DUF3421 domain-containing protein

Overview
NameDUF3421 domain-containing protein
Smed IDSMED30019692
Length (bp)686
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DUF3421 domain-containing protein (SMED30019692) t-SNE clustered cells

Violin plots show distribution of expression levels for DUF3421 domain-containing protein (SMED30019692) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DUF3421 domain-containing protein (SMED30019692) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DUF3421 domain-containing protein (SMED30019692) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019692

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30019692SMESG000046732.1 dd_Smed_v4_844_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30019692SMESG000046732.1 dd_Smed_v4_844_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
body wall musculatureSMED30019692SMESG000046732.1 dd_Smed_v4_844_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019692SMESG000046732.1 dd_Smed_v6_844_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30019692SMESG000046732.1 dd_Smed_v6_844_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019692SMESG000046732.1 dd_Smed_v4_844_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30019692SMESG000046732.1 dd_Smed_v4_844_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG13321 (gene:FBgn0033787 transcript:FBtr0345371)

HSP 1 Score: 102.064 bits (253), Expect = 9.124e-26
Identity = 58/138 (42.03%), Postives = 77/138 (55.80%), Query Frame = 2
Query:  176 GQVPYNAIQAGAG-----VFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLC 574
            G +P  AI AG       +FVGR+    ++ P KV  G    + P+GG+E    ++EVL        G   SWI +  GSVPP+A+  G T   EPLY+ RGY  GS+  GKV  SH C ++P+GG EHR+  YEVL 
Sbjct:   13 GSLPPGAILAGHDSDQDPIFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKHDFEVLV-------GDHFSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLV 143          

HSP 2 Score: 88.9669 bits (219), Expect = 7.254e-21
Identity = 53/146 (36.30%), Postives = 76/146 (52.05%), Query Frame = 2
Query:  152 LSWQPGSNGQVPYNAIQAGAG-----VFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLC 574
             SW P S G VP +AIQ G       ++VGR      +TPGKV   H   + PYGG+E     YEVL         PE +WI++    + P  VVGG+ +  + +Y+ R Y  G +   KV  + GC+++P+GG E    +YE+L 
Sbjct:   76 FSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLVQ-------PE-TWIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLA 213          

HSP 3 Score: 88.5817 bits (218), Expect = 8.203e-21
Identity = 49/123 (39.84%), Postives = 69/123 (56.10%), Query Frame = 2
Query:  206 GAGVFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLC 574
            G  ++VGR+    D+ P KV       + PYGG E V  +YE+L   G         W+   +G+VP NAV+ G TS  EPL+I R + +GS+  GK+ QSH C ++P  G E R+ +YEVL 
Sbjct:  169 GDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLAGYGY-------GWVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEEVRIDHYEVLV 284          

HSP 4 Score: 52.7582 bits (125), Expect = 5.746e-8
Identity = 26/73 (35.62%), Postives = 41/73 (56.16%), Query Frame = 2
Query:  368 EISWISA-FNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLCYSH 583
            + +WIS    GS+PP A++ G+ S  +P+++ R Y NG M   KV      +++P GG E    ++EVL   H
Sbjct:    3 DYTWISTNVYGSLPPGAILAGHDSDQDPIFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKHDFEVLVGDH 75          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG13321 (gene:FBgn0033787 transcript:FBtr0087792)

HSP 1 Score: 102.064 bits (253), Expect = 9.124e-26
Identity = 58/138 (42.03%), Postives = 77/138 (55.80%), Query Frame = 2
Query:  176 GQVPYNAIQAGAG-----VFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLC 574
            G +P  AI AG       +FVGR+    ++ P KV  G    + P+GG+E    ++EVL        G   SWI +  GSVPP+A+  G T   EPLY+ RGY  GS+  GKV  SH C ++P+GG EHR+  YEVL 
Sbjct:   13 GSLPPGAILAGHDSDQDPIFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKHDFEVLV-------GDHFSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLV 143          

