Leukocyte receptor cluster member 8-like protein

Overview
NameLeukocyte receptor cluster member 8-like protein
Smed IDSMED30019682
Length (bp)3324
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Leukocyte receptor cluster member 8-like protein (SMED30019682) t-SNE clustered cells

Violin plots show distribution of expression levels for Leukocyte receptor cluster member 8-like protein (SMED30019682) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Leukocyte receptor cluster member 8-like protein (SMED30019682) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Leukocyte receptor cluster member 8-like protein (SMED30019682) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019682

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30019682h1SMcG0011948 dd_Smed_v4_2926_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019682h1SMcG0011948 dd_Smed_v4_2926_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019682h1SMcG0011948 dd_Smed_v4_2926_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30019682h1SMcG0011948 dd_Smed_v4_2926_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30019682h1SMcG0011948 dd_Smed_v4_2926_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019682h1SMcG0011948 Contig38786uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019682h1SMcG0011948 Contig38786newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30019682h1SMcG0011948 OX_Smed_1.0.02553ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
neuronSMED30019682h1SMcG0011948 dd_Smed_v6_2926_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30019682h1SMcG0011948 dd_Smed_v6_2926_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Human
Match: LENG8 (leukocyte receptor cluster member 8 [Source:HGNC Symbol;Acc:HGNC:15500])

HSP 1 Score: 244.202 bits (622), Expect = 2.650e-67
Identity = 122/236 (51.69%), Postives = 154/236 (65.25%), Query Frame = 3
Query: 2463 WGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSI 3170
            W  L++VGTC D+ K YLRLT AP+PS VRP+ VLK SL  VK  W E   DY   CEQ KSIRQDLTVQ IR EFT+ VY+ HA +ALE  DHEEFNQCQ+Q+K LY E +   N  EFTAYR++YY+FT++  +I T LA L    K  PC++ AL LR AW+  N+ RFFRL C    P +   ++D F DRERK A K++IK +RP   +S+L   L F  +  C  F+  +
Sbjct:  545 WQELQIVGTCPDITKHYLRLTCAPDPSTVRPVAVLKKSLCMVKCHWKEKQ-DYAFACEQMKSIRQDLTVQGIRTEFTVEVYETHARIALEKGDHEEFNQCQTQLKSLYAENLPG-NVGEFTAYRILYYIFTKNSGDITTELAYLTRELKADPCVAHALALRTAWALGNYHRFFRLYC--HAPCMSGYLVDKFADRERKVALKAMIKTFRPALPVSYLQAELAFEGEAACRAFLEPL 776          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Human
Match: LENG8 (leukocyte receptor cluster member 8 [Source:HGNC Symbol;Acc:HGNC:15500])

HSP 1 Score: 244.202 bits (622), Expect = 2.650e-67
Identity = 122/236 (51.69%), Postives = 154/236 (65.25%), Query Frame = 3
Query: 2463 WGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSI 3170
            W  L++VGTC D+ K YLRLT AP+PS VRP+ VLK SL  VK  W E   DY   CEQ KSIRQDLTVQ IR EFT+ VY+ HA +ALE  DHEEFNQCQ+Q+K LY E +   N  EFTAYR++YY+FT++  +I T LA L    K  PC++ AL LR AW+  N+ RFFRL C    P +   ++D F DRERK A K++IK +RP   +S+L   L F  +  C  F+  +
Sbjct:  545 WQELQIVGTCPDITKHYLRLTCAPDPSTVRPVAVLKKSLCMVKCHWKEKQ-DYAFACEQMKSIRQDLTVQGIRTEFTVEVYETHARIALEKGDHEEFNQCQTQLKSLYAENLPG-NVGEFTAYRILYYIFTKNSGDITTELAYLTRELKADPCVAHALALRTAWALGNYHRFFRLYC--HAPCMSGYLVDKFADRERKVALKAMIKTFRPALPVSYLQAELAFEGEAACRAFLEPL 776          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Human
Match: LENG8 (leukocyte receptor cluster member 8 [Source:HGNC Symbol;Acc:HGNC:15500])

