          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Celegans
Match: nhl-1 (RING finger protein nhl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q03601])

HSP 1 Score: 103.99 bits (258), Expect = 6.001e-23
Identity = 76/275 (27.64%), Postives = 133/275 (48.36%), Query Frame = 1
Query:  862 IGSKGFKPCDFGNPQSIIT-SGDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFG-----QKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIIS-TGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN--NRFMCT-RILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVF 1656
             G KG K  +   P+ I   SG  +   DS N  + ++ + G+++  FG      G+L     +A ++    +V+D     I V+ L G+++ SFG           P G+ VD  G I VAD  +  +  F   G+FI K         +L  P F+ +   T  + V+D  NH + VFD +G++   FG+ G   G+F +P GI    +++++++D GN+RI +F+   +F+ +          L G + + +T  G+ I++ D  NH  ++F
Sbjct:  652 FGRKGAKDGELNWPRGICALSGGLVATCDSSNHRVCVFDKDGKFVRQFGGYGAGAGQLDSAAGLA-SSKLRVIVSDRYNHRISVFGLEGDHLFSFGGHGQGNAKFNNPWGVAVDDLGSIYVADKDNHRVQVFDKNGQFIAKFGSFGHLPGQLNSPLFIAVSRVTHHVYVSDSSNHRISVFDPHGVHLFSFGEEGFHGGQFKFPRGIAIDSQENLIIADSGNNRIQVFDAQGQFVSSFGTWGGGAGQLKGVEDVCVTADGS-IVVTDRENHRIQIF 924          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Celegans
Match: nhl-1 (RING finger protein nhl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q03601])

HSP 1 Score: 103.605 bits (257), Expect = 6.975e-23
Identity = 76/275 (27.64%), Postives = 133/275 (48.36%), Query Frame = 1
Query:  862 IGSKGFKPCDFGNPQSIIT-SGDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFG-----QKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIIS-TGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN--NRFMCT-RILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVF 1656
             G KG K  +   P+ I   SG  +   DS N  + ++ + G+++  FG      G+L     +A ++    +V+D     I V+ L G+++ SFG           P G+ VD  G I VAD  +  +  F   G+FI K         +L  P F+ +   T  + V+D  NH + VFD +G++   FG+ G   G+F +P GI    +++++++D GN+RI +F+   +F+ +          L G + + +T  G+ I++ D  NH  ++F
Sbjct:  702 FGRKGAKDGELNWPRGICALSGGLVATCDSSNHRVCVFDKDGKFVRQFGGYGAGAGQLDSAAGLA-SSKLRVIVSDRYNHRISVFGLEGDHLFSFGGHGQGNAKFNNPWGVAVDDLGSIYVADKDNHRVQVFDKNGQFIAKFGSFGHLPGQLNSPLFIAVSRVTHHVYVSDSSNHRISVFDPHGVHLFSFGEEGFHGGQFKFPRGIAIDSQENLIIADSGNNRIQVFDAQGQFVSSFGTWGGGAGQLKGVEDVCVTADGS-IVVTDRENHRIQIF 974          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Celegans
Match: ncl-1 (B-box type zinc finger protein ncl-1 [Source:UniProtKB/Swiss-Prot;Acc:P34611])

HSP 1 Score: 101.293 bits (251), Expect = 3.962e-22
Identity = 71/241 (29.46%), Postives = 115/241 (47.72%), Query Frame = 1
Query:  850 YLYKIGSKGFKPCDFGNPQSIITSGD-RILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIA-ETTNGHYLVTDFE-LKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSD-WGNSRIVIFNNRFMCTRILKSK 1560
            Y  K G  G     F  P  +  +G   I+V D+ N  IQ++ + G +   FG   K+ G+LL P  +A   T G ++VT+      I VY+  G ++  FG  +L  P+G+CVD  G+IIV + K   ++ F   G  ++K          L  P+ +      +IL++D   HC+KVF   G Y  + G  G +    NYP G+  +   ++VV+D   N  + +F+        L+S+
Sbjct:  575 YHCKFGEFGVMEGQFTEPSGVAVNGQGDIVVADTNNHRIQVFDKEGRFKFQFGECGKRDGQLLYPNRVAVNRTTGDFVVTERSPTHQIQVYNQYGQFLRKFGANILQHPRGVCVDSKGRIIVVECKVMRVIIFDMFGNILQKFS----CSRYLEFPNGVCTNDKNEILISDNRAHCIKVFSYEGQYLRQIGGEGVT----NYPIGVGINSLGEVVVADNHNNFNLTVFSQDGTMIGALESR 807          

HSP 2 Score: 77.411 bits (189), Expect = 1.232e-14
Identity = 51/175 (29.14%), Postives = 89/175 (50.86%), Query Frame = 1
Query: 1165 PKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVI-ISTGDILVTDFY-NHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN------NRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK 1665
            P G+ V+  G I+VAD  +  +  F   G+F  +  +  + D +L  P+ + +  +TGD +VT+    H ++V+++ G +  +FG +        +P G+C   +  I+V +    R++IF+       +F C+R L+        P G+  TN   EILI D+  HC KVF Y+
Sbjct:  592 PSGVAVNGQGDIVVADTNNHRIQVFDKEGRFKFQFGECGKRDGQLLYPNRVAVNRTTGDFVVTERSPTHQIQVYNQYGQFLRKFGAN-----ILQHPRGVCVDSKGRIIVVECKVMRVIIFDMFGNILQKFSCSRYLEF-------PNGVC-TNDKNEILISDNRAHCIKVFSYE 753          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Celegans
Match: ncl-1 (B-box type zinc finger protein ncl-1 [Source:UniProtKB/Swiss-Prot;Acc:P34611])

HSP 1 Score: 100.908 bits (250), Expect = 4.471e-22
Identity = 71/241 (29.46%), Postives = 115/241 (47.72%), Query Frame = 1
Query:  850 YLYKIGSKGFKPCDFGNPQSIITSGD-RILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIA-ETTNGHYLVTDFE-LKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSD-WGNSRIVIFNNRFMCTRILKSK 1560
            Y  K G  G     F  P  +  +G   I+V D+ N  IQ++ + G +   FG   K+ G+LL P  +A   T G ++VT+      I VY+  G ++  FG  +L  P+G+CVD  G+IIV + K   ++ F   G  ++K          L  P+ +      +IL++D   HC+KVF   G Y  + G  G +    NYP G+  +   ++VV+D   N  + +F+        L+S+
Sbjct:  572 YHCKFGEFGVMEGQFTEPSGVAVNGQGDIVVADTNNHRIQVFDKEGRFKFQFGECGKRDGQLLYPNRVAVNRTTGDFVVTERSPTHQIQVYNQYGQFLRKFGANILQHPRGVCVDSKGRIIVVECKVMRVIIFDMFGNILQKFS----CSRYLEFPNGVCTNDKNEILISDNRAHCIKVFSYEGQYLRQIGGEGVT----NYPIGVGINSLGEVVVADNHNNFNLTVFSQDGTMIGALESR 804          

HSP 2 Score: 77.411 bits (189), Expect = 1.342e-14
Identity = 51/175 (29.14%), Postives = 89/175 (50.86%), Query Frame = 1
Query: 1165 PKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVI-ISTGDILVTDFY-NHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN------NRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK 1665
            P G+ V+  G I+VAD  +  +  F   G+F  +  +  + D +L  P+ + +  +TGD +VT+    H ++V+++ G +  +FG +        +P G+C   +  I+V +    R++IF+       +F C+R L+        P G+  TN   EILI D+  HC KVF Y+
Sbjct:  589 PSGVAVNGQGDIVVADTNNHRIQVFDKEGRFKFQFGECGKRDGQLLYPNRVAVNRTTGDFVVTERSPTHQIQVYNQYGQFLRKFGAN-----ILQHPRGVCVDSKGRIIVVECKVMRVIIFDMFGNILQKFSCSRYLEF-------PNGVC-TNDKNEILISDNRAHCIKVFSYE 750          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Celegans
Match: ncl-1 (B-box type zinc finger protein ncl-1 [Source:UniProtKB/Swiss-Prot;Acc:P34611])

HSP 1 Score: 100.908 bits (250), Expect = 5.190e-22
Identity = 68/221 (30.77%), Postives = 107/221 (48.42%), Query Frame = 1
Query:  850 YLYKIGSKGFKPCDFGNPQSIITSGD-RILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIA-ETTNGHYLVTDFE-LKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGN 1503
            Y  K G  G     F  P  +  +G   I+V D+ N  IQ++ + G +   FG   K+ G+LL P  +A   T G ++VT+      I VY+  G ++  FG  +L  P+G+CVD  G+IIV + K   ++ F   G  ++K          L  P+ +      +IL++D   HC+KVF   G Y  + G  G +    NYP G+  +   ++VV+D  N
Sbjct:  634 YHCKFGEFGVMEGQFTEPSGVAVNGQGDIVVADTNNHRIQVFDKEGRFKFQFGECGKRDGQLLYPNRVAVNRTTGDFVVTERSPTHQIQVYNQYGQFLRKFGANILQHPRGVCVDSKGRIIVVECKVMRVIIFDMFGNILQKFS----CSRYLEFPNGVCTNDKNEILISDNRAHCIKVFSYEGQYLRQIGGEGVT----NYPIGVGINSLGEVVVADNHN 846          

HSP 2 Score: 77.411 bits (189), Expect = 1.428e-14
Identity = 51/175 (29.14%), Postives = 89/175 (50.86%), Query Frame = 1
Query: 1165 PKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVI-ISTGDILVTDFY-NHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN------NRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK 1665
            P G+ V+  G I+VAD  +  +  F   G+F  +  +  + D +L  P+ + +  +TGD +VT+    H ++V+++ G +  +FG +        +P G+C   +  I+V +    R++IF+       +F C+R L+        P G+  TN   EILI D+  HC KVF Y+
Sbjct:  651 PSGVAVNGQGDIVVADTNNHRIQVFDKEGRFKFQFGECGKRDGQLLYPNRVAVNRTTGDFVVTERSPTHQIQVYNQYGQFLRKFGAN-----ILQHPRGVCVDSKGRIIVVECKVMRVIIFDMFGNILQKFSCSRYLEF-------PNGVC-TNDKNEILISDNRAHCIKVFSYE 812          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Fly
Match: tn (gene:FBgn0265356 transcript:FBtr0340447)

HSP 1 Score: 125.946 bits (315), Expect = 7.624e-30
Identity = 81/277 (29.24%), Postives = 137/277 (49.46%), Query Frame = 1
Query:  853 LYKIGSKGFKPCDFGNPQSIITSGD-RILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLG-----PKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN--NRFMCT-RILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVF 1656
            L+++G +G +P  F  P+ +    D  I+V DS N  +Q++  +G ++  FG      G       +A    G Y++ D     I V D  G ++ +FG +         P G+  D  G I V D ++  +  F++ G F+ K     R + +L  PH++ + +T  ++V+D  NH +++FD NG   +  G  G   G+F +P G+   D+  I V+D GN+RI IFN    F+ T     S +    G +G+ + ++G  IL+ D  NH  +VF
Sbjct:  973 LFQLGGRGSEPGSFTWPRGLAVGPDNSIVVADSSNHRVQVFDSNGIFVKEFGEYGNGEGEFDCLAGVAVNRIGQYIIADRYNHRIQVLDPQGRFLRAFGSQGTADGKFNYPWGVTTDALGFIYVCDKENHRVQVFQSDGSFVGKFGSCGRGEGQLEHPHYIAVSNTNRVIVSDSNNHRIQIFDVNGKVLSTVGGEGSDDGQFKFPRGVAVDDQGYIFVADSGNNRIQIFNPDGSFLKTFGSWGSGDSEFKGLEGVAIMSNGN-ILVCDRENHRVQVF 1248          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Fly
Match: tn (gene:FBgn0265356 transcript:FBtr0340448)

HSP 1 Score: 125.561 bits (314), Expect = 1.038e-29
Identity = 81/277 (29.24%), Postives = 137/277 (49.46%), Query Frame = 1
Query:  853 LYKIGSKGFKPCDFGNPQSIITSGD-RILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLG-----PKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN--NRFMCT-RILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVF 1656
            L+++G +G +P  F  P+ +    D  I+V DS N  +Q++  +G ++  FG      G       +A    G Y++ D     I V D  G ++ +FG +         P G+  D  G I V D ++  +  F++ G F+ K     R + +L  PH++ + +T  ++V+D  NH +++FD NG   +  G  G   G+F +P G+   D+  I V+D GN+RI IFN    F+ T     S +    G +G+ + ++G  IL+ D  NH  +VF
Sbjct: 1002 LFQLGGRGSEPGSFTWPRGLAVGPDNSIVVADSSNHRVQVFDSNGIFVKEFGEYGNGEGEFDCLAGVAVNRIGQYIIADRYNHRIQVLDPQGRFLRAFGSQGTADGKFNYPWGVTTDALGFIYVCDKENHRVQVFQSDGSFVGKFGSCGRGEGQLEHPHYIAVSNTNRVIVSDSNNHRIQIFDVNGKVLSTVGGEGSDDGQFKFPRGVAVDDQGYIFVADSGNNRIQIFNPDGSFLKTFGSWGSGDSEFKGLEGVAIMSNGN-ILVCDRENHRVQVF 1277          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Fly
Match: tn (gene:FBgn0265356 transcript:FBtr0086573)

HSP 1 Score: 125.176 bits (313), Expect = 1.448e-29
Identity = 81/277 (29.24%), Postives = 137/277 (49.46%), Query Frame = 1
Query:  853 LYKIGSKGFKPCDFGNPQSIITSGD-RILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLG-----PKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN--NRFMCT-RILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVF 1656
            L+++G +G +P  F  P+ +    D  I+V DS N  +Q++  +G ++  FG      G       +A    G Y++ D     I V D  G ++ +FG +         P G+  D  G I V D ++  +  F++ G F+ K     R + +L  PH++ + +T  ++V+D  NH +++FD NG   +  G  G   G+F +P G+   D+  I V+D GN+RI IFN    F+ T     S +    G +G+ + ++G  IL+ D  NH  +VF
Sbjct: 1078 LFQLGGRGSEPGSFTWPRGLAVGPDNSIVVADSSNHRVQVFDSNGIFVKEFGEYGNGEGEFDCLAGVAVNRIGQYIIADRYNHRIQVLDPQGRFLRAFGSQGTADGKFNYPWGVTTDALGFIYVCDKENHRVQVFQSDGSFVGKFGSCGRGEGQLEHPHYIAVSNTNRVIVSDSNNHRIQIFDVNGKVLSTVGGEGSDDGQFKFPRGVAVDDQGYIFVADSGNNRIQIFNPDGSFLKTFGSWGSGDSEFKGLEGVAIMSNGN-ILVCDRENHRVQVF 1353          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Fly
Match: tn (gene:FBgn0265356 transcript:FBtr0086572)

HSP 1 Score: 125.176 bits (313), Expect = 1.448e-29
Identity = 81/277 (29.24%), Postives = 137/277 (49.46%), Query Frame = 1
Query:  853 LYKIGSKGFKPCDFGNPQSIITSGD-RILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLG-----PKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN--NRFMCT-RILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVF 1656
            L+++G +G +P  F  P+ +    D  I+V DS N  +Q++  +G ++  FG      G       +A    G Y++ D     I V D  G ++ +FG +         P G+  D  G I V D ++  +  F++ G F+ K     R + +L  PH++ + +T  ++V+D  NH +++FD NG   +  G  G   G+F +P G+   D+  I V+D GN+RI IFN    F+ T     S +    G +G+ + ++G  IL+ D  NH  +VF
Sbjct: 1078 LFQLGGRGSEPGSFTWPRGLAVGPDNSIVVADSSNHRVQVFDSNGIFVKEFGEYGNGEGEFDCLAGVAVNRIGQYIIADRYNHRIQVLDPQGRFLRAFGSQGTADGKFNYPWGVTTDALGFIYVCDKENHRVQVFQSDGSFVGKFGSCGRGEGQLEHPHYIAVSNTNRVIVSDSNNHRIQIFDVNGKVLSTVGGEGSDDGQFKFPRGVAVDDQGYIFVADSGNNRIQIFNPDGSFLKTFGSWGSGDSEFKGLEGVAIMSNGN-ILVCDRENHRVQVF 1353          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Fly
Match: tn (gene:FBgn0265356 transcript:FBtr0114622)

HSP 1 Score: 124.79 bits (312), Expect = 1.817e-29
Identity = 81/277 (29.24%), Postives = 137/277 (49.46%), Query Frame = 1
Query:  853 LYKIGSKGFKPCDFGNPQSIITSGDR-ILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLG-----PKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN--NRFMCT-RILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVF 1656
            L+++G +G +P  F  P+ +    D  I+V DS N  +Q++  +G ++  FG      G       +A    G Y++ D     I V D  G ++ +FG +         P G+  D  G I V D ++  +  F++ G F+ K     R + +L  PH++ + +T  ++V+D  NH +++FD NG   +  G  G   G+F +P G+   D+  I V+D GN+RI IFN    F+ T     S +    G +G+ + ++G  IL+ D  NH  +VF
Sbjct: 1242 LFQLGGRGSEPGSFTWPRGLAVGPDNSIVVADSSNHRVQVFDSNGIFVKEFGEYGNGEGEFDCLAGVAVNRIGQYIIADRYNHRIQVLDPQGRFLRAFGSQGTADGKFNYPWGVTTDALGFIYVCDKENHRVQVFQSDGSFVGKFGSCGRGEGQLEHPHYIAVSNTNRVIVSDSNNHRIQIFDVNGKVLSTVGGEGSDDGQFKFPRGVAVDDQGYIFVADSGNNRIQIFNPDGSFLKTFGSWGSGDSEFKGLEGVAIMSNGN-ILVCDRENHRVQVF 1517          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Zebrafish
Match: trim2b (tripartite motif containing 2b [Source:ZFIN;Acc:ZDB-GENE-090312-70])