HSP 2 Score: 88.9669 bits (219), Expect = 7.254e-21
Identity = 53/146 (36.30%), Postives = 76/146 (52.05%), Query Frame = 2
Query:  152 LSWQPGSNGQVPYNAIQAGAG-----VFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLC 574
             SW P S G VP +AIQ G       ++VGR      +TPGKV   H   + PYGG+E     YEVL         PE +WI++    + P  VVGG+ +  + +Y+ R Y  G +   KV  + GC+++P+GG E    +YE+L 
Sbjct:   76 FSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLVQ-------PE-TWIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLA 213          

HSP 3 Score: 88.5817 bits (218), Expect = 8.203e-21
Identity = 49/123 (39.84%), Postives = 69/123 (56.10%), Query Frame = 2
Query:  206 GAGVFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLC 574
            G  ++VGR+    D+ P KV       + PYGG E V  +YE+L   G         W+   +G+VP NAV+ G TS  EPL+I R + +GS+  GK+ QSH C ++P  G E R+ +YEVL 
Sbjct:  169 GDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLAGYGY-------GWVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEEVRIDHYEVLV 284          

HSP 4 Score: 52.7582 bits (125), Expect = 5.746e-8
Identity = 26/73 (35.62%), Postives = 41/73 (56.16%), Query Frame = 2
Query:  368 EISWISA-FNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLCYSH 583
            + +WIS    GS+PP A++ G+ S  +P+++ R Y NG M   KV      +++P GG E    ++EVL   H
Sbjct:    3 DYTWISTNVYGSLPPGAILAGHDSDQDPIFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKHDFEVLVGDH 75          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG10527 (gene:FBgn0034583 transcript:FBtr0071541)

HSP 1 Score: 100.523 bits (249), Expect = 4.662e-25
Identity = 53/141 (37.59%), Postives = 80/141 (56.74%), Query Frame = 2
Query:  158 WQPGSNGQVPYNAIQAG----AGVFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEV 568
            W P +NG+VP NA++ G      +++ R+R   D+ PGK+   H V +  +GG E   + YEVLC  G         W+    G++PPNA+  G T+  EPL+I R   +G++ VGKV  SHGC ++P+GG E     +E+
Sbjct:  159 WVPAANGEVPPNALEGGFDSSEQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVLCAGGGQ-------WLPVDAGNIPPNALPAGETAEGEPLFIGRATHDGTITVGKVQPSHGCCYIPYGGEELAYKEFEI 292          

HSP 2 Score: 60.4622 bits (145), Expect = 1.170e-10
Identity = 33/66 (50.00%), Postives = 40/66 (60.61%), Query Frame = 2
Query:  377 WISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLC 574
            W+ A NG VPPNA+ GG  SS E LYI R    G +  GK+  SHG +++  GG EH    YEVLC
Sbjct:  159 WVPAANGEVPPNALEGGFDSS-EQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVLC 223          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG32633 (gene:FBgn0052633 transcript:FBtr0073800)

HSP 1 Score: 97.0561 bits (240), Expect = 7.060e-24
Identity = 59/149 (39.60%), Postives = 74/149 (49.66%), Query Frame = 2
Query:  143 QASLSWQPGSNGQVPYNAIQAGAG-----VFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLC 574
             A   W   SNG VP NA+ AG       ++VGR+    D+ P KV       +  Y  +E    NYEVL        G    W+SA NG VPP AV  G     E LY  RGY  GS+ +GKV  SHGC ++P+   E ++  YEVLC
Sbjct:    1 MADHRWMHFSNGSVPPNAVVAGHDSDGDTIYVGRAFFSNDMLPAKVIPNKGKAYVAYAREEHELENYEVLS-------GYNYEWLSAENGEVPPGAVKVGRNVDGEYLYAGRGYHAGSLTMGKVHPSHGCLYIPYDSDEVKIFAYEVLC 142          