HSP 1 Score: 244.202 bits (622), Expect = 2.650e-67
Identity = 122/236 (51.69%), Postives = 154/236 (65.25%), Query Frame = 3
Query: 2463 WGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSI 3170
            W  L++VGTC D+ K YLRLT AP+PS VRP+ VLK SL  VK  W E   DY   CEQ KSIRQDLTVQ IR EFT+ VY+ HA +ALE  DHEEFNQCQ+Q+K LY E +   N  EFTAYR++YY+FT++  +I T LA L    K  PC++ AL LR AW+  N+ RFFRL C    P +   ++D F DRERK A K++IK +RP   +S+L   L F  +  C  F+  +
Sbjct:  545 WQELQIVGTCPDITKHYLRLTCAPDPSTVRPVAVLKKSLCMVKCHWKEKQ-DYAFACEQMKSIRQDLTVQGIRTEFTVEVYETHARIALEKGDHEEFNQCQTQLKSLYAENLPG-NVGEFTAYRILYYIFTKNSGDITTELAYLTRELKADPCVAHALALRTAWALGNYHRFFRLYC--HAPCMSGYLVDKFADRERKVALKAMIKTFRPALPVSYLQAELAFEGEAACRAFLEPL 776          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Human
Match: LENG8 (leukocyte receptor cluster member 8 [Source:HGNC Symbol;Acc:HGNC:15500])

HSP 1 Score: 244.202 bits (622), Expect = 2.650e-67
Identity = 122/236 (51.69%), Postives = 154/236 (65.25%), Query Frame = 3
Query: 2463 WGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSI 3170
            W  L++VGTC D+ K YLRLT AP+PS VRP+ VLK SL  VK  W E   DY   CEQ KSIRQDLTVQ IR EFT+ VY+ HA +ALE  DHEEFNQCQ+Q+K LY E +   N  EFTAYR++YY+FT++  +I T LA L    K  PC++ AL LR AW+  N+ RFFRL C    P +   ++D F DRERK A K++IK +RP   +S+L   L F  +  C  F+  +
Sbjct:  545 WQELQIVGTCPDITKHYLRLTCAPDPSTVRPVAVLKKSLCMVKCHWKEKQ-DYAFACEQMKSIRQDLTVQGIRTEFTVEVYETHARIALEKGDHEEFNQCQTQLKSLYAENLPG-NVGEFTAYRILYYIFTKNSGDITTELAYLTRELKADPCVAHALALRTAWALGNYHRFFRLYC--HAPCMSGYLVDKFADRERKVALKAMIKTFRPALPVSYLQAELAFEGEAACRAFLEPL 776          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Human
Match: LENG8 (leukocyte receptor cluster member 8 [Source:HGNC Symbol;Acc:HGNC:15500])

HSP 1 Score: 226.868 bits (577), Expect = 8.405e-62
Identity = 115/208 (55.29%), Postives = 141/208 (67.79%), Query Frame = 3
Query: 2463 WGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAY 3086
            W  L++VGTC D+ K YLRLT AP+PS VRP+ VLK SL  VK  W E   DY   CEQ KSIRQDLTVQ IR EFT+ VY+ HA +ALE  DHEEFNQCQ+Q+K LY E +   N  EFTAYR++YY+FT++  +I T LA L    K  PC++ AL LR AW+  N+ RFFRL C    P +   ++D F DRERK A K++IK Y
Sbjct:  397 WQELQIVGTCPDITKHYLRLTCAPDPSTVRPVAVLKKSLCMVKCHWKEKQ-DYAFACEQMKSIRQDLTVQGIRTEFTVEVYETHARIALEKGDHEEFNQCQTQLKSLYAENLPG-NVGEFTAYRILYYIFTKNSGDITTELAYLTRELKADPCVAHALALRTAWALGNYHRFFRLYC--HAPCMSGYLVDKFADRERKVALKAMIKTY 600          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Celegans
Match: hpo-10 (pep chromosome:WBcel235:III:5879845:5882428:1 gene:WBGene00017158.1 transcript:F01F1.1c.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:hpo-10)