HSP 1 Score: 248.054 bits (632), Expect = 8.059e-74
Identity = 147/475 (30.95%), Postives = 237/475 (49.89%), Query Frame = 1
Query:  382 PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLV-TERGILDPKVHIELKNLARPHCDIFDREIPHL----IDLNIKLPQAGEYELTVKFCESSIQGSPFTLIGSVMPLNKPMVIL------------------------------------------KPSEPTNLDYLYKIGSKGFKPCDFGNPQSIIT-SGDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            P+EN  +QL    ++++ + K I   GTI  T+  A  +  +  G L +  V +   + +  +D  G L  T   I+  +V+        P   I D EI  +     +    + + G + L ++  +  I+GSPF L  S  P + P                                              K   P   D +++IG+KG    +F N Q +   S  RIL+ DS N C+QI+S +GE+ + FG + +  G+L RP  +A   NG  ++ D++ K + ++   G Y +  G   L+GPKG+ VD+ G +IV DNK  ++  F+ +GK I K       D + AGPHF  + +  +I++TDF+NH VKVF+ +G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG+ LT+ G  +++ DSGNHCFKV++Y
Sbjct:  174 PEEN--DQLDLM-MEIEGLRKSIHNLGTIVTTNAVASQTEASGDG-LEQCIVGQPASVIITTRDKAGGLCKTGNAIISAEVYT-------PDGSIADGEIVDMKNGTYEFQYTVKKEGNFSLALRLYDQHIKGSPFQLKVSSSPDDSPTTTTAANAASTGSSDGGARKRSAKSPGSRSRQKGVRRGGSLFSTPKKRVNPIEDDLIFRIGTKGRNKGEFTNLQGVAACSEGRILIADSNNQCVQIFSNTGEFQSRFGVRGRSPGQLQRPTGVAVHPNGDIIIADYDNKWVSIFSSEGKYKAKLGSGRLMGPKGVSVDQNGHVIVVDNKACTVFIFQPSGKLITKFGSRGNGDRQFAGPHFAAVNNNNEIIITDFHNHSVKVFNADGEFLLKFGSNGEGNGQFNAPTGVAVDVNGNIIVADWGNSRIQVFDGSGSFLSYINTAADPLYGPQGLALTSDG-HVVVADSGNHCFKVYRY 636          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Zebrafish
Match: trim2b (tripartite motif containing 2b [Source:ZFIN;Acc:ZDB-GENE-090312-70])

HSP 1 Score: 247.669 bits (631), Expect = 2.192e-73
Identity = 147/475 (30.95%), Postives = 237/475 (49.89%), Query Frame = 1
Query:  382 PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLV-TERGILDPKVHIELKNLARPHCDIFDREIPHL----IDLNIKLPQAGEYELTVKFCESSIQGSPFTLIGSVMPLNKPMVIL------------------------------------------KPSEPTNLDYLYKIGSKGFKPCDFGNPQSIIT-SGDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            P+EN  +QL    ++++ + K I   GTI  T+  A  +  +  G L +  V +   + +  +D  G L  T   I+  +V+        P   I D EI  +     +    + + G + L ++  +  I+GSPF L  S  P + P                                              K   P   D +++IG+KG    +F N Q +   S  RIL+ DS N C+QI+S +GE+ + FG + +  G+L RP  +A   NG  ++ D++ K + ++   G Y +  G   L+GPKG+ VD+ G +IV DNK  ++  F+ +GK I K       D + AGPHF  + +  +I++TDF+NH VKVF+ +G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG+ LT+ G  +++ DSGNHCFKV++Y
Sbjct:  205 PEEN--DQLDLM-MEIEGLRKSIHNLGTIVTTNAVASQTEASGDG-LEQCIVGQPASVIITTRDKAGGLCKTGNAIISAEVYT-------PDGSIADGEIVDMKNGTYEFQYTVKKEGNFSLALRLYDQHIKGSPFQLKVSSSPDDSPTTTTAANAASTGSSDGGARKRSAKSPGSRSRQKGVRRGGSLFSTPKKRVNPIEDDLIFRIGTKGRNKGEFTNLQGVAACSEGRILIADSNNQCVQIFSNTGEFQSRFGVRGRSPGQLQRPTGVAVHPNGDIIIADYDNKWVSIFSSEGKYKAKLGSGRLMGPKGVSVDQNGHVIVVDNKACTVFIFQPSGKLITKFGSRGNGDRQFAGPHFAAVNNNNEIIITDFHNHSVKVFNADGEFLLKFGSNGEGNGQFNAPTGVAVDVNGNIIVADWGNSRIQVFDGSGSFLSYINTAADPLYGPQGLALTSDG-HVVVADSGNHCFKVYRY 667          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Zebrafish
Match: trim2b (tripartite motif containing 2b [Source:ZFIN;Acc:ZDB-GENE-090312-70])

HSP 1 Score: 247.669 bits (631), Expect = 2.192e-73
Identity = 147/475 (30.95%), Postives = 237/475 (49.89%), Query Frame = 1
Query:  382 PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLV-TERGILDPKVHIELKNLARPHCDIFDREIPHL----IDLNIKLPQAGEYELTVKFCESSIQGSPFTLIGSVMPLNKPMVIL------------------------------------------KPSEPTNLDYLYKIGSKGFKPCDFGNPQSIIT-SGDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            P+EN  +QL    ++++ + K I   GTI  T+  A  +  +  G L +  V +   + +  +D  G L  T   I+  +V+        P   I D EI  +     +    + + G + L ++  +  I+GSPF L  S  P + P                                              K   P   D +++IG+KG    +F N Q +   S  RIL+ DS N C+QI+S +GE+ + FG + +  G+L RP  +A   NG  ++ D++ K + ++   G Y +  G   L+GPKG+ VD+ G +IV DNK  ++  F+ +GK I K       D + AGPHF  + +  +I++TDF+NH VKVF+ +G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG+ LT+ G  +++ DSGNHCFKV++Y
Sbjct:  205 PEEN--DQLDLM-MEIEGLRKSIHNLGTIVTTNAVASQTEASGDG-LEQCIVGQPASVIITTRDKAGGLCKTGNAIISAEVYT-------PDGSIADGEIVDMKNGTYEFQYTVKKEGNFSLALRLYDQHIKGSPFQLKVSSSPDDSPTTTTAANAASTGSSDGGARKRSAKSPGSRSRQKGVRRGGSLFSTPKKRVNPIEDDLIFRIGTKGRNKGEFTNLQGVAACSEGRILIADSNNQCVQIFSNTGEFQSRFGVRGRSPGQLQRPTGVAVHPNGDIIIADYDNKWVSIFSSEGKYKAKLGSGRLMGPKGVSVDQNGHVIVVDNKACTVFIFQPSGKLITKFGSRGNGDRQFAGPHFAAVNNNNEIIITDFHNHSVKVFNADGEFLLKFGSNGEGNGQFNAPTGVAVDVNGNIIVADWGNSRIQVFDGSGSFLSYINTAADPLYGPQGLALTSDG-HVVVADSGNHCFKVYRY 667          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Zebrafish
Match: trim2a (tripartite motif containing 2a [Source:ZFIN;Acc:ZDB-GENE-050327-99])

HSP 1 Score: 243.432 bits (620), Expect = 3.674e-71
Identity = 147/465 (31.61%), Postives = 237/465 (50.97%), Query Frame = 1
Query:  382 PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKL--------VTERGILDPKVHIELKNLARPHCDIFDREIPHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTLIGSV----------------MPLN---KPMVILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITSG-DRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            P+EN  NQL F  ++ D + K I   G I  T+  A  +    +G L    V +   +++  KD DG L        + +   +D  +  E K        + D +     +    +P  G + LT+K  +  I+GSPF++  +                  P N   K   I +P+           P   D +++IG+KG    +F N Q +  S   ++L+ DS N C+QI+S  G++ + FG + +  G+L RP  +A   +G  ++ D++ K + ++   G + S  G   L+GPKG+ VD+ G IIV DNK   +  F+  GK + K  +   SD + AGPHF  +    +++VTDF+NH VKVF   G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F++       + +  +PL GPQG+ LT+ G  +++ DSGNHCFKV++Y
Sbjct:  292 PEEN--NQLDFL-VETDGLRKSIHNLGAIVTTNAVAAETVATGEG-LRHCIVGQLTSVTVTTKDRDGGLCRTGNALLIADLSAIDGSIVGEGK--------VTDHK-NGTYEFVYSVPCEGRFTLTLKLYDQHIRGSPFSIRANKPTDISLTADVDKKRLKSPGNSHVKQRAIKRPASMYSTGKRKENPIEDDLIFRIGTKGRNKGEFTNLQGVAASSVGKVLIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSSDGKFKSKIGSGKLMGPKGVSVDRNGHIIVVDNKSCCVFIFQPNGKLVSKFGNRGNSDKQFAGPHFAAVNQNNEVIVTDFHNHSVKVFSPEGEFILKFGSNGEGNGQFNAPTGVAVDANGNIIVADWGNSRIQVFDSSGSFLSYINTSADPLYGPQGLALTSDG-HVVVADSGNHCFKVYRY 742          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Zebrafish
Match: trim3b (tripartite motif containing 3b [Source:ZFIN;Acc:ZDB-GENE-070112-1132])

HSP 1 Score: 240.736 bits (613), Expect = 3.126e-70
Identity = 138/448 (30.80%), Postives = 233/448 (52.01%), Query Frame = 1
Query:  421 IKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERGILDPKVHIELKNLAR-PHCDIFDREIPHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTLIGSVMPLNKPM----------------------VILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITS-GDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            I+ + + + I+  G +  T      S    +G+   L V + V +++  KD D +LV   G    +  I  ++ A+    ++ D +     ++   L   GEY  ++      ++GSPF L  ++ P + P                        + +PS           P   + +Y++G++G +  +F N Q I  S   R++V DS N CIQ+++  G++   FG + +  G+L RP  +A  TNG  +V D++ + I ++   G + +  G   L+GPKG+ VD+ G II  DNK   +  F++ GK + K      SD + AGPHF+ + +  +I+VTDF+NH VKV+  +G +  +FG HG+  G+FN PTG+      +I+V+DWGNSRI +F++       + +  +PL GPQG+ LT+ G  +++ DSGNHCFKV++Y
Sbjct:  308 IETEGLRRSIQNLGVLLTTGAVGHTSVATGEGLRHAL-VGQHVTVTVTTKDKDSELV-RTGNAALRAEIMGQDGAQVTEAEVVDNK-NGTYEVGYTLKGEGEYLFSLILYGQPVRGSPFKL-RAIKPSDVPQSPDDVKRRVKSPSGTGGHIRQKAVRRPSSMYSTTKKKENPIEDELIYRVGTRGREKGEFTNLQGISASISGRVIVADSNNQCIQVFTNDGQFKARFGVRGRSPGQLQRPTGVAVDTNGDVIVADYDNRWISIFSPDGKFKNKIGAGRLMGPKGVAVDRNGHIIAVDNKACCVFIFQSNGKLVTKFGARGTSDRQFAGPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDVNGNIIVADWGNSRIQVFDSAGSFLSYINTSADPLYGPQGLALTSDG-HVVVADSGNHCFKVYRY 750          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Xenopus
Match: actr6 (ARP6 actin related protein 6 homolog [Source:Xenbase;Acc:XB-GENE-5860964])

HSP 1 Score: 249.21 bits (635), Expect = 5.653e-74
Identity = 145/469 (30.92%), Postives = 246/469 (52.45%), Query Frame = 1
Query:  361 TEINFRL-PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERGILDPKVHIELKNLARPHCDIFDREIPH----LIDLNIKLPQAGEYELTVKFCESSIQGSPFTL----IGSVMPLN---------------KPMVILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITSGD-RILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
             E +F L P EN  +QL F  ++ + + K I   GTI  T+  A  +    +G+   + + + + +++  KD DG+L           +I  + L  P   + D E+        + +  +P  G++ L+++  +  I+GSPF L       V P                 K   + +P+           P   D ++++G+KG    +F N Q +  S + +IL+ DS N C+QI+S  G++ + FG + +  G+L RP  +A   +G  ++ D++ K + ++   G + +  G   L+GPKG+ VD+ G IIV DNK   +  F+  GK + +       D + AGPHF  + S  +I+VTDF+NH VKVF+++G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG++LT+ G  +++ DSGNHCFKV++Y
Sbjct:  186 AEQDFPLQPHEN--DQLDFI-VETEGLKKSIHNLGTILTTNAVASETVATGEGLRQSV-IGQPMSVTITTKDKDGELCKT-----GSAYISAE-LFTPDGSVTDGEVVDNKNGTYEFSYTIPTEGDFTLSLRLYDQHIKGSPFKLKVVKSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSADGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDKQFAGPHFAAVNSNNEIIVTDFHNHSVKVFNQDGEFILKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLSLTSDG-HVVVADSGNHCFKVYRY 643          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Xenopus
Match: actr6 (ARP6 actin related protein 6 homolog [Source:Xenbase;Acc:XB-GENE-5860964])

HSP 1 Score: 249.21 bits (635), Expect = 1.524e-73
Identity = 145/469 (30.92%), Postives = 246/469 (52.45%), Query Frame = 1
Query:  361 TEINFRL-PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERGILDPKVHIELKNLARPHCDIFDREIPH----LIDLNIKLPQAGEYELTVKFCESSIQGSPFTL----IGSVMPLN---------------KPMVILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITSGD-RILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
             E +F L P EN  +QL F  ++ + + K I   GTI  T+  A  +    +G+   + + + + +++  KD DG+L           +I  + L  P   + D E+        + +  +P  G++ L+++  +  I+GSPF L       V P                 K   + +P+           P   D ++++G+KG    +F N Q +  S + +IL+ DS N C+QI+S  G++ + FG + +  G+L RP  +A   +G  ++ D++ K + ++   G + +  G   L+GPKG+ VD+ G IIV DNK   +  F+  GK + +       D + AGPHF  + S  +I+VTDF+NH VKVF+++G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG++LT+ G  +++ DSGNHCFKV++Y
Sbjct:  234 AEQDFPLQPHEN--DQLDFI-VETEGLKKSIHNLGTILTTNAVASETVATGEGLRQSV-IGQPMSVTITTKDKDGELCKTG-----SAYISAE-LFTPDGSVTDGEVVDNKNGTYEFSYTIPTEGDFTLSLRLYDQHIKGSPFKLKVVKSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSADGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDKQFAGPHFAAVNSNNEIIVTDFHNHSVKVFNQDGEFILKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLSLTSDG-HVVVADSGNHCFKVYRY 691          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Xenopus
Match: actr6 (ARP6 actin related protein 6 homolog [Source:Xenbase;Acc:XB-GENE-5860964])

HSP 1 Score: 247.669 bits (631), Expect = 1.771e-72
Identity = 145/469 (30.92%), Postives = 246/469 (52.45%), Query Frame = 1
Query:  361 TEINFRL-PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERGILDPKVHIELKNLARPHCDIFDREIPH----LIDLNIKLPQAGEYELTVKFCESSIQGSPFTL----IGSVMPLN---------------KPMVILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITSGD-RILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
             E +F L P EN  +QL F  ++ + + K I   GTI  T+  A  +    +G+   + + + + +++  KD DG+L           +I  + L  P   + D E+        + +  +P  G++ L+++  +  I+GSPF L       V P                 K   + +P+           P   D ++++G+KG    +F N Q +  S + +IL+ DS N C+QI+S  G++ + FG + +  G+L RP  +A   +G  ++ D++ K + ++   G + +  G   L+GPKG+ VD+ G IIV DNK   +  F+  GK + +       D + AGPHF  + S  +I+VTDF+NH VKVF+++G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG++LT+ G  +++ DSGNHCFKV++Y
Sbjct:  298 AEQDFPLQPHEN--DQLDFI-VETEGLKKSIHNLGTILTTNAVASETVATGEGLRQSV-IGQPMSVTITTKDKDGELCKTG-----SAYISAE-LFTPDGSVTDGEVVDNKNGTYEFSYTIPTEGDFTLSLRLYDQHIKGSPFKLKVVKSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSADGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDKQFAGPHFAAVNSNNEIIVTDFHNHSVKVFNQDGEFILKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLSLTSDG-HVVVADSGNHCFKVYRY 755          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Xenopus
Match: actr6 (ARP6 actin related protein 6 homolog [Source:Xenbase;Acc:XB-GENE-5860964])

HSP 1 Score: 233.802 bits (595), Expect = 1.829e-67
Identity = 146/485 (30.10%), Postives = 246/485 (50.72%), Query Frame = 1
Query:  361 TEINFRL-PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERGILDPKVHIELKNLARPHCDIFDREIPH----LIDLNIKLPQAGEYELTVKFCESSIQGSPFTL----IGSVMPLN---------------KPMVILKPSE----------PTNLDYLYKIGS------------KGFKPCDFGNPQSIITSGD-RILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAG----PHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
             E +F L P EN  +QL F  ++ + + K I   GTI  T+  A  +    +G+   + + + + +++  KD DG+L           +I  + L  P   + D E+        + +  +P  G++ L+++  +  I+GSPF L       V P                 K   + +P+           P   D ++++GS            KG    +F N Q +  S + +IL+ DS N C+QI+S  G++ + FG + +  G+L RP  +A   +G  ++ D++ K + ++   G + +  G   L+GPKG+ VD+ G IIV DNK   +  F+  GK + +       D + AG    PHF  + S  +I+VTDF+NH VKVF+++G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG++LT+ G  +++ DSGNHCFKV++Y
Sbjct:  285 AEQDFPLQPHEN--DQLDFI-VETEGLKKSIHNLGTILTTNAVASETVATGEGLRQSV-IGQPMSVTITTKDKDGELCKTG-----SAYISAE-LFTPDGSVTDGEVVDNKNGTYEFSYTIPTEGDFTLSLRLYDQHIKGSPFKLKVVKSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGSRKDEDVRSLTGTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSADGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDKQFAGTLDGPHFAAVNSNNEIIVTDFHNHSVKVFNQDGEFILKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLSLTSDG-HVVVADSGNHCFKVYRY 758          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Xenopus
Match: actr6 (ARP6 actin related protein 6 homolog [Source:Xenbase;Acc:XB-GENE-5860964])