HSP 2 Score: 72.0182 bits (175), Expect = 9.527e-15
Identity = 47/144 (32.64%), Postives = 68/144 (47.22%), Query Frame = 2
Query:  158 WQPGSNGQVPYNAIQAGAG-----VFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLC 574
            W   +   +P  A+ AG       ++VGR     D+ P KV       +  Y   E   ++ +VL  +G         W+ A +G+V P A+  G     EPLY+ R     S+ VGK+  SHGC ++P GG E R+ NYEVL 
Sbjct:  147 WIDTTATNIPDGALVAGHDSNGDTIYVGRVFRNGDLLPAKVVPAKGKAYAAYAQAEHELTDVQVLTGSGFR-------WVPASHGNVAPGALSSGPNVDGEPLYVGRAIYCDSLSVGKIHPSHGCIYIPFGGEEVRLENYEVLV 283          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG32633 (gene:FBgn0052633 transcript:FBtr0310431)

HSP 1 Score: 97.0561 bits (240), Expect = 7.060e-24
Identity = 59/149 (39.60%), Postives = 74/149 (49.66%), Query Frame = 2
Query:  143 QASLSWQPGSNGQVPYNAIQAGAG-----VFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLC 574
             A   W   SNG VP NA+ AG       ++VGR+    D+ P KV       +  Y  +E    NYEVL        G    W+SA NG VPP AV  G     E LY  RGY  GS+ +GKV  SHGC ++P+   E ++  YEVLC
Sbjct:    1 MADHRWMHFSNGSVPPNAVVAGHDSDGDTIYVGRAFFSNDMLPAKVIPNKGKAYVAYAREEHELENYEVLS-------GYNYEWLSAENGEVPPGAVKVGRNVDGEYLYAGRGYHAGSLTMGKVHPSHGCLYIPYDSDEVKIFAYEVLC 142          

HSP 2 Score: 72.0182 bits (175), Expect = 9.527e-15
Identity = 47/144 (32.64%), Postives = 68/144 (47.22%), Query Frame = 2
Query:  158 WQPGSNGQVPYNAIQAGAG-----VFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLC 574
            W   +   +P  A+ AG       ++VGR     D+ P KV       +  Y   E   ++ +VL  +G         W+ A +G+V P A+  G     EPLY+ R     S+ VGK+  SHGC ++P GG E R+ NYEVL 
Sbjct:  147 WIDTTATNIPDGALVAGHDSNGDTIYVGRVFRNGDLLPAKVVPAKGKAYAAYAQAEHELTDVQVLTGSGFR-------WVPASHGNVAPGALSSGPNVDGEPLYVGRAIYCDSLSVGKIHPSHGCIYIPFGGEEVRLENYEVLV 283          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A4Z2D656 (DM9 domain-containing protein OS=Schistosoma japonicum OX=6182 GN=EWB00_004219 PE=4 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 1.719e-39
Identity = 76/159 (47.80%), Postives = 99/159 (62.26%), Query Frame = 2
Query:  107 FQLKMCSVGSGRQASLSWQPGSNGQVPY-NAIQAGAGVFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLCYS 580
             ++KM      RQA LSW PG  GQ+P  +AI+A  G++V R R   DV PGK    + +G+  Y G+E   SN+EVLC+T L   G   +WI    G+VP  A+  G TSS+EPLY+ RG VNG  C+GKV  SHGC++ P GG EH V  YEVLC++
Sbjct:  144 LKMKMWPQNKTRQAHLSWLPGCAGQIPPPHAIEATPGIYVIRGRTCDDVIPGKWVINYGLGYISYDGREIELSNFEVLCNTSLQSTGNLYTWIPCSGGNVPDKALHAGETSSSEPLYVARGIVNGETCIGKVHPSHGCAYFPWGGDEHAVKCYEVLCFT 302          