HSP 1 Score: 209.149 bits (531), Expect = 8.904e-57
Identity = 102/216 (47.22%), Postives = 144/216 (66.67%), Query Frame = 3
Query: 2478 VVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNML 3125
            + GTCQ++EK + RLT AP PSEVRP++VL+ SL++V+   Y    +Y ++  Q +SIRQDLTVQ IR EFT+ VY+++A ++LE  D EEFN+CQSQ+KLLY E  +C N  EF AYRL+YY+   + ++I   L  L    K++ C+ FAL +R A + NN+ +FFRL      P++C  I+D F+DRERK A   I KA+RPT     ++  L
Sbjct:  395 IRGTCQNIEKSFFRLTAAPNPSEVRPLEVLRLSLQNVRDK-YRARAEYSYLTSQMRSIRQDLTVQVIRNEFTVEVYEINARISLENADREEFNKCQSQLKLLYSEIENCANQAEFVAYRLLYYIAMDNQIDINALLRELTPELKENDCVEFALNVRKAVTMNNYVKFFRLF--KNAPRMCPYIMDLFVDRERKKALGIITKAFRPTITYKLIAEFL 607          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Celegans
Match: hpo-10 (pep chromosome:WBcel235:III:5879826:5882428:1 gene:WBGene00017158.1 transcript:F01F1.1c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:hpo-10)

HSP 1 Score: 209.149 bits (531), Expect = 8.904e-57
Identity = 102/216 (47.22%), Postives = 144/216 (66.67%), Query Frame = 3
Query: 2478 VVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNML 3125
            + GTCQ++EK + RLT AP PSEVRP++VL+ SL++V+   Y    +Y ++  Q +SIRQDLTVQ IR EFT+ VY+++A ++LE  D EEFN+CQSQ+KLLY E  +C N  EF AYRL+YY+   + ++I   L  L    K++ C+ FAL +R A + NN+ +FFRL      P++C  I+D F+DRERK A   I KA+RPT     ++  L
Sbjct:  395 IRGTCQNIEKSFFRLTAAPNPSEVRPLEVLRLSLQNVRDK-YRARAEYSYLTSQMRSIRQDLTVQVIRNEFTVEVYEINARISLENADREEFNKCQSQLKLLYSEIENCANQAEFVAYRLLYYIAMDNQIDINALLRELTPELKENDCVEFALNVRKAVTMNNYVKFFRLF--KNAPRMCPYIMDLFVDRERKKALGIITKAFRPTITYKLIAEFL 607          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Celegans
Match: hpo-10 (pep chromosome:WBcel235:III:5879506:5882428:1 gene:WBGene00017158.1 transcript:F01F1.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:hpo-10)

HSP 1 Score: 209.149 bits (531), Expect = 9.599e-57
Identity = 102/216 (47.22%), Postives = 144/216 (66.67%), Query Frame = 3
Query: 2478 VVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNML 3125
            + GTCQ++EK + RLT AP PSEVRP++VL+ SL++V+   Y    +Y ++  Q +SIRQDLTVQ IR EFT+ VY+++A ++LE  D EEFN+CQSQ+KLLY E  +C N  EF AYRL+YY+   + ++I   L  L    K++ C+ FAL +R A + NN+ +FFRL      P++C  I+D F+DRERK A   I KA+RPT     ++  L
Sbjct:  400 IRGTCQNIEKSFFRLTAAPNPSEVRPLEVLRLSLQNVRDK-YRARAEYSYLTSQMRSIRQDLTVQVIRNEFTVEVYEINARISLENADREEFNKCQSQLKLLYSEIENCANQAEFVAYRLLYYIAMDNQIDINALLRELTPELKENDCVEFALNVRKAVTMNNYVKFFRLF--KNAPRMCPYIMDLFVDRERKKALGIITKAFRPTITYKLIAEFL 612          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Celegans
Match: F20D12.2 (pep chromosome:WBcel235:IV:7948643:7953548:1 gene:WBGene00017642.1 transcript:F20D12.2.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F20D12.2)

HSP 1 Score: 51.2174 bits (121), Expect = 5.553e-6
Identity = 40/142 (28.17%), Postives = 69/142 (48.59%), Query Frame = 3
Query: 2619 YRHICEQFKSIRQDLTVQCIREEFTLNVY----KLH-------ATVALE----ANDHEEFNQCQSQIKLLYEE----GISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRL 2987
            Y  +  + +++R+++T   + +   LN+     +LH         + +E    A ++E   +C   ++ LYE+    GISC N  EF +Y ++ +M   + L     LA   E  +  P +  ALQL  A+  NN+ RFFRL
Sbjct:  377 YNFLWNRTRALRKEVTQLSLSDTLALNLVERCTRLHILFGYVLCDLGVEQFDPAMNNETLGKCLQTLRHLYEDFEKRGISCENEPEFRSYDVMLHMNDTNVL--AQVLAYRSEVRQSQP-VRLALQLATAFRDNNYFRFFRL 515          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Celegans
Match: F20D12.2 (pep chromosome:WBcel235:IV:7948674:7953548:1 gene:WBGene00017642.1 transcript:F20D12.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F20D12.2)