HSP 1 Score: 206.453 bits (524), Expect = 1.216e-57
Identity = 130/439 (29.61%), Postives = 221/439 (50.34%), Query Frame = 1
Query:  361 TEINFRL-PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERGILDPKVHIELKNLARPHCDIFDREIPH----LIDLNIKLPQAGEYELTVKFCESSIQGSPFTL----IGSVMPLN---------------KPMVILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITSGD-RILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPL 1572
             E +F L P EN  +QL F  ++ + + K I   GTI  T+  A  +    +G+   + + + + +++  KD DG+L           +I  + L  P   + D E+        + +  +P  G++ L+++  +  I+GSPF L       V P                 K   + +P+           P   D ++++G+KG    +F N Q +  S + +IL+ DS N C+QI+S  G++ + FG + +  G+L RP  +A   +G  ++ D++ K + ++   G + +  G   L+GPKG+ VD+ G IIV DNK   +  F+  GK + +       D + AGPHF  + S  +I+VTDF+NH VKVF+++G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI     +  CT  L  ++ PL
Sbjct:  285 AEQDFPLQPHEN--DQLDFI-VETEGLKKSIHNLGTILTTNAVASETVATGEGLRQSV-IGQPMSVTITTKDKDGELCKTG-----SAYISAE-LFTPDGSVTDGEVVDNKNGTYEFSYTIPTEGDFTLSLRLYDQHIKGSPFKLKVVKSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSADGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDKQFAGPHFAAVNSNNEIIVTDFHNHSVKVFNQDGEFILKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRI-----QVTCTYSLHLEQWPL 708          

HSP 2 Score: 65.0846 bits (157), Expect = 1.907e-10
Identity = 44/166 (26.51%), Postives = 76/166 (45.78%), Query Frame = 1
Query: 1168 KGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN-NRFMCTRI--LKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVF 1656
            +G+     G+I++AD+ +  +  F   G+F  +     RS  +L  P  + +  +GDI++ D+ N  V +F  +G ++ + G      G+   P G+       I+V D     + IF  N  + TR     + ++   GP      NS  EI++ D  NH  KVF
Sbjct:  490 QGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSADGKFKTKIGS-----GKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDKQFAGPH-FAAVNSNNEIIVTDFHNHSVKVF 649          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Mouse
Match: Trim2 (tripartite motif-containing 2 [Source:MGI Symbol;Acc:MGI:1933163])

HSP 1 Score: 244.202 bits (622), Expect = 1.799e-71
Identity = 160/548 (29.20%), Postives = 268/548 (48.91%), Query Frame = 1
Query:  229 SFQMLHNALNVRQNQIL---------------SQLNNLMNSDN--ENEEGHERKWGNEGNETEI-----------------NFRL-PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLV-TERGILDPKVHIELKNLARPHCDIFDREI----PHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTL----IGSVMPLN---------------KPMVILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITS-GDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            +F  L   LNVR++ +L               SQL+ L+      ++      +  N G ETE+                 +F L P EN  +QL F  ++ + + K I   GTI  T+  A  +    +G+   + + + + +++  KD DG+L  T    L  +       L+ P   + D EI        +    + + G++ L+++  +  I+GSPF L       V P                 K   + +P+           P   D ++++G+KG    +F N Q +  S   +IL+ DS N C+QI+S  G++ + FG + +  G+L RP  +A   +G  ++ D++ K + ++   G + +  G   L+GPKG+ VD+ G IIV DNK   +  F+  GK + +       D + AGPHF  + S  +I++TDF+NH VKVF++ G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG+ LT+ G  +++ DSGNHCFKV++Y
Sbjct:  207 TFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPREN--DQLDFI-VETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTI-IGQPMSVTITTKDKDGELCKTGNAYLTAE-------LSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSNDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDG-HVVVADSGNHCFKVYRY 742          

HSP 2 Score: 66.6254 bits (161), Expect = 4.520e-11
Identity = 46/172 (26.74%), Postives = 78/172 (45.35%), Query Frame = 1
Query: 1168 KGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN-NRFMCTRI--LKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK*SF 1674
            +G+    +G+I++AD+ +  +  F   G+F  +     RS  +L  P  + +  +GDI++ D+ N  V +F  +G ++ + G      G+   P G+       I+V D     + IF  N  + TR     + +    GP      NS  EI+I D  NH  KVF  +  F
Sbjct:  490 QGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSNDGKFKTKIGS-----GKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPH-FAAVNSNNEIIITDFHNHSVKVFNQEGEF 655          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Mouse
Match: Trim2 (tripartite motif-containing 2 [Source:MGI Symbol;Acc:MGI:1933163])

HSP 1 Score: 244.202 bits (622), Expect = 1.799e-71
Identity = 160/548 (29.20%), Postives = 268/548 (48.91%), Query Frame = 1
Query:  229 SFQMLHNALNVRQNQIL---------------SQLNNLMNSDN--ENEEGHERKWGNEGNETEI-----------------NFRL-PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLV-TERGILDPKVHIELKNLARPHCDIFDREI----PHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTL----IGSVMPLN---------------KPMVILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITS-GDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            +F  L   LNVR++ +L               SQL+ L+      ++      +  N G ETE+                 +F L P EN  +QL F  ++ + + K I   GTI  T+  A  +    +G+   + + + + +++  KD DG+L  T    L  +       L+ P   + D EI        +    + + G++ L+++  +  I+GSPF L       V P                 K   + +P+           P   D ++++G+KG    +F N Q +  S   +IL+ DS N C+QI+S  G++ + FG + +  G+L RP  +A   +G  ++ D++ K + ++   G + +  G   L+GPKG+ VD+ G IIV DNK   +  F+  GK + +       D + AGPHF  + S  +I++TDF+NH VKVF++ G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG+ LT+ G  +++ DSGNHCFKV++Y
Sbjct:  207 TFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPREN--DQLDFI-VETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTI-IGQPMSVTITTKDKDGELCKTGNAYLTAE-------LSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSNDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDG-HVVVADSGNHCFKVYRY 742          

HSP 2 Score: 66.6254 bits (161), Expect = 4.520e-11
Identity = 46/172 (26.74%), Postives = 78/172 (45.35%), Query Frame = 1
Query: 1168 KGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN-NRFMCTRI--LKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK*SF 1674
            +G+    +G+I++AD+ +  +  F   G+F  +     RS  +L  P  + +  +GDI++ D+ N  V +F  +G ++ + G      G+   P G+       I+V D     + IF  N  + TR     + +    GP      NS  EI+I D  NH  KVF  +  F
Sbjct:  490 QGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSNDGKFKTKIGS-----GKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPH-FAAVNSNNEIIITDFHNHSVKVFNQEGEF 655          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Mouse
Match: Trim2 (tripartite motif-containing 2 [Source:MGI Symbol;Acc:MGI:1933163])

HSP 1 Score: 244.202 bits (622), Expect = 1.799e-71
Identity = 160/548 (29.20%), Postives = 268/548 (48.91%), Query Frame = 1
Query:  229 SFQMLHNALNVRQNQIL---------------SQLNNLMNSDN--ENEEGHERKWGNEGNETEI-----------------NFRL-PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLV-TERGILDPKVHIELKNLARPHCDIFDREI----PHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTL----IGSVMPLN---------------KPMVILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITS-GDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            +F  L   LNVR++ +L               SQL+ L+      ++      +  N G ETE+                 +F L P EN  +QL F  ++ + + K I   GTI  T+  A  +    +G+   + + + + +++  KD DG+L  T    L  +       L+ P   + D EI        +    + + G++ L+++  +  I+GSPF L       V P                 K   + +P+           P   D ++++G+KG    +F N Q +  S   +IL+ DS N C+QI+S  G++ + FG + +  G+L RP  +A   +G  ++ D++ K + ++   G + +  G   L+GPKG+ VD+ G IIV DNK   +  F+  GK + +       D + AGPHF  + S  +I++TDF+NH VKVF++ G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG+ LT+ G  +++ DSGNHCFKV++Y
Sbjct:  207 TFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPREN--DQLDFI-VETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTI-IGQPMSVTITTKDKDGELCKTGNAYLTAE-------LSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSNDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDG-HVVVADSGNHCFKVYRY 742          

HSP 2 Score: 66.6254 bits (161), Expect = 4.520e-11
Identity = 46/172 (26.74%), Postives = 78/172 (45.35%), Query Frame = 1
Query: 1168 KGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN-NRFMCTRI--LKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK*SF 1674
            +G+    +G+I++AD+ +  +  F   G+F  +     RS  +L  P  + +  +GDI++ D+ N  V +F  +G ++ + G      G+   P G+       I+V D     + IF  N  + TR     + +    GP      NS  EI+I D  NH  KVF  +  F
Sbjct:  490 QGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSNDGKFKTKIGS-----GKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPH-FAAVNSNNEIIITDFHNHSVKVFNQEGEF 655          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Mouse
Match: Trim2 (tripartite motif-containing 2 [Source:MGI Symbol;Acc:MGI:1933163])

HSP 1 Score: 244.202 bits (622), Expect = 1.799e-71
Identity = 160/548 (29.20%), Postives = 268/548 (48.91%), Query Frame = 1
Query:  229 SFQMLHNALNVRQNQIL---------------SQLNNLMNSDN--ENEEGHERKWGNEGNETEI-----------------NFRL-PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLV-TERGILDPKVHIELKNLARPHCDIFDREI----PHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTL----IGSVMPLN---------------KPMVILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITS-GDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            +F  L   LNVR++ +L               SQL+ L+      ++      +  N G ETE+                 +F L P EN  +QL F  ++ + + K I   GTI  T+  A  +    +G+   + + + + +++  KD DG+L  T    L  +       L+ P   + D EI        +    + + G++ L+++  +  I+GSPF L       V P                 K   + +P+           P   D ++++G+KG    +F N Q +  S   +IL+ DS N C+QI+S  G++ + FG + +  G+L RP  +A   +G  ++ D++ K + ++   G + +  G   L+GPKG+ VD+ G IIV DNK   +  F+  GK + +       D + AGPHF  + S  +I++TDF+NH VKVF++ G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG+ LT+ G  +++ DSGNHCFKV++Y
Sbjct:  207 TFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPREN--DQLDFI-VETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTI-IGQPMSVTITTKDKDGELCKTGNAYLTAE-------LSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSNDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDG-HVVVADSGNHCFKVYRY 742          

HSP 2 Score: 66.6254 bits (161), Expect = 4.520e-11
Identity = 46/172 (26.74%), Postives = 78/172 (45.35%), Query Frame = 1
Query: 1168 KGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN-NRFMCTRI--LKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK*SF 1674
            +G+    +G+I++AD+ +  +  F   G+F  +     RS  +L  P  + +  +GDI++ D+ N  V +F  +G ++ + G      G+   P G+       I+V D     + IF  N  + TR     + +    GP      NS  EI+I D  NH  KVF  +  F
Sbjct:  490 QGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSNDGKFKTKIGS-----GKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPH-FAAVNSNNEIIITDFHNHSVKVFNQEGEF 655          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Mouse
Match: Trim2 (tripartite motif-containing 2 [Source:MGI Symbol;Acc:MGI:1933163])

HSP 1 Score: 244.202 bits (622), Expect = 2.362e-71
Identity = 160/548 (29.20%), Postives = 268/548 (48.91%), Query Frame = 1
Query:  229 SFQMLHNALNVRQNQIL---------------SQLNNLMNSDN--ENEEGHERKWGNEGNETEI-----------------NFRL-PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLV-TERGILDPKVHIELKNLARPHCDIFDREI----PHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTL----IGSVMPLN---------------KPMVILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITS-GDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            +F  L   LNVR++ +L               SQL+ L+      ++      +  N G ETE+                 +F L P EN  +QL F  ++ + + K I   GTI  T+  A  +    +G+   + + + + +++  KD DG+L  T    L  +       L+ P   + D EI        +    + + G++ L+++  +  I+GSPF L       V P                 K   + +P+           P   D ++++G+KG    +F N Q +  S   +IL+ DS N C+QI+S  G++ + FG + +  G+L RP  +A   +G  ++ D++ K + ++   G + +  G   L+GPKG+ VD+ G IIV DNK   +  F+  GK + +       D + AGPHF  + S  +I++TDF+NH VKVF++ G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG+ LT+ G  +++ DSGNHCFKV++Y
Sbjct:  233 TFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPREN--DQLDFI-VETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTI-IGQPMSVTITTKDKDGELCKTGNAYLTAE-------LSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSNDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDG-HVVVADSGNHCFKVYRY 768          

HSP 2 Score: 67.0106 bits (162), Expect = 3.972e-11
Identity = 46/172 (26.74%), Postives = 78/172 (45.35%), Query Frame = 1
Query: 1168 KGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN-NRFMCTRI--LKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK*SF 1674
            +G+    +G+I++AD+ +  +  F   G+F  +     RS  +L  P  + +  +GDI++ D+ N  V +F  +G ++ + G      G+   P G+       I+V D     + IF  N  + TR     + +    GP      NS  EI+I D  NH  KVF  +  F
Sbjct:  516 QGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSNDGKFKTKIGS-----GKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPH-FAAVNSNNEIIITDFHNHSVKVFNQEGEF 681          
BLAST of Tripartite motif-containing protein 3-like vs. UniProt/SwissProt
Match: sp|A4IF63|TRIM2_BOVIN (Tripartite motif-containing protein 2 OS=Bos taurus OX=9913 GN=TRIM2 PE=2 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 3.048e-71
Identity = 164/555 (29.55%), Postives = 270/555 (48.65%), Query Frame = 1
Query:  229 SFQMLHNALNVRQNQIL---------------SQLNNLMNSDNENEEGHER---------KWGNEGNETEI-----------------NFRL-PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLV-TERGILDPKVHIELKNLARPHCDIFDREI----PHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTL----IGSVMPLN---------------KPMVILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITSGD-RILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            +F  L   LNVR++ +L               SQL+ L+       EG E          +  N G ETE+                 +F L P EN  +QL F  ++ + + K I   GTI  T+  A  +    +G+   + + + + +++  KD DG+L  T    L  +       L+ P   + D EI        +    + + G++ L+++  +  I+GSPF L       V P                 K   + +P+           P   D ++++G+KG    +F N Q +  S + +IL+ DS N C+QI+S  G++ + FG + +  G+L RP  +A   +G  ++ D++ K + ++   G + +  G   L+GPKG+ VD+ G IIV DNK   +  F+  GK + +       D + AGPHF  + S  +I+VTDF+NH VKVF++ G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG+ LT+ G  +++ DSGNHCFKV++Y
Sbjct:  207 TFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLL-------EGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPREN--DQLDFI-VETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTI-IGQPMSVTITTKDKDGELCKTGNAYLTAE-------LSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSSDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIVTDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDG-HVVVADSGNHCFKVYRY 742          

HSP 2 Score: 65.4698 bits (158), Expect = 7.450e-10
Identity = 45/172 (26.16%), Postives = 77/172 (44.77%), Query Frame = 1
Query: 1168 KGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN-NRFMCTRI--LKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK*SF 1674
            +G+     G+I++AD+ +  +  F   G+F  +     RS  +L  P  + +  +GDI++ D+ N  V +F  +G ++ + G      G+   P G+       I+V D     + IF  N  + TR     + +    GP      NS  EI++ D  NH  KVF  +  F
Sbjct:  490 QGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSSDGKFKTKIGS-----GKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPH-FAAVNSNNEIIVTDFHNHSVKVFNQEGEF 655          
BLAST of Tripartite motif-containing protein 3-like vs. UniProt/SwissProt
Match: sp|Q9C040|TRIM2_HUMAN (Tripartite motif-containing protein 2 OS=Homo sapiens OX=9606 GN=TRIM2 PE=1 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 4.646e-71
Identity = 160/548 (29.20%), Postives = 269/548 (49.09%), Query Frame = 1
Query:  229 SFQMLHNALNVRQNQIL---------------SQLNNLMNSDN--ENEEGHERKWGNEGNETEI-----------------NFRL-PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLV-TERGILDPKVHIELKNLARPHCDIFDREI----PHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTL----IGSVMPLN---------------KPMVILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITSGD-RILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            +F  L   LNVR++ +L               SQL+ L+      ++      +  N G ETE+                 +F L P EN  +QL F  ++ + + K I   GTI  T+  A  +    +G+   + + + + +++  KD DG+L  T    L  +       L+ P   + D EI        +    + + G++ L+++  +  I+GSPF L       V P                 K   + +P+           P   D ++++G+KG    +F N Q +  S + +IL+ DS N C+QI+S  G++ + FG + +  G+L RP  +A   +G  ++ D++ K + ++   G + +  G   L+GPKG+ VD+ G IIV DNK   +  F+  GK + +       D + AGPHF  + S  +I++TDF+NH VKVF++ G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG+ LT+ G  +++ DSGNHCFKV++Y
Sbjct:  207 TFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPREN--DQLDFI-VETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTI-IGQPMSVTITTKDKDGELCKTGNAYLTAE-------LSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSSDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDG-HVVVADSGNHCFKVYRY 742          