HSP 2 Score: 96.6709 bits (239), Expect = 3.755e-20
Identity = 52/141 (36.88%), Postives = 78/141 (55.32%), Query Frame = 2
Query:  134 SGRQASLSWQPGSNGQVP-YNAIQAGAGVFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRV 553
            + R+A+LSW P S G  P  N +QA +G+ V R + G ++ PGK+   + VG+ PY GKE   + YEVLC T +       +W+    G VP  A++ G T   E LY+ R  + G M +GK+  S   + L +GG E ++
Sbjct:    6 NAREANLSWIPYSTGSPPPSNIVQAESGICVIRGKKGTNLIPGKMLLKNGVGYIPYEGKEVQINEYEVLCQTNIFPHQTLYNWVPGSRGKVPVGALLAGITMHEELLYVARATIEGEMSIGKINCSQKFALLTYGGKELKM 146          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: G4LX92 (DUF3421 domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_167270 PE=4 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 2.944e-39
Identity = 69/154 (44.81%), Postives = 93/154 (60.39%), Query Frame = 2
Query:  119 MCSVGSGRQASLSWQPGSNGQVPYNAIQAGAGVFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLCYS 580
            M  +G G Q  LSW P  NG VP+NAI    G++V R +      PGK  +GH+  ++PYGG+E+    YEVLCDT    +     W+ A  G+VP NA++GG  S N+PLYI +  +NG  CVGKV   H C+++P GG EH V +YEVL + 
Sbjct:    1 MAKIGKGIQIPLSWVPDRNGNVPHNAISVTNGIYVVRCQHDRQWIPGKAANGHDTAYYPYGGEEKNTKEYEVLCDTSFSRY----EWVQASCGNVPKNAIIGG-MSGNDPLYIAKSKINGETCVGKVHHGHECAYIPWGGQEHSVKDYEVLVWK 149          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: Q5DHE4 (SJCHGC04453 protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 3.983e-38
Identity = 70/154 (45.45%), Postives = 89/154 (57.79%), Query Frame = 2
Query:  119 MCSVGSGRQASLSWQPGSNGQVPYNAIQAGAGVFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLCYS 580
            M  +G G Q  LSW P ++G VP+NAI     ++V RS+      PGK   GHN  ++P  G+E     YEVLCDT L        W S   G+VP NA++ G  S N+PLYI RG VNG +CVGKV   H C++ P GG EH V +YEVL + 
Sbjct:    1 MAKIGKGIQIPLSWVPATDGNVPHNAINVSGDIYVIRSKHDGHWIPGKAVIGHNTAYYPMNGQEIKTREYEVLCDTSLSGHNKGYEWESESGGNVPKNAIIAG-MSGNDPLYIARGSVNGEVCVGKVHYGHNCAYFPWGGNEHSVNDYEVLVWK 153          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A183RBG8 (DUF3421 domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 7.773e-38
Identity = 75/156 (48.08%), Postives = 96/156 (61.54%), Query Frame = 2
Query:  110 QLKMCSVGSGRQASLSWQPGSNGQVPYNAIQAGAGVFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPE--ISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVL 571
            + +M  +G G Q+ LSW   ++G+VP NAI AG  V++ R     DV PGKV       +  Y G E    +YEVLCDT L  +GP+    W    NG VP  AVVGG TSSNEPLYI R Y+NG   VGKV +SHGC++ P+GG E ++ +YEVL
Sbjct:   14 RTQMARIGKGIQSCLSWIHQTDGRVPTNAIDAGHAVYITRICHSGDVIPGKVVPHLGKAYISYDGTEYEFDSYEVLCDTKL-PYGPQHCYKWERHSNGYVPKYAVVGGITSSNEPLYIAREYINGERVVGKVHESHGCAYFPYGGQERKMNHYEVL 168          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A5K4FBP2 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 8.321e-38
Identity = 69/154 (44.81%), Postives = 92/154 (59.74%), Query Frame = 2
Query:  119 MCSVGSGRQASLSWQPGSNGQVPYNAIQAGAGVFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLCYS 580
            M  +G G Q  LSW P  NG VP+NAI    G++V R +      PGK  +GH+  ++PYGG+E+    YEVLCDT          W+ A  G+VP NA++GG  S N+PLYI +  +NG  CVGKV   H C+++P GG EH V +YEVL + 
Sbjct:    1 MAKIGKGIQIPLSWVPDRNGNVPHNAISVTNGIYVVRCQHDRQWIPGKAANGHDTAYYPYGGEEKNTKEYEVLCDTSFSGH-QGYEWVQASCGNVPKNAIIGG-MSGNDPLYIAKSKINGETCVGKVHHGHECAYIPWGGQEHSVKDYEVLVWK 152          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000046732.1 (SMESG000046732.1)