HSP 1 Score: 51.2174 bits (121), Expect = 5.553e-6
Identity = 40/142 (28.17%), Postives = 69/142 (48.59%), Query Frame = 3
Query: 2619 YRHICEQFKSIRQDLTVQCIREEFTLNVY----KLH-------ATVALE----ANDHEEFNQCQSQIKLLYEE----GISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRL 2987
            Y  +  + +++R+++T   + +   LN+     +LH         + +E    A ++E   +C   ++ LYE+    GISC N  EF +Y ++ +M   + L     LA   E  +  P +  ALQL  A+  NN+ RFFRL
Sbjct:  377 YNFLWNRTRALRKEVTQLSLSDTLALNLVERCTRLHILFGYVLCDLGVEQFDPAMNNETLGKCLQTLRHLYEDFEKRGISCENEPEFRSYDVMLHMNDTNVL--AQVLAYRSEVRQSQP-VRLALQLATAFRDNNYFRFFRL 515          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Fly
Match: CG6700 (gene:FBgn0032305 transcript:FBtr0301710)

HSP 1 Score: 256.914 bits (655), Expect = 1.790e-71
Identity = 115/233 (49.36%), Postives = 170/233 (72.96%), Query Frame = 3
Query: 2472 LKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEE-GISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISS 3167
            L +VGTC+DLEK +LRLT+AP PSEVRP++VL +SL +VK  W  +  DY + C+Q KSIRQDLTVQ IR++FT+ VY+ HA +A+E  DHEEFNQCQ+Q+K+LY E G    N LEFTAYR++YY+FT++ L+I T + S+    +++P ++ ALQ R+AWS  N+C+ F L  +   P +   +I+WFL+RERKAA + IIK+YRP   + +++ +L F + ++C +++ +
Sbjct:  623 LHIVGTCRDLEKSFLRLTKAPSPSEVRPVEVLTHSLVNVKGKWRANQ-DYHYACDQLKSIRQDLTVQGIRDQFTVEVYETHARIAMEKGDHEEFNQCQTQLKMLYMEIGGKNANALEFTAYRILYYIFTKNTLDITTVMRSITADQRENPVIAHALQFRSAWSLGNYCKLFSLYRT--APLMSGHMIEWFLERERKAALRVIIKSYRPNISVDYITKILAFDSSEKCKEWLDT 852          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Fly
Match: CG6700 (gene:FBgn0032305 transcript:FBtr0080187)

HSP 1 Score: 256.914 bits (655), Expect = 1.790e-71
Identity = 115/233 (49.36%), Postives = 170/233 (72.96%), Query Frame = 3
Query: 2472 LKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEE-GISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISS 3167
            L +VGTC+DLEK +LRLT+AP PSEVRP++VL +SL +VK  W  +  DY + C+Q KSIRQDLTVQ IR++FT+ VY+ HA +A+E  DHEEFNQCQ+Q+K+LY E G    N LEFTAYR++YY+FT++ L+I T + S+    +++P ++ ALQ R+AWS  N+C+ F L  +   P +   +I+WFL+RERKAA + IIK+YRP   + +++ +L F + ++C +++ +
Sbjct:  623 LHIVGTCRDLEKSFLRLTKAPSPSEVRPVEVLTHSLVNVKGKWRANQ-DYHYACDQLKSIRQDLTVQGIRDQFTVEVYETHARIAMEKGDHEEFNQCQTQLKMLYMEIGGKNANALEFTAYRILYYIFTKNTLDITTVMRSITADQRENPVIAHALQFRSAWSLGNYCKLFSLYRT--APLMSGHMIEWFLERERKAALRVIIKSYRPNISVDYITKILAFDSSEKCKEWLDT 852          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Fly
Match: xmas (gene:FBgn0286809 transcript:FBtr0474622)