HSP 2 Score: 66.2402 bits (160), Expect = 4.588e-10
Identity = 46/172 (26.74%), Postives = 77/172 (44.77%), Query Frame = 1
Query: 1168 KGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN-NRFMCTRI--LKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK*SF 1674
            +G+     G+I++AD+ +  +  F   G+F  +     RS  +L  P  + +  +GDI++ D+ N  V +F  +G ++ + G      G+   P G+       I+V D     + IF  N  + TR     + +    GP      NS  EI+I D  NH  KVF  +  F
Sbjct:  490 QGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSSDGKFKTKIGS-----GKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPH-FAAVNSNNEIIITDFHNHSVKVFNQEGEF 655          
BLAST of Tripartite motif-containing protein 3-like vs. UniProt/SwissProt
Match: sp|F7H9X2|TRIM2_CALJA (Tripartite motif-containing protein 2 OS=Callithrix jacchus OX=9483 GN=TRIM2 PE=3 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 6.068e-71
Identity = 160/548 (29.20%), Postives = 268/548 (48.91%), Query Frame = 1
Query:  229 SFQMLHNALNVRQNQIL---------------SQLNNLMNSDN--ENEEGHERKWGNEGNETEI-----------------NFRL-PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLV-TERGILDPKVHIELKNLARPHCDIFDREI----PHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTL----IGSVMPLN---------------KPMVILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITS-GDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            +F  L   LNVR++ +L               SQL+ L+      ++      +  N G ETE+                 +F L P EN  +QL F  ++ + + K I   GTI  T+  A  +    +G+   + + + + +++  KD DG+L  T    L  +       L+ P   + D EI        +    + + G++ L+++  +  I+GSPF L       V P                 K   + +P+           P   D ++++G+KG    +F N Q +  S   +IL+ DS N C+QI+S  G++ + FG + +  G+L RP  +A   +G  ++ D++ K + ++   G + +  G   L+GPKG+ VD+ G IIV DNK   +  F+  GK + +       D + AGPHF  + S  +I++TDF+NH VKVF++ G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG+ LT+ G  +++ DSGNHCFKV++Y
Sbjct:  207 TFDELQKTLNVRKSVLLMELEVNYGVKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPREN--DQLDFI-VETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTI-IGQPMSVTITTKDKDGELCKTGNAYLTAE-------LSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSSDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDG-HVVVADSGNHCFKVYRY 742          

HSP 2 Score: 67.0106 bits (162), Expect = 2.950e-10
Identity = 46/172 (26.74%), Postives = 78/172 (45.35%), Query Frame = 1
Query: 1168 KGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN-NRFMCTRI--LKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK*SF 1674
            +G+    +G+I++AD+ +  +  F   G+F  +     RS  +L  P  + +  +GDI++ D+ N  V +F  +G ++ + G      G+   P G+       I+V D     + IF  N  + TR     + +    GP      NS  EI+I D  NH  KVF  +  F
Sbjct:  490 QGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSSDGKFKTKIGS-----GKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPH-FAAVNSNNEIIITDFHNHSVKVFNQEGEF 655          
BLAST of Tripartite motif-containing protein 3-like vs. UniProt/SwissProt
Match: sp|D3ZQG6|TRIM2_RAT (Tripartite motif-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Trim2 PE=1 SV=2)

HSP 1 Score: 244.973 bits (624), Expect = 6.588e-71
Identity = 160/548 (29.20%), Postives = 269/548 (49.09%), Query Frame = 1
Query:  229 SFQMLHNALNVRQNQIL---------------SQLNNLMNSDN--ENEEGHERKWGNEGNETEI-----------------NFRL-PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLV-TERGILDPKVHIELKNLARPHCDIFDREI----PHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTL----IGSVMPLN---------------KPMVILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITS-GDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            +F  L   LNVR++ +L               SQL+ L+      ++      +  N G ETE+                 +F L P EN  +QL F  ++ + + K I   GTI  T+  A  +    +G+   + + + + +++  KD DG+L  T    L  +       L+ P   + D EI        +    + + G++ L+++  +  I+GSPF L       V P                 K   + +P+           P   D ++++G+KG    +F N Q +  S   +IL+ DS N C+QI+S  G++ + FG + +  G+L RP  +A   +G  ++ D++ K + ++   G + +  G   L+GPKG+ VD+ G IIV DNK   +  F+  GK + +       D + AGPHF  + S+ +I++TDF+NH VKVF++ G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG+ LT+ G  +++ DSGNHCFKV++Y
Sbjct:  207 TFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPREN--DQLDFI-VETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTI-IGQPMSVTITTKDKDGELCKTGNAYLTAE-------LSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSNDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSSNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDG-HVVVADSGNHCFKVYRY 742          

HSP 2 Score: 67.0106 bits (162), Expect = 2.682e-10
Identity = 46/172 (26.74%), Postives = 78/172 (45.35%), Query Frame = 1
Query: 1168 KGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN-NRFMCTRI--LKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK*SF 1674
            +G+    +G+I++AD+ +  +  F   G+F  +     RS  +L  P  + +  +GDI++ D+ N  V +F  +G ++ + G      G+   P G+       I+V D     + IF  N  + TR     + +    GP      NS  EI+I D  NH  KVF  +  F
Sbjct:  490 QGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSNDGKFKTKIGS-----GKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPH-FAAVNSSNEIIITDFHNHSVKVFNQEGEF 655          
BLAST of Tripartite motif-containing protein 3-like vs. UniProt/SwissProt
Match: sp|D2GXS7|TRIM2_AILME (Tripartite motif-containing protein 2 OS=Ailuropoda melanoleuca OX=9646 GN=TRIM2 PE=3 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 9.734e-71
Identity = 163/554 (29.42%), Postives = 269/554 (48.56%), Query Frame = 1
Query:  229 SFQMLHNALNVRQNQIL---------------SQLNNLMNSDNENEEGHER---------KWGNEGNETEI-----------------NFRL-PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERGILDPKVHIELKNLARPHCDIFDREI----PHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTL----IGSVMPLN---------------KPMVILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITS-GDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            +F  L   LNVR++ +L               SQL+ L+       EG E          +  N G ETE+                 +F L P EN  +QL F  ++ + + K I   GTI  T+  A  +    +G+   + + + + +++  KD DG+L           +I  + L+ P   + D EI        +    + + G++ L+++  +  I+GSPF L       V P                 K   + +P+           P   D ++++G+KG    +F N Q +  S   +IL+ DS N C+QI+S  G++ + FG + +  G+L RP  +A   +G  ++ D++ K + ++   G + +  G   L+GPKG+ VD+ G IIV DNK   +  F+  GK + +       D + AGPHF  + S  +I+VTDF+NH VKVF++ G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG+ LT+ G  +++ DSGNHCFKV++Y
Sbjct:  207 TFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLL-------EGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPREN--DQLDFI-VETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTI-IGQPMSVTITTKDKDGELCKT-----GNAYITAE-LSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSSDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIVTDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDG-HVVVADSGNHCFKVYRY 742          

HSP 2 Score: 66.2402 bits (160), Expect = 4.509e-10
Identity = 45/172 (26.16%), Postives = 78/172 (45.35%), Query Frame = 1
Query: 1168 KGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN-NRFMCTRI--LKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK*SF 1674
            +G+    +G+I++AD+ +  +  F   G+F  +     RS  +L  P  + +  +GDI++ D+ N  V +F  +G ++ + G      G+   P G+       I+V D     + IF  N  + TR     + +    GP      NS  EI++ D  NH  KVF  +  F
Sbjct:  490 QGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSSDGKFKTKIGS-----GKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPH-FAAVNSNNEIIVTDFHNHSVKVFNQEGEF 655          
BLAST of Tripartite motif-containing protein 3-like vs. TrEMBL
Match: C3YZN3 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_69647 PE=4 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 6.765e-79
Identity = 172/562 (30.60%), Postives = 279/562 (49.64%), Query Frame = 1
Query:  169 NMTNLTASLNLDAVSEQVE--QSFQMLHNALNVRQNQILSQLNNLMNSDNE----NEEGHERKWGN-------------EGNETEI---------------NFRLPDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERGILDPKVHIELKNLARPHCDIFDREIPHLIDLNIKL---PQA-GEYELTVKFCESSIQGSPFTL-------------------IGSVM------PLNKPMVILKP-SEPTNLDYLYKIGSKGFKPCDFGNPQSIITSGDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            N+T ++  L       ++E   +F+ L  A++ R+  + S+L  + ++ N+     +E       N              GNETE+               + + P +   N    F  ++D++ + I   G I MT+ +  + T+A    L +  +   + +++  KD  G L+ + G  D  V I     A P   + D E+    +   +L   PQ  G+Y + ++     ++GSPF L                    G+V       P +      +P S P   D + ++G KG    +F NPQ + T   +I+V DS N  IQ++S  G++   FG + +  G+L RP  +  + NG+Y+V D++ K + V+   G +++ FG   LLGPKG+ VDK G IIV DNK S +  F++ GKF++K       D + AGPHF+ +    +I+V+DF+NHCVKVFD NG +   FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG+ LT  G  + + DSGNHCFK++KY
Sbjct:  173 NITEISQHLATKKSDAEIEITSAFEELEKAISQRKTALFSELETVYSAKNQVLHDQKEALNSALANISSSCEFTEQALSHGNETEVLLIKKQMSDRLTELASIKYPLKPEQNDFVLFQAELDNIKRSIANLGCI-MTNHSVGHETVASGEGLRQGVIGRQMSVTITTKDRLGSLI-KTGHADISVEI-----ASPEGSVIDGEVADNKNGTYELTYLPQKEGKYSMALRLFGEHVRGSPFDLKVIPESQLPDQSVKTKIIKTGTVRQKAYKRPASSRSKGSRPRSNPIEDDLVMRVGVKGRNKGEFTNPQGVATCPGKIIVADSNNQVIQVFSNMGDFKLKFGARGRNAGQLQRPTGVTVSHNGNYIVADYDNKWVSVFGPDGKFINKFGSGKLLGPKGVAVDKNGHIIVVDNKASCVFIFQSNGKFLQKFGSRGNDDKQFAGPHFVAVSPANNIVVSDFHNHCVKVFDPNGTFLYRFGSNGEGNGQFNAPTGVAVDSSGNIIVADWGNSRIQVFDCTGSFLSYVNTMADPLYGPQGLCLTADGY-VAVADSGNHCFKIYKY 726          
BLAST of Tripartite motif-containing protein 3-like vs. TrEMBL
Match: A0A4S2L4E3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010427 PE=4 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 1.470e-77
Identity = 157/484 (32.44%), Postives = 244/484 (50.41%), Query Frame = 1
Query:  406 LKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQ-----GILSKLPVNEDVRISLILKDSDGKLVT------------ERGILDPKVHI----ELKNLARPHCDIFDRE----IPHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTLIG------------------SVMPLNKPMVILK----PSEPT------------------NLDYLYKIGSKGFKPCDFGNPQSI-ITSGDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFK 1659
            + FF  ++D +L  +R  G I +TS++A  +T+A         + +  +NE+VRI +I +D+ G+ +T             R     +V I    + +    P  +   RE    IP  + +  ++   G Y+L +K     IQGSP+ +                    S  P  +  V++      S P+                    DYL+ IG+KG    +F NP  + +T  +++LV DS N+ IQI++   ++L   G      G+L+RP+D+AET NG+YLV+DFEL  + VY   G Y+S FGQ+ L GPKGI  D+ G+I+V D K   L  FK TGKFI +       DN+   P  + + S  +I V+D+  H +KVFD+NG+Y   FG+HG   G  + PTG+    +D++ VSDWGN+R+ +F+      R++ S  EP  GPQG+T       + + D GN+C KVF+
Sbjct:  194 MSFFPTELDQLLSMVRCVGVIGLTSIDAGKTTLAKDPDDEFSPIRRCLLNEEVRIDIITRDNMGRCITNPTSKEFTATLHSRNDYITEVRISDINDAERTGNPLSNYPSREQLTNIPTALQVAYRISTPGAYDLGIKLYGEHIQGSPYMIYARAPCTPDVRSWLETIREISEAPRRRHTVLVSRRRCKSAPSFSAAGDKLGALADINVIGRGDYLFSIGTKGRGEGEFANPTGVCVTRENKVLVADSNNASIQIFNTQAQFLFRIGEYGYHPGQLMRPMDVAETINGNYLVSDFELHCVTVYSPTGTYISRFGQRYLSGPKGIIADRNGRILVVDQKSCMLCIFKPTGKFINRFGARGSGDNQFTNPFSVAVNSQDEIYVSDYAQHAIKVFDQNGLYLFRFGEHGMEPGMLHAPTGLAFDKQDNLFVSDWGNNRVQVFDALGNFQRVISSAFEPFNGPQGLTFHTPTQRLFVTDPGNYCVKVFQ 677          
BLAST of Tripartite motif-containing protein 3-like vs. TrEMBL
Match: A0A3Q2DHW1 (Tripartite motif containing 2b OS=Cyprinodon variegatus OX=28743 PE=4 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 2.902e-77
Identity = 178/558 (31.90%), Postives = 268/558 (48.03%), Query Frame = 1
Query:  172 MTNLTASLNLDAVSEQVEQSFQMLHNALNVRQNQIL---------------SQLNNLMNSD-------NENEEG--HERKWGNEGNETEINFRL-----------PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKD-SDGKLVTERGILDPKVHIELKNLARPHCDIFDREIPH----LIDLNIKLPQAGEYELTVKFCESSIQGSPFTLI--------------------GSVMPLNKPMVILKPSEPTNLDYLYKIGSKGFKPCDFGNPQSIITSGD-RILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            +TN  AS     + E ++ SF+ LH  L VR++ +L               +Q++NL   D        + EE    E        E E+  RL           P+EN  +QL    ++ D + K I   GTI  TS  A  S     G L +  V     ++++ +D S G   T   IL  +V         P   I D EI        +    +P+ GE+ L ++  +  I+GSPF L                      +   L  P    K   P   D ++KIG+KG    +F N Q +  S + RIL+ DS N C+QI+S  GE+ T FG + +  G+L RP  +A   +G  ++ D++ K + ++   G + +  G   L+GPKG+ VD+ G +IV DNK  ++  F+ TGK I K       D + AGPHF  +    +I+VTDF+NH VKVF   G    +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG+ LT+ G  +++ DSGNHCFKV++Y
Sbjct:   91 LTNQRAS-----IEEDIQSSFEDLHKQLEVRKSVLLMELEVTYGLKQKVLQAQIDNLTRGDGDITATCTQTEEALAEEASVATLEAEHELEERLKELAILRMPCQPEEN--DQLDLV-METDGLRKSIHNLGTIVTTSAVASQSEAMGSG-LEQCIVGHPASVTIVTRDKSGGACKTGNAILSAEVFT-------PDGSIVDGEIVDHKNGTYEFVYTVPKEGEFSLALRLYDQHIKGSPFKLTIAKASERRGKSPGQKKKGSKRASSALGTPR--RKTQNPIEDDLIFKIGTKGRNKGEFTNLQGVAASSNGRILIADSNNQCVQIFSNEGEFKTRFGVRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSCEGKFKAKLGSGRLMGPKGVSVDQNGHVIVVDNKACTVFIFQLTGKLIAKFGSRGNGDKQFAGPHFAAVNKNNEIIVTDFHNHSVKVFTAEGELVLKFGSNGEGNGQFNAPTGVAVDINGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDG-HVVVADSGNHCFKVYRY 629          
BLAST of Tripartite motif-containing protein 3-like vs. TrEMBL
Match: A0A075A616 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_12537 PE=4 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 4.875e-77
Identity = 158/484 (32.64%), Postives = 241/484 (49.79%), Query Frame = 1
Query:  406 LKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQ-----GILSKLPVNEDVRISLILKDSDGKLVTERGILDPKVHIELKNLARPHCDIFD----------------RE----IPHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTLIG------------------SVMPLNKPMVI------------------LKPSEPTNL----DYLYKIGSKGFKPCDFGNPQSI-ITSGDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFK 1659
            + FF  ++D +L  +R  G I +TS++A  +T+A         + +  +NE+VRI +I +DS G+ +      +    +  +N       I D                RE    IP  + +  ++   G Y+L +K     IQGSP+ +                    S  P  +  V+                  LK     N+    DYL+ IG+KG    +F NP  I +T   ++LV DS N+ IQI++   ++L   G      G+L+RP+D+AET NG+YLV+DFEL  + VY   G+Y+S FGQ+ L GPKGI  D+ G+I+V D K   L  FK TGKFI +       DN+   P  + + S  +I V+D+  H +KVFD+NG+Y   FG+HG   G  + PTG+    +D++ VSDWGN+R+ +F+      R++ S  EP  GPQG+T       + + D GN+C KVF+
Sbjct:  194 MSFFPTELDQLLSMVRCVGVIGLTSIDAGKTTLAKDPDEEFSPIRRCLLNEEVRIDIIPRDSMGRCIMNPTAKEFTATLHSRNDYITEVKISDINDTERTGNALPNHPSREQLTNIPAALQVTYRIATPGAYDLGIKLYGEHIQGSPYMIYARAPCTPDVRSWLETIREISEAPRRRHTVLVSRRRCKSAPSCSVAGDKLKALADINVIGRGDYLFSIGTKGRGEGEFANPTGICVTREHKVLVADSNNASIQIFTTQAQFLFRIGEYGYHPGQLMRPMDVAETINGNYLVSDFELHCVTVYSPTGSYISRFGQRYLSGPKGIIADRNGRILVVDQKSCMLCIFKPTGKFINRFGARGSGDNQFTNPFSVAVNSQDEIYVSDYAQHAIKVFDQNGLYLFRFGEHGIEPGMLHAPTGLAFDKQDNLFVSDWGNNRVQVFDALGNFQRVISSAFEPFNGPQGLTFHTPTQRLFVTDPGNYCVKVFQ 677          
BLAST of Tripartite motif-containing protein 3-like vs. TrEMBL
Match: T1JNP3 (Uncharacterized protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 9.842e-77
Identity = 168/501 (33.53%), Postives = 269/501 (53.69%), Query Frame = 1
Query:  262 RQNQIL-SQLNNLMNSDNENEEGHERKWGNEGNETEINF--RLPDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERGILDPKVHIELKNLARPHCDIFDREIPHL---IDLNIKLPQAGEYELTVKFCESSIQGSPFTLIGSV---------------------------MPLNKPMVILKPSEPTNLDYLYKIGSKGFKPCDFGNPQSIITSGD-RILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            +Q ++L + LNNL +S    E     K  N G++TE+    ++P+EN  + L F    +  V K I   G+I   S  A  +T A +G L    V     +++I KD +  LV    +   ++  E+ ++  P C    + I H     DL   +P+ G Y+L+++  +  ++GSPF +   +                            P  K     + S P   D L ++G KG    +F NPQ +  S   +I++ DS N C+Q+++ +GE    FG + +  G+L RP  +A   NG+Y+V D++ K + +++  G +V+  G   LLGPKG+ VD+ G I+V DNK S ++ F+  GK I K       +N+ AGPHF+ I +   I+V+DF+NHC+KVFD +G +   FG +G+  G+FN PTGI    +D+I+V+DWGNSRI +F+        + +  +PL GPQG++LT+SG  +++ DSGNHCFK++KY
Sbjct:  328 QQRELLDACLNNLTSSCEFTE-----KALNHGSDTEVLIIQKMPEEN--DYLIFNESDLPAVKKCIYNMGSIQSNSAIAFETTAAGEG-LRHCIVGHPSLVTVISKDRNCDLVK---VGHSQITAEIVSITSPIC-YTAKVIDHRNGSYDLTYTIPKEGLYQLSIRLFDQHVKGSPFRIKAILEEESSSSDRPSSKIPRTTGVRQHATKRTPSAKSGGSNRRSNPIEDDLLLRVGFKGRNKGEFTNPQGVCCSNSGKIIIADSNNQCLQVFTSTGECKLRFGIRGRSAGQLQRPTGVACLDNGNYVVADYDNKWVSIFEPSGKFVNRIGVGKLLGPKGVAVDQDGHIVVVDNKASCIIVFQTNGKMINKFGSRGNQENQFAGPHFVAINNKNQIVVSDFHNHCIKVFDPDGGFLMSFGSNGEGNGQFNAPTGIAVDSQDNILVADWGNSRIQVFDCNGSFLSYVNTAADPLYGPQGLSLTDSG-HVVVADSGNHCFKLYKY 815          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Cavefish
Match: trim2b (tripartite motif containing 2b [Source:ZFIN;Acc:ZDB-GENE-090312-70])