HSP 1 Score: 314.694 bits (805), Expect = 1.023e-110
Identity = 155/155 (100.00%), Postives = 155/155 (100.00%), Query Frame = 2
Query:  119 MCSVGSGRQASLSWQPGSNGQVPYNAIQAGAGVFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLCYSH 583
            MCSVGSGRQASLSWQPGSNGQVPYNAIQAGAGVFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLCYSH
Sbjct:    1 MCSVGSGRQASLSWQPGSNGQVPYNAIQAGAGVFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLCYSH 155          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000046742.1 (SMESG000046742.1)

HSP 1 Score: 239.58 bits (610), Expect = 4.657e-81
Identity = 113/155 (72.90%), Postives = 131/155 (84.52%), Query Frame = 2
Query:  119 MCSVGSGRQASLSWQPGSNGQVPYNAIQAGAGVFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLCYSH 583
            MCSVGSGRQASLSWQPG+NGQVPYNAIQA  G+F+GR+R G DVTPGK+  G+N G+F Y GKEE  SNYEVLCDTGLHVFGPE  WI   NG VPPNA+VGG+TSSNEPLYI R  ++G MCVGK+ QSHGC+++P+GG EHR+ NYEVLCYS+
Sbjct:    1 MCSVGSGRQASLSWQPGNNGQVPYNAIQADGGLFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVLCYSN 155          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000046710.1 (SMESG000046710.1)

HSP 1 Score: 218.009 bits (554), Expect = 1.700e-72
Identity = 103/154 (66.88%), Postives = 121/154 (78.57%), Query Frame = 2
Query:  119 MCSVGSGRQASLSWQPGSNGQVPYNAIQAGAGVFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLCYS 580
            M   GSGRQASLSWQPG  GQVPYNAIQA AG+++ R+R G D+T GK   GHN G+FPY G+E+  SNYEVLCDTGLHVFG E  W    NGSVP NAVVGG+T+SNEPLYI +  +NG MCVGKV QSHGC+F+P+GG EH+  +YEVLC+S
Sbjct:    1 MSRAGSGRQASLSWQPGQYGQVPYNAIQADAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLCFS 154          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000046697.1 (SMESG000046697.1)

HSP 1 Score: 218.009 bits (554), Expect = 1.700e-72
Identity = 103/154 (66.88%), Postives = 121/154 (78.57%), Query Frame = 2
Query:  119 MCSVGSGRQASLSWQPGSNGQVPYNAIQAGAGVFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLCYS 580
            M   GSGRQASLSWQPG  GQVPYNAIQA AG+++ R+R G D+T GK   GHN G+FPY G+E+  SNYEVLCDTGLHVFG E  W    NGSVP NAVVGG+T+SNEPLYI +  +NG MCVGKV QSHGC+F+P+GG EH+  +YEVLC+S
Sbjct:    1 MSRAGSGRQASLSWQPGQYGQVPYNAIQADAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLCFS 154          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000046728.1 (SMESG000046728.1)