HSP 1 Score: 252.677 bits (644), Expect = 1.727e-75
Identity = 144/457 (31.51%), Postives = 235/457 (51.42%), Query Frame = 1
Query:  382 PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLV-TERGILDPKVHIELKNLARPHCDIFDREI----PHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTLIGSVMPLNKPMVILKPSEPTNL-------------------------DYLYKIGSKGFKPCDFGNPQSIITSGDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            P+EN  +QL+   ++++ + K I   G I  T+  A  +  A +G L +  V +   + +  KD  G +  T   I+  +V         P+  + D EI        +    L + G++ L ++  +  I+GSPF L  +  P + P      + P +                          D +++IG+KG    +F N Q +  S + IL+ DS N C+QI+S  GE+ + FG + +  G+L RP  +A   NG  ++ D++ K + ++   G Y +  G   L+GPKG+ VD+ G +IV DNK   +  F+ +GK + K       D + AGPHF  + +  +I+VTDF+NH VKVF   G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG+ LT+ G  +++ DSGNHCFKV++Y
Sbjct:  205 PEEN--DQLELM-MEVEGLRKSIHNLGAIITTNAVASQTEAAGEG-LEQCVVGQPASVIITTKDKSGGVCKTGNAIISAEVFT-------PNGSVTDGEILDHKNGTYEFQYTLHKEGDFSLALRLYDQHIKGSPFRLKVTSSPDDSPPTTSGANSPGSRSRQKGVRRGGSLFSTPKKKVNPIEDDLIFRIGTKGRNKGEFTNLQGVAASPESILIADSNNQCVQIFSNQGEFQSRFGVRGRSPGQLQRPTGVAVHPNGDIIIADYDNKWVSIFTSDGKYKAKLGSGRLMGPKGVSVDQNGHVIVVDNKACMVFIFQPSGKLVTKFGSRGNGDKQFAGPHFAAVNNNNEIIVTDFHNHSVKVFSAEGEFLLKFGSNGEGNGQFNAPTGVAVDVNGNIIVADWGNSRIQVFDGSGSFLSYINTAADPLYGPQGLALTSDG-HVVVADSGNHCFKVYRY 649          

HSP 2 Score: 59.3066 bits (142), Expect = 6.841e-9
Identity = 40/162 (24.69%), Postives = 68/162 (41.98%), Query Frame = 1
Query: 1198 IIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSK---EEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK*SF 1674
            I++AD+ +  +  F   G+F  +     RS  +L  P  + +   GDI++ D+ N  V +F  +G Y+ + G      G    P G+       ++V D     + IF           S+   ++   GP      N+  EI++ D  NH  KVF  +  F
Sbjct:  407 ILIADSNNQCVQIFSNQGEFQSRFGVRGRSPGQLQRPTGVAVHPNGDIIIADYDNKWVSIFTSDGKYKAKLGS-----GRLMGPKGVSVDQNGHVIVVDNKACMVFIFQPSGKLVTKFGSRGNGDKQFAGPH-FAAVNNNNEIIVTDFHNHSVKVFSAEGEF 562          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Cavefish
Match: trim3a (tripartite motif containing 3a [Source:ZFIN;Acc:ZDB-GENE-080522-4])

HSP 1 Score: 241.121 bits (614), Expect = 1.243e-70
Identity = 140/449 (31.18%), Postives = 233/449 (51.89%), Query Frame = 1
Query:  421 IKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERGILDPKVHIELKNLARPHCDIFDREIPHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTLIGSVMPLNKPM------------------------VILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITSGD-RILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            ++ + + + I+  G +  TS     S    +G+   + V +   +++  KD  G+LV + G    K  I   + +    ++ D +     D+   L   GE+  ++      ++GSPF L  +V P + P                          + +PS           P   + +Y++G++G +  +F N Q I TS + RI+V DS N CIQ++S  G++   FG + +  G+L RP  +    NG  +V D++ + I ++   G + S  G   L+GPKG+ VDK G II ADNK   +  F++ GK + K      SD + +GPHF+ + +  +I+VTDF+NH VKV++ +G +  +FG HG+  G+FN PTG+      +I+V+DWGNSRI +F++       + +  +PL GPQG+ LT+ G  + + DSGNHCFKV++Y
Sbjct:  270 VETEGLRRSIQNLGVLLTTSAVGHTSVATGEGLRHAV-VGQLTTVTVTTKDKGGELV-KTGNAALKAQISGVDGSVLGAEVSDNK-NGTYDVGYTLRSEGEFSFSLLLYGQPVRGSPFRLR-AVKPCDAPQSPDDVKRRVKSPGGGGGGGHVRQKAVRRPSSMYSTTKKKENPIEDELIYRVGTRGRERGEFSNLQGISTSSNGRIVVADSNNQCIQVFSNDGQFKLRFGVRGRSPGQLQRPTGVTVDMNGDIIVADYDNRWITIFSSDGKFKSKIGAGRLMGPKGVAVDKNGHIIAADNKACCVFIFQSNGKLVTKFGAKGTSDRQFSGPHFVAVNNKNEIVVTDFHNHSVKVYNADGEFLFKFGSHGEGNGQFNAPTGVAVDGNGNIIVADWGNSRIQVFDSSGSFLSYINTTADPLYGPQGLALTSDG-HVAVADSGNHCFKVYRY 713          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Cavefish
Match: trim2a (tripartite motif containing 2 [Source:NCBI gene;Acc:103036279])

HSP 1 Score: 241.506 bits (615), Expect = 1.348e-70
Identity = 142/458 (31.00%), Postives = 235/458 (51.31%), Query Frame = 1
Query:  382 PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERG-ILDPKVHIELKNLARPHCDIFDREIPHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTLIGS--VMPLN-----------------KPMVILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITSG-DRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            P+EN  +QL+F  ++ + + K I   G I  T+  A  +    +G L          +++  KD DG L    G +L  ++      +     ++ D +     +    LP+ G + L+++     I+GSPF++  +  V PL                  K   I +P+           P   D +++IG+KG    +F N Q +  S   ++L+ DS N C+QI+S  G++ + FG + +  G+L RP  +A    G  ++ D++ K + ++   G + +  G   L+GPKG+ VD+ G IIV DNK   +  F+  GK + K  +    D + AGPHF  +    +I+VTDF+NH VKVF+  G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG+ LT+ G  +++ DSGNHCFKV++Y
Sbjct:  294 PEEN--SQLEFL-VETEGLRKSIHNLGAIVTTNAVAGETVATGEG-LRHCTAGRPTSVTVTTKDKDGGLCRMGGALLTAQLSDVEDGIPFNEGELMDHK-NGTYEFLYTLPREGRFTLSLRLYGHHIRGSPFSIRANKPVDPLANADGAKKRLKSPGSGHVKQRAIKRPASMYSSGRRKENPIEDDLMFRIGTKGRNKGEFTNLQGVAASNVGKVLIADSNNQCVQIFSNDGQFKSRFGVRGRSPGQLQRPTGVAVHPTGDIIIADYDNKWVSIFSNDGKFKTKIGSGKLMGPKGVTVDRNGHIIVVDNKACCVFIFQPNGKLVTKFGNRGNGDKQFAGPHFAAVNQNNEIIVTDFHNHSVKVFNPEGEFLLKFGSNGEGNGQFNAPTGVAVDVNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDG-HVVVADSGNHCFKVYRY 745          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Cavefish
Match: trim2a (tripartite motif containing 2 [Source:NCBI gene;Acc:103036279])

HSP 1 Score: 241.506 bits (615), Expect = 1.348e-70
Identity = 142/458 (31.00%), Postives = 235/458 (51.31%), Query Frame = 1
Query:  382 PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERG-ILDPKVHIELKNLARPHCDIFDREIPHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTLIGS--VMPLN-----------------KPMVILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITSG-DRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            P+EN  +QL+F  ++ + + K I   G I  T+  A  +    +G L          +++  KD DG L    G +L  ++      +     ++ D +     +    LP+ G + L+++     I+GSPF++  +  V PL                  K   I +P+           P   D +++IG+KG    +F N Q +  S   ++L+ DS N C+QI+S  G++ + FG + +  G+L RP  +A    G  ++ D++ K + ++   G + +  G   L+GPKG+ VD+ G IIV DNK   +  F+  GK + K  +    D + AGPHF  +    +I+VTDF+NH VKVF+  G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG+ LT+ G  +++ DSGNHCFKV++Y
Sbjct:  294 PEEN--SQLEFL-VETEGLRKSIHNLGAIVTTNAVAGETVATGEG-LRHCTAGRPTSVTVTTKDKDGGLCRMGGALLTAQLSDVEDGIPFNEGELMDHK-NGTYEFLYTLPREGRFTLSLRLYGHHIRGSPFSIRANKPVDPLANADGAKKRLKSPGSGHVKQRAIKRPASMYSSGRRKENPIEDDLMFRIGTKGRNKGEFTNLQGVAASNVGKVLIADSNNQCVQIFSNDGQFKSRFGVRGRSPGQLQRPTGVAVHPTGDIIIADYDNKWVSIFSNDGKFKTKIGSGKLMGPKGVTVDRNGHIIVVDNKACCVFIFQPNGKLVTKFGNRGNGDKQFAGPHFAAVNQNNEIIVTDFHNHSVKVFNPEGEFLLKFGSNGEGNGQFNAPTGVAVDVNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDG-HVVVADSGNHCFKVYRY 745          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Cavefish
Match: trim2a (tripartite motif containing 2 [Source:NCBI gene;Acc:103036279])

HSP 1 Score: 241.506 bits (615), Expect = 1.348e-70
Identity = 142/458 (31.00%), Postives = 235/458 (51.31%), Query Frame = 1
Query:  382 PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERG-ILDPKVHIELKNLARPHCDIFDREIPHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTLIGS--VMPLN-----------------KPMVILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITSG-DRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            P+EN  +QL+F  ++ + + K I   G I  T+  A  +    +G L          +++  KD DG L    G +L  ++      +     ++ D +     +    LP+ G + L+++     I+GSPF++  +  V PL                  K   I +P+           P   D +++IG+KG    +F N Q +  S   ++L+ DS N C+QI+S  G++ + FG + +  G+L RP  +A    G  ++ D++ K + ++   G + +  G   L+GPKG+ VD+ G IIV DNK   +  F+  GK + K  +    D + AGPHF  +    +I+VTDF+NH VKVF+  G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG+ LT+ G  +++ DSGNHCFKV++Y
Sbjct:  294 PEEN--SQLEFL-VETEGLRKSIHNLGAIVTTNAVAGETVATGEG-LRHCTAGRPTSVTVTTKDKDGGLCRMGGALLTAQLSDVEDGIPFNEGELMDHK-NGTYEFLYTLPREGRFTLSLRLYGHHIRGSPFSIRANKPVDPLANADGAKKRLKSPGSGHVKQRAIKRPASMYSSGRRKENPIEDDLMFRIGTKGRNKGEFTNLQGVAASNVGKVLIADSNNQCVQIFSNDGQFKSRFGVRGRSPGQLQRPTGVAVHPTGDIIIADYDNKWVSIFSNDGKFKTKIGSGKLMGPKGVTVDRNGHIIVVDNKACCVFIFQPNGKLVTKFGNRGNGDKQFAGPHFAAVNQNNEIIVTDFHNHSVKVFNPEGEFLLKFGSNGEGNGQFNAPTGVAVDVNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDG-HVVVADSGNHCFKVYRY 745          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Sea Lamprey
Match: trim2b (tripartite motif containing 2b [Source:ZFIN;Acc:ZDB-GENE-090312-70])

HSP 1 Score: 227.254 bits (578), Expect = 8.278e-71
Identity = 108/271 (39.85%), Postives = 167/271 (61.62%), Query Frame = 1
Query:  853 LYKIGSKGFKPCDFGNPQSIITSGD-RILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            L   G+KG    +F N Q + TSG+ RI++ DS N C+Q+++  G + + FG + +  G+L RP  +A   NG  +V D++ K + ++   G + S  G   LLGPKG+ VD+ G IIV DNK   +  F+ +GK + +       D + AGPHF+ + S  DI+VTDF+NH VKVF+ +G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F++       + +  +PL GPQG+ LT  G  +++ DSGNHCFK+++Y
Sbjct:    1 LLPAGTKGRNKGEFTNLQGVATSGNSRIVIADSNNQCVQVFTNDGTFKSRFGVRGRSPGQLQRPTGVAVHPNGDVIVADYDNKWVSIFGTDGKFKSKLGAGKLLGPKGVAVDRNGHIIVVDNKACCVTAFQPSGKLVTRFGSRGNGDKQFAGPHFVAVNSNNDIIVTDFHNHSVKVFNSDGEFLLKFGSNGEGNGQFNAPTGVAVDALGNIIVADWGNSRIQVFDSSGSFLSYINTSADPLYGPQGLALTCDG-HVIVADSGNHCFKIYRY 270          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009943.1 (pep scaffold:Pmarinus_7.0:GL488567:275:4344:1 gene:ENSPMAG00000008992.1 transcript:ENSPMAT00000009943.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.916 bits (263), Expect = 1.843e-24
Identity = 63/227 (27.75%), Postives = 113/227 (49.78%), Query Frame = 1
Query:  850 YLYKIGSKGFKPCDFGNPQSII---TSGDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETT-NGHYLVTDFELKIILVYDLLGNYVSSFGQKVLL-----GPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGN 1503
            +L+K G+ G  P  F  P  +      G RI+V+D  N  +QI+S  G  L+ FG +  ++G+   P D+A +  +G  LV+D     + ++   G +V+ +G +  L      P+G+  D  G+++V D  +  L+  +   +  + +  +     +   P  + +   G I V D  NH V+VF+ +G +  +FG  G   G+ + P+G+  + E  IVV D+GN
Sbjct:  328 FLFKFGAHGSHPGQFDRPAGVAWDPGRGGRIVVSDKDNHRVQIFSGEGRVLSTFGERGSESGQFCYPWDVAVSPGDGLILVSDTRNHRVQLFSPDGAFVNKYGFEGALWKHFDSPRGVAFDAEGRLLVTDFNNHRLLVVRPDCRSARFLGGSGSGPGQFLRPQGVAVDPEGRIAVADSRNHRVQVFEPDGAFLCQFGAPGGGPGQMDRPSGVAVTPEGLIVVVDFGN 554          

HSP 2 Score: 93.2041 bits (230), Expect = 2.757e-20
Identity = 114/529 (21.55%), Postives = 206/529 (38.94%), Query Frame = 1
Query:  169 NMTNLTASL-NLDAVSEQVEQSFQMLHNA--LNVRQNQILSQLNNLMNSDNENEEGHERKWGNEGNETEINFRLPDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERGILDPKVHIELKNLARPH-CDIFDREIPHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTLI---GSVMPLNKPMVILKP--SEPTNLDYLYKIGSKGFK-PC----------------DFGNPQSI-ITSGDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIA--ETTNGHYLVTDFELKIILVYDLLGNYVSSFGQK-----VLLGPKGICVDKT-GQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIF--NNRFMCT-RILKSKEEPLCGPQGITLTNSGTEILIVDSGNH 1641
             +  L  SL  LD+  E V  + +   +A  L   + ++ +QL +++           ++      +  + F  PD  L   ++  G        E+               ST+A +G L+K+        +++ +D  G+     G  DP     L    R    ++ D++      ++ +    GE+ ++V      ++GSPF ++   G   P +  +   +P   EP +      +   G + PC                    P  + + S  R++V D  N  IQ++  SG +L  FG      G+  RP  +A      G  +V+D +   + ++   G  +S+FG++         P  + V    G I+V+D ++  +  F   G F+ K             P  +   + G +LVTDF NH + V   +       G  G   G+F  P G+    E  I V+D  N R+ +F  +  F+C           +  P G+ +T  G  I++VD GN+
Sbjct:   50 QLEELRQSLARLDSAVESVRAALEAGADAEALGAVRARVAAQLRDIVGLGTAGAPSPPQQ---PQEDDRVVFVPPDAALYAAIRTLGAVQSGACPEL---------------STVAGEG-LTKVVKGRLASFTVVTRDHGGEFRRTGG--DPVCAAALGPDGRAAWAEVRDKQ-DGTYGVSYRPAADGEHTVSVTVLGRHVEGSPFRVLVRPGRSRPSHSEVRDARPIGGEPGSSKRQACVAQPGTRTPCVCHSKVIFSCGGTGDGQLCRPWGVCVDSEGRVIVADRSNDRIQVFGPSGGFLFKFGAHGSHPGQFDRPAGVAWDPGRGGRIVVSDKDNHRVQIFSGEGRVLSTFGERGSESGQFCYPWDVAVSPGDGLILVSDTRNHRVQLFSPDGAFVNKYGFEGALWKHFDSPRGVAFDAEGRLLVTDFNNHRLLVVRPDCRSARFLGGSGSGPGQFLRPQGVAVDPEGRIAVADSRNHRVQVFEPDGAFLCQFGAPGGGPGQMDRPSGVAVTPEGL-IVVVDFGNN 555          

HSP 3 Score: 59.3066 bits (142), Expect = 1.338e-9
Identity = 40/134 (29.85%), Postives = 65/134 (48.51%), Query Frame = 1
Query: 1288 DNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICC--SDEDDIVVSDWGNSRIVIFN--NRFMCTRILKSKEE-PLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK*SF 1674
            D +L  P  + + S G ++V D  N  ++VF  +G +  +FG HG   G+F+ P G+         IVVSD  N R+ IF+   R + T   +  E    C P  + ++     IL+ D+ NH  ++F    +F
Sbjct:  292 DGQLCRPWGVCVDSEGRVIVADRSNDRIQVFGPSGGFLFKFGAHGSHPGQFDRPAGVAWDPGRGGRIVVSDKDNHRVQIFSGEGRVLSTFGERGSESGQFCYPWDVAVSPGDGLILVSDTRNHRVQLFSPDGAF 425          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005035.1 (pep scaffold:Pmarinus_7.0:GL476697:205350:209715:-1 gene:ENSPMAG00000004581.1 transcript:ENSPMAT00000005035.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.6481 bits (200), Expect = 1.796e-17
Identity = 65/232 (28.02%), Postives = 110/232 (47.41%), Query Frame = 1
Query: 1000 FGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVD------KTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN--NRFM----CTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFK 1659
            FG K  + GR   P  +A T  GH +V D     + V+D  G ++ + G       +  C+       + G I+VAD  +  +  F  TG+F++          +L+ P  +   S+G + V D  NH V+VF  +G++   FG  G   G  ++P  +  + +  + VSD GN R+ IF+   R++     +    S    +  P+G+ +  SG  I++ DSGN+  KVF+
Sbjct:    7 FGCKGTEEGRFTWPRGLAVTPEGHLIVADSSNHRLQVFDWSGRFIRAIGSHGSGDGQFDCLSGVTVNAQLGLILVADRYNHRVQIFDRTGRFLRAFGREGAGRGQLSYPWGVACDSSGLVYVCDKDNHRVQVFSPDGVFVRGFGGPGSGEGRLDHPHYLAVTPQGRVAVSDCGNHRVQIFDRYGRYISKLGDSSGSGSGPGQMRYPRGVAVDRSGN-IVVADSGNNRVKVFR 237          

HSP 2 Score: 71.2478 bits (173), Expect = 5.962e-14
Identity = 59/248 (23.79%), Postives = 101/248 (40.73%), Query Frame = 1
Query:  931 ILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIY---QNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIF--NNRFM-CTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVF 1656
            ILV D  N  +QI+  +G +L  FG +    G+L  P  +A                                           D +G + V D  +  +  F   G F++        + +L  PH+L +   G + V+D  NH V++FD+ G Y     +    G   G+  YP G+      +IVV+D GN+R+ +F  +  F+       S++  + G +G+ L     +I++ D  NH  ++F
Sbjct:   79 ILVADRYNHRVQIFDRTGRFLRAFGREGAGRGQLSYPWGVA------------------------------------------CDSSGLVYVCDKDNHRVQVFSPDGVFVRGFGGPGSGEGRLDHPHYLAVTPQGRVAVSDCGNHRVQIFDRYGRYISKLGDSSGSGSGPGQMRYPRGVAVDRSGNIVVADSGNNRVKVFRPDGTFLHAFGSWGSEDGQMKGLEGLAL--HAGDIVVCDRENHRIQIF 282          

HSP 3 Score: 65.0846 bits (157), Expect = 6.632e-12
Identity = 50/186 (26.88%), Postives = 84/186 (45.16%), Query Frame = 1
Query:  850 YLYKIGSKGFKPCDFGNPQSIIT-SGDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKV--------LLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVF 1380
            +L   G +G        P  +   S   + V D  N  +Q++S  G ++  FG      GRL  P  +A T  G   V+D     + ++D  G Y+S  G           +  P+G+ VD++G I+VAD+ ++ +  F+  G F+         D ++ G   L  +  GDI+V D  NH +++F
Sbjct:   98 FLRAFGREGAGRGQLSYPWGVACDSSGLVYVCDKDNHRVQVFSPDGVFVRGFGGPGSGEGRLDHPHYLAVTPQGRVAVSDCGNHRVQIFDRYGRYISKLGDSSGSGSGPGQMRYPRGVAVDRSGNIVVADSGNNRVKVFRPDGTFLHAFGSWGSEDGQMKGLEGLA-LHAGDIVVCDRENHRIQIF 282          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Nematostella
Match: EDO36857 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHB3])

HSP 1 Score: 125.176 bits (313), Expect = 6.288e-33
Identity = 73/236 (30.93%), Postives = 126/236 (53.39%), Query Frame = 1
Query:  841 NLDYLYKIGSKGFKPCDFGNPQSI-ITSGDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLG--------PKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIF 1521
            N  +L++ GS G       +P  + +T    I+V+D  N+ +Q++S  GE+   F P+++    L  P  +A  T+G  +V D     I++YD  GN+V+SFG    LG        P  + ++  G IIV+D  +  +  F +TG ++ +   + R D +   P  + + S  +++V+D +NH +++F  +G Y ++FG  G   GEF  P G+  + +  IVV+DWGN RI +F
Sbjct:    2 NSKFLFRFGSLGRGEGQLQSPSGVAVTPDGNIVVSDMINNRMQVFSIKGEFQRAF-PEDES---LHHPSGVAVDTDGRVIVVDRGNARIVIYDSKGNHVTSFGS---LGNGRGQFNCPSHVAINSKGHIIVSDFGNDRIQVFSSTGSYMFRFGRSGRGDGEFNWPTGVGVNSRDEVIVSDSFNHRIQIFRADGSYLSQFGSEGSREGEFKRPEGVAVAHQGSIVVADWGNDRIQVF 230          

HSP 2 Score: 77.411 bits (189), Expect = 3.547e-16
Identity = 54/197 (27.41%), Postives = 96/197 (48.73%), Query Frame = 1
Query: 1096 KIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNR----FMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK*SF 1674
            K +  +  LG      G+  L  P G+ V   G I+V+D  ++ +  F   G+F +   +    D  L  P  + + + G ++V D  N  + ++D  G +   FG  G+  G+FN P+ +  + +  I+VSD+GN RI +F++     F   R  +   E    P G+ + NS  E+++ DS NH  ++F+   S+
Sbjct:    4 KFLFRFGSLGR-----GEGQLQSPSGVAVTPDGNIVVSDMINNRMQVFSIKGEFQRAFPE----DESLHHPSGVAVDTDGRVIVVDRGNARIVIYDSKGNHVTSFGSLGNGRGQFNCPSHVAINSKGHIIVSDFGNDRIQVFSSTGSYMFRFGRSGRGDGE-FNWPTGVGV-NSRDEVIVSDSFNHRIQIFRADGSY 189          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Nematostella
Match: EDO34308 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPQ3])

HSP 1 Score: 123.25 bits (308), Expect = 1.388e-29
Identity = 107/416 (25.72%), Postives = 185/416 (44.47%), Query Frame = 1
Query:  448 IREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERGILDPKVHIELK--NLARPHCDIFDREIPHLIDLNIKLPQA-GEYELTVKFCESSIQGSPFTLIGSVMPLNKPMVILKPSEPTNLDYLYKIGSKGFKPCDFGNPQSI-ITSGDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQK-----VLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGD-ILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSK---EEPLCGPQGITLTNSGTEILIVDSGNHCFKVF 1656
            ++  G I   S  A  S  + +GI +   V  +    LI KD  GK    R +   KV +E+K  + +   C I D+     +   I  P+  G +   V   + +I  SPFT+          +V+ +         + K G  G K  +F +P  + I +  RI V DS N  +Q+    GE++T FG   ++ G    P D+     G  ++ D     + V +  G ++  FG++         P G+ V    +I+VAD +++ +  F   GKF+ K         +   P +L++ +  D I V+D  NH ++VFD NG+Y   FG  G   G+F +P G+       ++++D GN R+ I N+     + + S+   +  L  P+ + +  +   I++ D  N+   VF
Sbjct:  356 VQSLGQIRAASTFASISFASGEGIHTA-RVKVEAHFKLITKDRHGK----RSMGGDKVVVEIKQPDGSDLPCRIEDKGDGSYMVYYI--PEVNGRHLAHVMISDKAIMDSPFTI----------LVVNRREYKEVGGTIMKFGQYGSKKREFKSPFGVAIDNEGRIYVADSYNHRVQVLGTRGEFITSFGSHGERRGEFNCPTDVDIDNRGRVIICDNGNNRVQVLNRNGGFIGKFGREGTGNGYFKSPWGLAVTANNEIVVADMENNRVQMFSPEGKFMMKFGSPGDRPGQFNAPGYLLVNNEDDQIFVSDSKNHRIQVFDMNGVYIRSFGSQGAGKGQFMHPRGLAMDIAGHLIIADMGNHRLQILNSAGEFVKEIGSEGSGDGQLSFPESVAIMPNSGYIVVSDLSNNRIHVF 754          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Nematostella
Match: EDO29851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2G3])

HSP 1 Score: 119.398 bits (298), Expect = 1.564e-28
Identity = 68/233 (29.18%), Postives = 117/233 (50.21%), Query Frame = 1
Query:  847 DYLYKIGSKGFKPCDFGNPQSIITSG--DRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFG------QKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIF 1521
            ++++K GS G +   F  P  +      DRI+V D  N  +Q++S  G +L  FG K  K G+   P D+A  + G+ LV+D     + ++   G +++ +G       K    P+G+     G++IV D  +  L+      K  + +        +   P  + +   G+I+V D  NH +++F  NG +  +FG HG + G+ + P+GIC S +  IVV D+GN+RI +F
Sbjct:  351 NFVHKFGSAGSRNGQFDRPAGVTCDHERDRIIVADKDNHRVQVFSLDGTFLLKFGEKGSKNGQFSYPWDVAVNSEGNILVSDTRNHRVQLFTCDGQFLNKYGFEQGIHWKCFDSPRGVAFAHDGRMIVTDFNNHRLLVISGDCKSAQWLGTEGSGLTQFVRPQGVCVDQEGNIVVADSRNHRIQIFQPNGNFLCKFGSHGGALGQLDRPSGICVSPDGLIVVVDFGNNRIQVF 583          

HSP 2 Score: 101.679 bits (252), Expect = 8.377e-23
Identity = 67/240 (27.92%), Postives = 119/240 (49.58%), Query Frame = 1
Query:  970 YSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQK-----VLLGPKGI-CVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFG-QHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCG---PQGITLTNSGTEILIVDSGNHCFKVFK 1659
            Y+  G  L  FG + +  G+L RP  +    NG  +V D     I ++D  GN+V  FG           P G+ C  +  +IIVAD  +  +  F   G F+ K  +    + + + P  + + S G+ILV+D  NH V++F  +G + N++G + G  W  F+ P G+  + +  ++V+D+ N R+++ +      + L ++   L     PQG+ +   G  I++ DS NH  ++F+
Sbjct:  299 YNGVGPVLLSFGSEGESGGQLCRPWGVCCDRNGSIIVADRSNNRIQIFDNYGNFVHKFGSAGSRNGQFDRPAGVTCDHERDRIIVADKDNHRVQVFSLDGTFLLKFGEKGSKNGQFSYPWDVAVNSEGNILVSDTRNHRVQLFTCDGQFLNKYGFEQGIHWKCFDSPRGVAFAHDGRMIVTDFNNHRLLVISGDCKSAQWLGTEGSGLTQFVRPQGVCVDQEGN-IVVADSRNHRIQIFQ 537          

HSP 3 Score: 50.8322 bits (120), Expect = 1.260e-6
Identity = 30/95 (31.58%), Postives = 45/95 (47.37%), Query Frame = 1
Query: 1408 FGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNN------RFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK*SF 1674
            FG  G+S G+   P G+CC     I+V+D  N+RI IF+N      +F       S+      P G+T  +    I++ D  NH  +VF    +F
Sbjct:  309 FGSEGESGGQLCRPWGVCCDRNGSIIVADRSNNRIQIFDNYGNFVHKFGSA---GSRNGQFDRPAGVTCDHERDRIIVADKDNHRVQVFSLDGTF 400          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Nematostella
Match: EDO47715 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLM1])

HSP 1 Score: 119.783 bits (299), Expect = 2.137e-28
Identity = 90/328 (27.44%), Postives = 151/328 (46.04%), Query Frame = 1
Query:  712 QAGEYELTVKFCESSIQGSPFTL-IGSVMPLNKPMVILKPSEPTNLDYLYKIGSKGFKPCDFGNPQSIITSGDR--ILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLG-------PKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNR--FMCTRILKSKEEP-LCGPQGITLTNSGTEILIVDSGNHCFKVF 1656
            Q G +++ V     +I GSPF++ +   M   K    ++             GS+G    +F  P ++    +    +VTD  N  +Q++  +G ++  FG +    G+   P  IA  TNGH +V DF    + +++  G ++  FG     G       P G+     G I++++  +  +  F   G+ I+       +  +   PH L +     ++V D  N  ++VF+  G     FG+ G   G F+ P G+ C DED+I+VSD+ N R+ IFN    F+        EE     P GI +TN G  +++VDSGNH  ++F
Sbjct:  435 QRGNHKIIVTIRNRNIGGSPFSVNVTGRMNYKKLGKAIRT-----------FGSEGAGGGEFSIPWAVAIDEENECFIVTDCNNHRVQVFDFNGVFMFKFGCEGIDKGQFKNPKGIARLTNGHIVVADFNNHRVQIFNEDGRFLRKFGFYGTGGEPGSMNHPCGVACTPGGLILISEQDNHRIQMFDVNGEPIRMFGSQGFTKGQFIYPHHLCVTQRDKVVVADCVNDRIQVFNIEGECLFSFGKEGTQNGLFDGPEGVTCDDEDNILVSDYHNHRVQIFNAEGGFVAAFGQFGDEEGNFRNPCGIAVTNDGN-VVVVDSGNHRIQIF 750          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Nematostella
Match: EDO47642 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLP9])

HSP 1 Score: 114.005 bits (284), Expect = 1.239e-26
Identity = 87/322 (27.02%), Postives = 145/322 (45.03%), Query Frame = 1
Query:  718 GEYELTVKFCESSIQGSPFTLIGSVMPLNKPMVILKPSEPTNLDYLYKIGSKGFKPCDFGNPQSIITSGD-RILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKV-----LLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSK---EEPLCGPQGITLTNSGTEILIVDSGNHCFKVF 1656
            G++ + V      I+GSPFT+           V+        +    KIGS+G K  +F  P S+ T  D  I VTD  N  +Q +   G++L   G K  K G+L+ P  +   ++G  +V+D++   + ++   G +VS  G+K       L P G+ +++ G ++V D  ++ +   K  G  +        +D +L  P  + +      LVTD  N+ +  FD +G +   FG  G   G  + P GI    E  I++SD+ N R+ + +          S+   E     P GI LT  G  +++ D  NH  +VF
Sbjct:  401 GKHVIVVSIRGRQIEGSPFTV----------KVVEGIDYKNVMAVFMKIGSQGTKSGEFRQPSSVATDTDGNIYVTDFVNCRVQKFDMFGKHLKDIGTKGSKDGQLMNPCGVVVGSDGTLIVSDWDNHRVQMFSPEGKFVSKIGRKGSENGNFLHPSGLALNQDGDLVVIDKDNNRVQVLKLDGSHVMSFGSLGNADGQLDCPSHVAVTPDNGYLVTDTGNNRIVKFDASGNHVMSFGTKGSGEGRLDRPAGIAIDPEGFIIISDFQNHRVQVHSPEGEFYATFGSEGNIEGQFKFPSGIALTLDG-HVIVADRHNHRIQVF 711          