HSP 1 Score: 199.134 bits (505), Expect = 4.002e-65
Identity = 92/153 (60.13%), Postives = 113/153 (73.86%), Query Frame = 2
Query:  119 MCSVGSGRQASLSWQPGSNGQVPYNAIQAGAGVFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLCY 577
            M   G GRQA +SW PG  GQ+PYNAI AG GVF+ R++ G+DVTPG V  G+N   FP+ G+EE  +NYEVLCDTGLHVFGPEI W     G VP  A+VGGNTS+ EPLYI R +VNG +CVGKV QSH C+++P+   EHR+ NYE+LC+
Sbjct:    1 MSRAGKGRQACVSWLPGQYGQIPYNAISAGDGVFIARAKTGSDVTPGMVRIGYNNAFFPFDGREEFITNYEVLCDTGLHVFGPEIVWKHMGGGCVPSGAIVGGNTSNGEPLYIARAHVNGELCVGKVCQSHKCAYMPNQSKEHRIQNYEILCF 153          
The following BLAST results are available for this feature:
BLAST of DUF3421 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG133219.124e-2642.03gene:FBgn0033787 transcript:FBtr0345371[more]
CG133219.124e-2642.03gene:FBgn0033787 transcript:FBtr0087792[more]
CG105274.662e-2537.59gene:FBgn0034583 transcript:FBtr0071541[more]
CG326337.060e-2439.60gene:FBgn0052633 transcript:FBtr0073800[more]
CG326337.060e-2439.60gene:FBgn0052633 transcript:FBtr0310431[more]
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2D6561.719e-3947.80DM9 domain-containing protein OS=Schistosoma japon... [more]
G4LX922.944e-3944.81DUF3421 domain-containing protein OS=Schistosoma m... [more]
Q5DHE43.983e-3845.45SJCHGC04453 protein OS=Schistosoma japonicum OX=61... [more]
A0A183RBG87.773e-3848.08DUF3421 domain-containing protein OS=Schistosoma r... [more]
A0A5K4FBP28.321e-3844.81Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046732.11.023e-110100.00SMESG000046732.1[more]
SMESG000046742.14.657e-8172.90SMESG000046742.1[more]
SMESG000046710.11.700e-7266.88SMESG000046710.1[more]
SMESG000046697.11.700e-7266.88SMESG000046697.1[more]
SMESG000046728.14.002e-6560.13SMESG000046728.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019692 ID=SMED30019692|Name=DUF3421 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=686bp
AAGGTCTGCAACAGATTCTGTGTGCGTGACTAATGTGACGCATCGATGAG
TTTGCAATGCTAATCAATATTTTTCACATATTTATGTTGTGAACTGAATT
CATTTGTTTCAATTGAAAATGTGCAGTGTTGGTAGTGGTCGTCAAGCTTC
ATTATCGTGGCAGCCAGGATCAAATGGTCAAGTTCCTTATAACGCGATTC
AAGCCGGAGCTGGAGTTTTTGTTGGTCGATCTCGAATTGGTGCAGATGTG
ACTCCTGGCAAAGTATGTTCTGGGCATAATGTAGGACATTTTCCTTATGG
CGGAAAAGAGGAAGTATGTAGTAACTATGAGGTTTTATGTGACACTGGAC
TTCATGTGTTTGGTCCAGAAATTTCTTGGATTTCTGCATTTAATGGTTCA
GTTCCTCCTAATGCCGTGGTTGGGGGTAACACTAGTAGTAACGAACCACT
TTACATATGCAGAGGATATGTCAATGGATCCATGTGTGTAGGAAAAGTTG
CTCAATCTCACGGTTGTTCATTTTTACCACACGGAGGAACTGAACATCGA
GTTCCTAATTATGAAGTTCTTTGCTATTCTCATTAATAGTTTCAAGAACT
TCTTGATTTTGATGCAAATTCTAAATCTGATAAATCAACATTAAGTTATT
AAAGAATAAATGCTTGTAAAATTTTGAGAAAAAAAA
back to top

protein sequence of SMED30019692-orf-1

>SMED30019692-orf-1 ID=SMED30019692-orf-1|Name=SMED30019692-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=156bp
MCSVGSGRQASLSWQPGSNGQVPYNAIQAGAGVFVGRSRIGADVTPGKVC
SGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAV
VGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEV
LCYSH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000054dorsal region of the epidermis
PLANA:0000240body wall musculature
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR006616DM9_repeat
IPR024518DUF3421
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006616DM9 repeatSMARTSM00696dm9coord: 11..76
e-value: 6.4E-7
score: 37.9
coord: 84..154
e-value: 5.5E-28
score: 109.0
IPR024518Domain of unknown function DUF3421PFAMPF11901DUF3421coord: 30..145
e-value: 2.3E-33
score: 114.6
NoneNo IPR availablePANTHERPTHR31649FAMILY NOT NAMEDcoord: 84..154
coord: 8..75