HSP 2 Score: 54.6842 bits (130), Expect = 8.034e-8
Identity = 37/144 (25.69%), Postives = 64/144 (44.44%), Query Frame = 1
Query: 1237 FKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN--NRFMCTRILKSKEEP-LCGPQGITLTNSGTEILIVDSGNHCFKVFK 1659
            +K       K+        +   P  +   + G+I VTDF N  V+ FD  G +  + G  G   G+   P G+    +  ++VSDW N R+ +F+   +F+     K  E      P G+ L   G +++++D  N+  +V K
Sbjct:  429 YKNVMAVFMKIGSQGTKSGEFRQPSSVATDTDGNIYVTDFVNCRVQKFDMFGKHLKDIGTKGSKDGQLMNPCGVVVGSDGTLIVSDWDNHRVQMFSPEGKFVSKIGRKGSENGNFLHPSGLALNQDG-DLVVIDKDNNRVQVLK 571          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Medaka
Match: trim3a (tripartite motif-containing protein 3 [Source:NCBI gene;Acc:101175583])

HSP 1 Score: 243.817 bits (621), Expect = 2.236e-71
Identity = 140/447 (31.32%), Postives = 229/447 (51.23%), Query Frame = 1
Query:  421 IKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERGILDPKVHIELKNLARPHCDIFDREIPHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTLIGSVMP---LNKP-------------------MVILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITSGD-RILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            ++ D + + I+  G +  T      S    +G+   L V +   I++  KD DG+LV + G    +  I   +  R   ++ D +     ++   +   GE+  ++      ++GSPF L  +V P   L  P                     + +PS           P   + +Y++G++G    +F N Q I  S + RI+V DS N CIQ++S  G++   FG + +  G+L RP  +    NG  +V D++ + I ++   G + +  G   L+GPKG+ VDK G II ADNK   +  F++ GK + K      SD    GPHF+ + +  +I+VTDF+NH VKV++ +G +  +FG HG+  G+FN PTG+      +I+V+DWGNSRI +F++       + +  +PL GPQG+ LT+ G  + + DSGNHCFKV++Y
Sbjct:  308 VETDGLRRSIQNMGVLITTGAVGHTSVATGEGLRHAL-VGQHTSITVTTKDKDGELV-KSGNAALRAEIVSADGVRTEAEVVDNK-NGTYEVGYTVRSEGEFTFSLLLYGQPVKGSPFRL-RAVKPSDVLQSPEDVKRRVKSPSGGGGHVRQKAVRRPSSMYSTTKKKENPIEDELIYRVGTRGRDKGEFTNLQGISASSNGRIVVADSNNQCIQVFSNDGQFKMRFGVRGRSPGQLQRPTGVTVDVNGDIIVADYDNRWISIFSSDGKFKNKIGAGRLMGPKGVAVDKNGHIITADNKACCVFIFQSNGKLVTKFGARGTSDRHFTGPHFVAVNNKNEIVVTDFHNHSVKVYNADGEFLFKFGSHGEGNGQFNAPTGVAVDANGNIIVADWGNSRIQVFDSSGSFLSYINTSADPLYGPQGLALTSDG-HVAVADSGNHCFKVYRY 749          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Medaka
Match: trim2b (tripartite motif-containing protein 2 [Source:NCBI gene;Acc:101163206])

HSP 1 Score: 241.506 bits (615), Expect = 3.858e-71
Identity = 168/571 (29.42%), Postives = 264/571 (46.23%), Query Frame = 1
Query:  223 EQSFQMLHNALNVRQNQIL---------------SQLNNLMNSD-------NENEEG--HERKWGNEGNETEINFRL-----------PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKD-SDGKLVTERGILDPKVHIELKNLARPHCDIFDREIPH----LIDLNIKLPQAGEYELTVKFCESSIQGSPFTLIGSVMPLNKPMVILKPS--------------------------------------------------EPTNLDYLYKIGSKGFKPCDFGNPQSIITSG-DRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            + SF+ LH  L+VR++ +L               +Q++ L+  D        + EE    E    N   E ++  RL           P+EN  +QL    ++ D + K I   GTI  TS  A  S     G+   + V     ++++ +D S G   +   IL  +V         P   I D EI        +    +P+ G++ L ++     I+GSPF L   V+  ++  V + PS                                                   P   D ++KIG+KG    +F N Q +  S   RIL+ DS N C+QI+S  GE+ + FG + +  G+L RP  +A   +G  ++ D++ K + ++   G + +  G   L+GPKG+ VD+ G +IV DNK  ++  F+ TGK I K       D + AGPHF  +    +I++TDF+NH VKVF   G    +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG+ LT+ G  +++ DSGNHCFKV++Y
Sbjct:  113 QSSFEDLHKQLDVRKSVLLMELEVTYGLKQKVLQAQIDRLLRGDEDISSVCTQTEEALAGEACAANLQVERDLGERLGELAHLCIPSQPEEN--DQLDLI-LETDGLRKSIHNLGTILTTSAVASQSEAMGAGLEQSI-VGLPASVTIVTRDKSGGACKSGNAILSAEVFT-------PDGSIVDGEIVDHKNGTYEFVYTVPKEGDFSLALRLYNQHIKGSPFKL--KVIRASEVEVEVSPSTTTATNSAANATPSTGSSEGAKRRGKSPGQKKKGSKRASSALGTPRRKTQNPIEDDLIFKIGTKGRNKGEFTNLQGVAASSIGRILIADSNNQCVQIFSNEGEFKSRFGVRGRTPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFTSEGKFKAKLGSGRLMGPKGVSVDQNGHVIVVDNKACTVFIFQLTGKLITKFGSRGNGDKQFAGPHFAAVNKNNEIIITDFHNHSVKVFTPEGELVLKFGSNGEGNGQFNAPTGVAVDTNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDG-HVVVADSGNHCFKVYRY 669          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Medaka
Match: trim3b (tripartite motif-containing protein 3 [Source:NCBI gene;Acc:101169131])

HSP 1 Score: 241.891 bits (616), Expect = 1.037e-70
Identity = 140/448 (31.25%), Postives = 231/448 (51.56%), Query Frame = 1
Query:  421 IKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLV-TERGILDPKVHIELKNLARPHCDIFDREIPHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTLIGSVMPLNKPM----------------------VILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITSGD-RILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            ++ + + + I+  G +  T+  A  S    +G L  +   +   I++  KD DG+LV T   IL   +   +        +I D +     ++   L   GEY  ++      I+GSPF L  +V P + P                        + +PS           P   + +Y++GS+G +  +F N Q I  S + R++V DS N CIQ++S  G++   FG + +  G+L RP  +    NG  +V D++ + + ++   G + +  G   L+GPKG+ VDK G II  DNK   +  F++ GK + K      +D + AGPHF+ + +  +I+VTDF+NH VKV++ +G +  +FG HG+  G+FN PTG+      +I+V+DWGNSRI +F++       + +  +PL GPQG+ LT+ G  + + DSGNHCFKV++Y
Sbjct:  308 VETEGLRRSIQNLGVLLTTAAVAHTSVATGEG-LRYVATGQHHTITVTTKDKDGELVRTGNAILRADI-TSVDGSRAAETEITDNK-NGTYEVGYTLRSEGEYSFSLLLYGQPIRGSPFRL-RAVKPSDVPQSPDDVKRRVKSPSGTGGHIRQKAVRRPSSMYSTTKKKENPIEDELIYRVGSRGREKGEFTNLQGISASSNGRVVVADSNNQCIQVFSNDGQFKMRFGVRGRSPGQLQRPTGVTVDMNGDIVVADYDNRWVSIFGSDGKFKNKIGAGRLMGPKGVAVDKNGHIITVDNKACCVFIFQSNGKLVTKFGGRGTTDRQFAGPHFVAVNNKNEIIVTDFHNHSVKVYNADGEFLFKFGSHGEGNGQFNAPTGVAVDANGNIIVADWGNSRIQVFDSTGSFLSYINTSADPLYGPQGLALTSDG-HVAVADSGNHCFKVYRY 750          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Medaka
Match: trim2a (tripartite motif containing 2 [Source:NCBI gene;Acc:101163547])

HSP 1 Score: 241.121 bits (614), Expect = 1.981e-70
Identity = 147/457 (32.17%), Postives = 233/457 (50.98%), Query Frame = 1
Query:  382 PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERGILDPKVHIELKNLARPHCDIFDREIPHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTLI------------GSVMPLNKP-------MVILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITSG-DRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            P EN  NQL F  ++ + + K I   GTI  T+  A   T+A    L    V     I++  KD DG+L      L     I   + +R   +I D +     +      + G + L+++     I+GSPF +             G+   L  P         I +P+           P   D +++IG+KG    +F N Q +  S   ++L+ DS N C+Q++S  G++ + FG + +  G+L RP  +A   NG  ++ D++ K + ++   G + +  G   L+GPKG+ VDK G IIV DNK   +  F+  GK + K  +    D + AGPHF  + +  +I+VTDF+NH VKVF+  G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG+ LT+ G  +++ DSGNHCFKV++Y
Sbjct:  293 PKEN--NQLDFL-VETEGLKKSIHNLGTIVTTNAVAS-ETVATGESLRHCVVGVPTSITITTKDKDGELCKMGNAL-ITTEISPPDNSRDIGEILDNK-NGTYEYIFTAAKEGTFNLSLRLYNQHIKGSPFRIKAIKSIDACPKSDGTKKRLKSPGSGHIKQRAIKRPASMYSSGRRKENPIEDDLIFRIGTKGRNKGEFTNLQGVAASSLGKVLIADSNNQCVQMFSNDGQFKSRFGVRGRTPGQLQRPTGVAVHPNGDIIIADYDNKWVSIFSSEGKFKNKIGSGKLMGPKGVAVDKNGHIIVVDNKACCVFIFQVNGKLVTKFGNRGNGDKQFAGPHFAAVNNNNEIIVTDFHNHSVKVFNTEGEFLLKFGSNGEGNGQFNAPTGVSVDANGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDG-HVVVADSGNHCFKVYRY 742          

HSP 2 Score: 63.1586 bits (152), Expect = 4.649e-10
Identity = 42/172 (24.42%), Postives = 77/172 (44.77%), Query Frame = 1
Query: 1168 KGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN-NRFMCTRI--LKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK*SF 1674
            +G+     G++++AD+ +  +  F   G+F  +     R+  +L  P  + +   GDI++ D+ N  V +F   G ++N+ G      G+   P G+       I+V D     + IF  N  + T+     + ++   GP      N+  EI++ D  NH  KVF  +  F
Sbjct:  490 QGVAASSLGKVLIADSNNQCVQMFSNDGQFKSRFGVRGRTPGQLQRPTGVAVHPNGDIIIADYDNKWVSIFSSEGKFKNKIGS-----GKLMGPKGVAVDKNGHIIVVDNKACCVFIFQVNGKLVTKFGNRGNGDKQFAGPH-FAAVNNNNEIIVTDFHNHSVKVFNTEGEF 655          
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Medaka
Match: trim2a (tripartite motif containing 2 [Source:NCBI gene;Acc:101163547])

HSP 1 Score: 241.121 bits (614), Expect = 1.981e-70
Identity = 147/457 (32.17%), Postives = 233/457 (50.98%), Query Frame = 1
Query:  382 PDENLCNQLKFFGIKMDDVLKEIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERGILDPKVHIELKNLARPHCDIFDREIPHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTLI------------GSVMPLNKP-------MVILKPSE----------PTNLDYLYKIGSKGFKPCDFGNPQSIITSG-DRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKY 1662
            P EN  NQL F  ++ + + K I   GTI  T+  A   T+A    L    V     I++  KD DG+L      L     I   + +R   +I D +     +      + G + L+++     I+GSPF +             G+   L  P         I +P+           P   D +++IG+KG    +F N Q +  S   ++L+ DS N C+Q++S  G++ + FG + +  G+L RP  +A   NG  ++ D++ K + ++   G + +  G   L+GPKG+ VDK G IIV DNK   +  F+  GK + K  +    D + AGPHF  + +  +I+VTDF+NH VKVF+  G +  +FG +G+  G+FN PTG+      +I+V+DWGNSRI +F+        + +  +PL GPQG+ LT+ G  +++ DSGNHCFKV++Y
Sbjct:  293 PKEN--NQLDFL-VETEGLKKSIHNLGTIVTTNAVAS-ETVATGESLRHCVVGVPTSITITTKDKDGELCKMGNAL-ITTEISPPDNSRDIGEILDNK-NGTYEYIFTAAKEGTFNLSLRLYNQHIKGSPFRIKAIKSIDACPKSDGTKKRLKSPGSGHIKQRAIKRPASMYSSGRRKENPIEDDLIFRIGTKGRNKGEFTNLQGVAASSLGKVLIADSNNQCVQMFSNDGQFKSRFGVRGRTPGQLQRPTGVAVHPNGDIIIADYDNKWVSIFSSEGKFKNKIGSGKLMGPKGVAVDKNGHIIVVDNKACCVFIFQVNGKLVTKFGNRGNGDKQFAGPHFAAVNNNNEIIVTDFHNHSVKVFNTEGEFLLKFGSNGEGNGQFNAPTGVSVDANGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDG-HVVVADSGNHCFKVYRY 742          

HSP 2 Score: 63.1586 bits (152), Expect = 4.649e-10
Identity = 42/172 (24.42%), Postives = 77/172 (44.77%), Query Frame = 1
Query: 1168 KGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFN-NRFMCTRI--LKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK*SF 1674
            +G+     G++++AD+ +  +  F   G+F  +     R+  +L  P  + +   GDI++ D+ N  V +F   G ++N+ G      G+   P G+       I+V D     + IF  N  + T+     + ++   GP      N+  EI++ D  NH  KVF  +  F
Sbjct:  490 QGVAASSLGKVLIADSNNQCVQMFSNDGQFKSRFGVRGRTPGQLQRPTGVAVHPNGDIIIADYDNKWVSIFSSEGKFKNKIGS-----GKLMGPKGVAVDKNGHIIVVDNKACCVFIFQVNGKLVTKFGNRGNGDKQFAGPH-FAAVNNNNEIIVTDFHNHSVKVFNTEGEF 655          
BLAST of Tripartite motif-containing protein 3-like vs. Planmine SMEST
Match: SMESG000029727.1 (SMESG000029727.1)

HSP 1 Score: 832.017 bits (2148), Expect = 0.000e+0
Identity = 406/407 (99.75%), Postives = 407/407 (100.00%), Query Frame = 1
Query:  445 EIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERGILDPKVHIELKNLARPHCDIFDREIPHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTLIGSVMPLNKPMVILKPSEPTNLDYLYKIGSKGFKPCDFGNPQSIITSGDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK 1665
            EIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERGILDPKVHIELKNLARPHCDIFDREIPHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTLIGSVMPLNKPMVILKPSEPTNLDYLYKIG+KGFKPCDFGNPQSIITSGDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK
Sbjct:   30 EIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERGILDPKVHIELKNLARPHCDIFDREIPHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTLIGSVMPLNKPMVILKPSEPTNLDYLYKIGNKGFKPCDFGNPQSIITSGDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK 436          
BLAST of Tripartite motif-containing protein 3-like vs. Planmine SMEST
Match: SMESG000029727.1 (SMESG000029727.1)

HSP 1 Score: 831.632 bits (2147), Expect = 0.000e+0
Identity = 406/407 (99.75%), Postives = 407/407 (100.00%), Query Frame = 1
Query:  445 EIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERGILDPKVHIELKNLARPHCDIFDREIPHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTLIGSVMPLNKPMVILKPSEPTNLDYLYKIGSKGFKPCDFGNPQSIITSGDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK 1665
            EIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERGILDPKVHIELKNLARPHCDIFDREIPHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTLIGSVMPLNKPMVILKPSEPTNLDYLYKIG+KGFKPCDFGNPQSIITSGDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK
Sbjct:   24 EIREFGTISMTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERGILDPKVHIELKNLARPHCDIFDREIPHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTLIGSVMPLNKPMVILKPSEPTNLDYLYKIGNKGFKPCDFGNPQSIITSGDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK 430          
BLAST of Tripartite motif-containing protein 3-like vs. Planmine SMEST
Match: SMESG000015738.1 (SMESG000015738.1)

HSP 1 Score: 103.219 bits (256), Expect = 6.058e-23
Identity = 96/360 (26.67%), Postives = 159/360 (44.17%), Query Frame = 1
Query:  631 LKNLARPHCDIFDREIPHLIDLNIKLPQAGEYELTVKFCESSIQGSPFTLIGSVMPLNKPMVILKPSEPTNLDYLYKIGSKGFKPCDFGNPQSII--TSGDRILVTDSGNSCIQIYSESG-------EYLTCFGPKEKKTGRLLRPIDIAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKV-----LLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVII-STGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIFNNRFMCTRIL---KSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVF 1656
            L N+ R +C+   RE  ++I+   K   +  YE+ V    S  Q  P TL    M  + P++                GSKG    +F  P+ I   +S +RI++ DS N  +QI+S+ G       E +   G  +    +      IA   N   + +D     + + D+ G  +   G+       L  P GI  D    I + D  +  +  F   G++IK++  + +       PH+L +   T +I V+D  NH ++VFDK+G Y   F   G +     YP GI   +E ++++ D+GN+RI IF+N+     +     S +    G +GI + N G  I + D  NH  ++F
Sbjct:  305 LNNVERSNCE-NTREKTYIIERPCK---SIAYEIPV----SVKQLLPITLQSIYMTKSLPILTF--------------GSKGTGSGEFIWPRGIAIDSSTNRIIIADSSNHRVQIFSDKGVCEKVIPEMVCDQGTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNEGNVLICDYGNNRISIFSNQGKFLYLFGSHGSHDGQFKGLEGIAVFNDG-RIAVSDRDNHRIQIF 641          
BLAST of Tripartite motif-containing protein 3-like vs. Planmine SMEST
Match: SMESG000035122.1 (SMESG000035122.1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.373e-13
Identity = 77/326 (23.62%), Postives = 141/326 (43.25%), Query Frame = 1
Query:  763 GSPFTLIGSVMPLN--------KPMV----ILKPSEPT-NLDYL-----YKIGSKGFKPCDFGNPQSIITS-GDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNG-HYLVTD--FELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSR--IVIFNN------RFMCTRILKSKEEPLCG----PQG--ITLTNSGTEILIVDS 1632
            G  F L GS + LN        +P+V    + KP  P  N +Y+      + GS+G       +P        + I+V D+ N  I I+S+ G+++  FG   ++ G L  P  +    N  HY+V D   E   + ++   G ++       +    G+ ++  G I+  D+   ++      G+ +K ++      +++  P  +V+    +  + DF  HCV V+ ++G +   FG    +    NYP GI  S+  DI+V D   +R  + +F         F C  +  S+    CG     +G  +TL  +   +L++D+
Sbjct:  527 GPEFPLDGSQVSLNSQFNNNTFRPLVNMNPVPKPPFPNRNRNYVPMVIKERWGSQGSNRGQLNSPHGFCLGFNEEIVVADTQNHRIHIFSKDGQFINQFGIAGREEGHLWHPRKVTIIRNSQHYVVCDRGSERSRMQIFAKNGYFIRKIAIPYIDIVAGLAINSMGHIVAVDSVSPTIFVVTEMGEMVKWIE----CSSQMREPSDIVV-HGENYYICDFKGHCVCVYKQDGTFLFRFGNEKIT----NYPNGIDVSNHGDILVGDSHGNRFHVAVFTKDGHLTGEFECPSVKVSRA---CGLKITSEGYLVTLAKNNHNVLVIDT 840          
BLAST of Tripartite motif-containing protein 3-like vs. Planmine SMEST
Match: SMESG000035122.1 (SMESG000035122.1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.611e-13
Identity = 77/326 (23.62%), Postives = 141/326 (43.25%), Query Frame = 1
Query:  763 GSPFTLIGSVMPLN--------KPMV----ILKPSEPT-NLDYL-----YKIGSKGFKPCDFGNPQSIITS-GDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNG-HYLVTD--FELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSR--IVIFNN------RFMCTRILKSKEEPLCG----PQG--ITLTNSGTEILIVDS 1632
            G  F L GS + LN        +P+V    + KP  P  N +Y+      + GS+G       +P        + I+V D+ N  I I+S+ G+++  FG   ++ G L  P  +    N  HY+V D   E   + ++   G ++       +    G+ ++  G I+  D+   ++      G+ +K ++      +++  P  +V+    +  + DF  HCV V+ ++G +   FG    +    NYP GI  S+  DI+V D   +R  + +F         F C  +  S+    CG     +G  +TL  +   +L++D+
Sbjct:  533 GPEFPLDGSQVSLNSQFNNNTFRPLVNMNPVPKPPFPNRNRNYVPMVIKERWGSQGSNRGQLNSPHGFCLGFNEEIVVADTQNHRIHIFSKDGQFINQFGIAGREEGHLWHPRKVTIIRNSQHYVVCDRGSERSRMQIFAKNGYFIRKIAIPYIDIVAGLAINSMGHIVAVDSVSPTIFVVTEMGEMVKWIE----CSSQMREPSDIVV-HGENYYICDFKGHCVCVYKQDGTFLFRFGNEKIT----NYPNGIDVSNHGDILVGDSHGNRFHVAVFTKDGHLTGEFECPSVKVSRA---CGLKITSEGYLVTLAKNNHNVLVIDT 846          
The following BLAST results are available for this feature:
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRIM39.646e-7330.59tripartite motif containing 3 [Source:HGNC Symbol;... [more]
TRIM29.674e-7229.20tripartite motif containing 2 [Source:HGNC Symbol;... [more]
TRIM31.073e-7130.59tripartite motif containing 3 [Source:HGNC Symbol;... [more]
TRIM21.434e-7129.20tripartite motif containing 2 [Source:HGNC Symbol;... [more]
TRIM35.717e-7130.59tripartite motif containing 3 [Source:HGNC Symbol;... [more]
back to top
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nhl-16.001e-2327.64RING finger protein nhl-1 [Source:UniProtKB/Swiss... [more]
nhl-16.975e-2327.64RING finger protein nhl-1 [Source:UniProtKB/Swiss... [more]
ncl-13.962e-2229.46B-box type zinc finger protein ncl-1 [Source:UniP... [more]
ncl-14.471e-2229.46B-box type zinc finger protein ncl-1 [Source:UniP... [more]
ncl-15.190e-2230.77B-box type zinc finger protein ncl-1 [Source:UniP... [more]
back to top
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tn7.624e-3029.24gene:FBgn0265356 transcript:FBtr0340447[more]
tn1.038e-2929.24gene:FBgn0265356 transcript:FBtr0340448[more]
tn1.448e-2929.24gene:FBgn0265356 transcript:FBtr0086573[more]
tn1.448e-2929.24gene:FBgn0265356 transcript:FBtr0086572[more]
tn1.817e-2929.24gene:FBgn0265356 transcript:FBtr0114622[more]
back to top
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trim2b8.059e-7430.95tripartite motif containing 2b [Source:ZFIN;Acc:ZD... [more]
trim2b2.192e-7330.95tripartite motif containing 2b [Source:ZFIN;Acc:ZD... [more]
trim2b2.192e-7330.95tripartite motif containing 2b [Source:ZFIN;Acc:ZD... [more]
trim2a3.674e-7131.61tripartite motif containing 2a [Source:ZFIN;Acc:ZD... [more]
trim3b3.126e-7030.80tripartite motif containing 3b [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actr65.653e-7430.92ARP6 actin related protein 6 homolog [Source:Xenba... [more]
actr61.524e-7330.92ARP6 actin related protein 6 homolog [Source:Xenba... [more]
actr61.771e-7230.92ARP6 actin related protein 6 homolog [Source:Xenba... [more]
actr61.829e-6730.10ARP6 actin related protein 6 homolog [Source:Xenba... [more]
actr61.216e-5729.61ARP6 actin related protein 6 homolog [Source:Xenba... [more]
back to top
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trim21.799e-7129.20tripartite motif-containing 2 [Source:MGI Symbol;A... [more]
Trim21.799e-7129.20tripartite motif-containing 2 [Source:MGI Symbol;A... [more]
Trim21.799e-7129.20tripartite motif-containing 2 [Source:MGI Symbol;A... [more]
Trim21.799e-7129.20tripartite motif-containing 2 [Source:MGI Symbol;A... [more]
Trim22.362e-7129.20tripartite motif-containing 2 [Source:MGI Symbol;A... [more]
back to top
BLAST of Tripartite motif-containing protein 3-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A4IF63|TRIM2_BOVIN3.048e-7129.55Tripartite motif-containing protein 2 OS=Bos tauru... [more]
sp|Q9C040|TRIM2_HUMAN4.646e-7129.20Tripartite motif-containing protein 2 OS=Homo sapi... [more]
sp|F7H9X2|TRIM2_CALJA6.068e-7129.20Tripartite motif-containing protein 2 OS=Callithri... [more]
sp|D3ZQG6|TRIM2_RAT6.588e-7129.20Tripartite motif-containing protein 2 OS=Rattus no... [more]
sp|D2GXS7|TRIM2_AILME9.734e-7129.42Tripartite motif-containing protein 2 OS=Ailuropod... [more]
back to top
BLAST of Tripartite motif-containing protein 3-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3YZN36.765e-7930.60Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A4S2L4E31.470e-7732.44Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A3Q2DHW12.902e-7731.90Tripartite motif containing 2b OS=Cyprinodon varie... [more]
A0A075A6164.875e-7732.64Uncharacterized protein OS=Opisthorchis viverrini ... [more]
T1JNP39.842e-7733.53Uncharacterized protein OS=Strigamia maritima OX=1... [more]
back to top
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trim2b1.727e-7531.51tripartite motif containing 2b [Source:ZFIN;Acc:ZD... [more]
trim3a1.243e-7031.18tripartite motif containing 3a [Source:ZFIN;Acc:ZD... [more]
trim2a1.348e-7031.00tripartite motif containing 2 [Source:NCBI gene;Ac... [more]
trim2a1.348e-7031.00tripartite motif containing 2 [Source:NCBI gene;Ac... [more]
trim2a1.348e-7031.00tripartite motif containing 2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
trim2b8.278e-7139.85tripartite motif containing 2b [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000009943.11.843e-2427.75pep scaffold:Pmarinus_7.0:GL488567:275:4344:1 gene... [more]
ENSPMAT00000005035.11.796e-1728.02pep scaffold:Pmarinus_7.0:GL476697:205350:209715:-... [more]
back to top
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO368576.288e-3330.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343081.388e-2925.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO298511.564e-2829.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477152.137e-2827.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476421.239e-2627.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tripartite motif-containing protein 3-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trim3a2.236e-7131.32tripartite motif-containing protein 3 [Source:NCBI... [more]
trim2b3.858e-7129.42tripartite motif-containing protein 2 [Source:NCBI... [more]
trim3b1.037e-7031.25tripartite motif-containing protein 3 [Source:NCBI... [more]
trim2a1.981e-7032.17tripartite motif containing 2 [Source:NCBI gene;Ac... [more]
trim2a1.981e-7032.17tripartite motif containing 2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Tripartite motif-containing protein 3-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029727.10.000e+099.75SMESG000029727.1[more]
SMESG000029727.10.000e+099.75SMESG000029727.1[more]
SMESG000015738.16.058e-2326.67SMESG000015738.1[more]
SMESG000035122.11.373e-1323.62SMESG000035122.1[more]
SMESG000035122.11.611e-1323.62SMESG000035122.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019696 ID=SMED30019696|Name=Tripartite motif-containing protein 3-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1676bp
CTCCCACTCAATCAGATCTTATTCTCATTGGCTAACATTGGGATTGTCTG
AAATGAACTGAATCGATTATTCCACCAATTCATTCCGTTGATCCTTCTGA
ATCTTGTCTGCGAGAATATCGAGTGGAATTTTAGACTTTAAATTCTTCTT
AGATTCAGCTATTCATACAACATGACAAACTTGACAGCCAGCCTCAATTT
GGATGCTGTGAGTGAACAGGTTGAGCAATCATTTCAGATGCTCCACAACG
CCTTGAATGTCAGACAAAACCAAATATTATCCCAATTGAATAATCTTATG
AATTCTGACAATGAAAACGAGGAGGGGCATGAGAGAAAGTGGGGAAATGA
GGGAAATGAAACCGAGATCAATTTCAGATTACCCGACGAAAATCTTTGTA
ATCAACTGAAATTCTTTGGGATAAAAATGGATGATGTTTTAAAGGAAATT
CGGGAATTCGGCACGATTTCCATGACTTCCGTCAACGCAAAATACTCGAC
AATTGCGGATCAAGGAATCTTGAGTAAGTTGCCAGTAAATGAAGACGTGA
GGATCTCCTTGATTTTGAAAGATAGCGATGGCAAGTTGGTCACTGAAAGA
GGAATTCTCGATCCTAAAGTTCATATTGAACTAAAGAATTTAGCCAGACC
TCATTGTGACATATTTGATAGAGAAATACCGCATCTGATAGATTTAAACA
TAAAATTACCACAAGCTGGAGAGTATGAACTTACAGTAAAATTTTGCGAA
AGCTCTATTCAAGGATCTCCTTTTACTTTGATCGGATCAGTAATGCCATT
AAATAAGCCAATGGTCATTTTAAAACCTTCTGAACCGACAAATTTGGACT
ATCTCTACAAAATTGGCAGCAAAGGGTTCAAACCTTGTGATTTTGGTAAT
CCACAGTCAATCATAACGAGTGGGGATAGAATTTTAGTTACCGACAGTGG
AAACTCCTGCATACAAATATACAGTGAAAGTGGGGAATATCTAACTTGCT
TCGGACCCAAAGAGAAAAAAACTGGTCGACTGCTCCGTCCTATAGATATT
GCAGAGACCACCAACGGGCATTACCTTGTAACTGATTTTGAATTAAAAAT
AATTCTAGTGTATGATTTATTGGGAAATTATGTGTCATCCTTCGGTCAAA
AGGTTCTTTTAGGCCCCAAAGGTATTTGTGTGGACAAAACCGGTCAAATA
ATTGTCGCCGATAACAAAGATTCGAGTTTAGTCTTTTTTAAAGCAACGGG
TAAATTTATTAAAAAAGTGAAAGATAATCCTAGAAGTGACAATAAATTGG
CCGGGCCGCATTTTTTGGTTATTATTTCCACGGGAGATATTCTAGTAACA
GACTTTTATAATCATTGTGTCAAAGTTTTTGACAAAAACGGAATTTACCA
AAATGAATTTGGTCAACACGGAGACAGCTGGGGAGAATTCAATTACCCGA
CGGGGATATGTTGCTCCGACGAAGACGACATTGTAGTATCAGATTGGGGC
AATTCAAGAATAGTAATTTTCAATAACCGATTCATGTGCACCAGAATTCT
GAAATCAAAAGAGGAGCCTTTATGCGGACCGCAGGGCATCACCTTAACCA
ACAGTGGAACAGAAATCTTAATAGTGGATTCAGGGAATCATTGTTTCAAA
GTTTTTAAATACAAATGATCATTTAC
back to top

protein sequence of SMED30019696-orf-1

>SMED30019696-orf-1 ID=SMED30019696-orf-1|Name=SMED30019696-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=499bp
MTNLTASLNLDAVSEQVEQSFQMLHNALNVRQNQILSQLNNLMNSDNENE
EGHERKWGNEGNETEINFRLPDENLCNQLKFFGIKMDDVLKEIREFGTIS
MTSVNAKYSTIADQGILSKLPVNEDVRISLILKDSDGKLVTERGILDPKV
HIELKNLARPHCDIFDREIPHLIDLNIKLPQAGEYELTVKFCESSIQGSP
FTLIGSVMPLNKPMVILKPSEPTNLDYLYKIGSKGFKPCDFGNPQSIITS
GDRILVTDSGNSCIQIYSESGEYLTCFGPKEKKTGRLLRPIDIAETTNGH
YLVTDFELKIILVYDLLGNYVSSFGQKVLLGPKGICVDKTGQIIVADNKD
SSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCV
KVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDEDDIVVSDWGNSRIVIF
NNRFMCTRILKSKEEPLCGPQGITLTNSGTEILIVDSGNHCFKVFKYK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR001258NHL_repeat
IPR013783Ig-like_fold
IPR0110426-blade_b-propeller_TolB-like
IPR013017NHL_repeat_subgr
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0008270zinc ion binding
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
GO:0043523regulation of neuron apoptotic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001258NHL repeatPFAMPF01436NHLcoord: 467..495
e-value: 1.3E-4
score: 21.8
coord: 423..450
e-value: 2.2E-6
score: 27.4
coord: 330..353
e-value: 1.4E-4
score: 21.8
coord: 376..403
e-value: 1.3E-7
score: 31.3
NoneNo IPR availableGENE3DG3DSA:2.40.10.500coord: 419..498
e-value: 4.4E-8
score: 35.0
NoneNo IPR availablePANTHERPTHR24104FAMILY NOT NAMEDcoord: 299..451
NoneNo IPR availablePANTHERPTHR24104:SF28E3 UBIQUITIN-PROTEIN LIGASE NHLRC1coord: 229..363
NoneNo IPR availablePANTHERPTHR24104:SF28E3 UBIQUITIN-PROTEIN LIGASE NHLRC1coord: 379..496
coord: 299..451
NoneNo IPR availablePANTHERPTHR24104FAMILY NOT NAMEDcoord: 229..363
coord: 379..496
NoneNo IPR availableSUPERFAMILYSSF101898NHL repeatcoord: 247..497
IPR011042Six-bladed beta-propeller, TolB-likeGENE3DG3DSA:2.120.10.30coord: 218..418
e-value: 8.7E-47
score: 161.6
IPR013017NHL repeat, subgroupPROSITEPS51125NHLcoord: 410..453
score: 14.104
IPR013017NHL repeat, subgroupPROSITEPS51125NHLcoord: 228..270
score: 8.121
IPR013017NHL repeat, subgroupPROSITEPS51125NHLcoord: 370..406
score: 12.829
IPR013017NHL repeat, subgroupPROSITEPS51125NHLcoord: 274..317
score: 7.689
IPR013017NHL repeat, subgroupPROSITEPS51125NHLcoord: 466..498
score: 8.882
IPR013017NHL repeat, subgroupPROSITEPS51125NHLcoord: 318..359
score: 11.02