HSP 1 Score: 55.4546 bits (132), Expect = 3.176e-7
Identity = 40/151 (26.49%), Postives = 67/151 (44.37%), Query Frame = 3
Query: 2745 EEFNQCQSQIKLLYEE----GISCPNYLEFTAYRLIYYMFTRDFL-NIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYR-------PTCEISFLSNMLGFPNQDECMKFI 3161
            E   +C   +K +Y +    G+ CP   EF  Y ++  +   +FL +IG   A LQ      P +  A+Q   A    NF RFF+L        L + I+  +  R R      +I+AYR        +  +S+++ +L F ++ E   F+
Sbjct:  348 ENLTKCLQTLKYMYHDLRIKGVPCPKEAEFRGYIVLLNLADANFLWDIGQLPAELQSC----PEVRQAIQFYLALQDTNFVRFFQLLADKDTSYLSACILVNYFTRLRVLGLHRLIQAYRSPRKDEVSSLPLSYIAELLSFASEQEAADFV 494          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Fly
Match: xmas (gene:FBgn0286809 transcript:FBtr0474624)

HSP 1 Score: 55.4546 bits (132), Expect = 3.872e-7
Identity = 40/151 (26.49%), Postives = 67/151 (44.37%), Query Frame = 3
Query: 2745 EEFNQCQSQIKLLYEE----GISCPNYLEFTAYRLIYYMFTRDFL-NIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYR-------PTCEISFLSNMLGFPNQDECMKFI 3161
            E   +C   +K +Y +    G+ CP   EF  Y ++  +   +FL +IG   A LQ      P +  A+Q   A    NF RFF+L        L + I+  +  R R      +I+AYR        +  +S+++ +L F ++ E   F+
Sbjct:  348 ENLTKCLQTLKYMYHDLRIKGVPCPKEAEFRGYIVLLNLADANFLWDIGQLPAELQSC----PEVRQAIQFYLALQDTNFVRFFQLLADKDTSYLSACILVNYFTRLRVLGLHRLIQAYRSPRKDEVSSLPLSYIAELLSFASEQEAADFV 494          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Zebrafish
Match: leng8 (leukocyte receptor cluster (LRC) member 8 [Source:NCBI gene;Acc:100037367])

HSP 1 Score: 249.595 bits (636), Expect = 4.242e-69
Identity = 128/277 (46.21%), Postives = 181/277 (65.34%), Query Frame = 3
Query: 2349 KLANRASRFKDHL-LKSAVANESFDVVDRGPIDELSTETWGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCP--NYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSI 3170
            K  +RA+RF   L  +  V N +   +  G  + LS   W    +VGTCQD+ K YLRLT AP+PS VRP+ VL+ SL  VK  W  +  DY + CEQ KSIRQDLTVQ +R +FT+ VY+ HA +ALE  DHEEFNQCQ+Q+K LY++   CP  N  EFTAYRLIYY+FT++  ++ T L  L    +  PC++ AL+LR AW+  NF RFFRL    K P++ + +ID F++RER  A ++I+K++RP+  + ++ + L FP+ D C+ F++ +
Sbjct:  548 KKQSRAARFHTKLRTEPLVLNINVFDLPNGTQEGLS---WDDCPIVGTCQDITKNYLRLTCAPDPSTVRPVPVLRKSLIAVKAHWKSNQ-DYVYACEQMKSIRQDLTVQGVRTDFTVEVYETHARIALEKGDHEEFNQCQTQLKALYKD---CPSDNVGEFTAYRLIYYIFTKNSGDLTTELVYLTTELRADPCVAHALELRTAWALGNFHRFFRL--YQKAPRMAAYLIDKFVERERNIALRAILKSFRPSVSVEYVQSSLAFPDLDTCLAFLTGL 815          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Zebrafish
Match: leng8 (leukocyte receptor cluster (LRC) member 8 [Source:NCBI gene;Acc:100037367])

HSP 1 Score: 249.595 bits (636), Expect = 4.283e-69
Identity = 128/277 (46.21%), Postives = 181/277 (65.34%), Query Frame = 3
Query: 2349 KLANRASRFKDHL-LKSAVANESFDVVDRGPIDELSTETWGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCP--NYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSI 3170
            K  +RA+RF   L  +  V N +   +  G  + LS   W    +VGTCQD+ K YLRLT AP+PS VRP+ VL+ SL  VK  W  +  DY + CEQ KSIRQDLTVQ +R +FT+ VY+ HA +ALE  DHEEFNQCQ+Q+K LY++   CP  N  EFTAYRLIYY+FT++  ++ T L  L    +  PC++ AL+LR AW+  NF RFFRL    K P++ + +ID F++RER  A ++I+K++RP+  + ++ + L FP+ D C+ F++ +
Sbjct:  548 KKQSRAARFHTKLRTEPLVLNINVFDLPNGTQEGLS---WDDCPIVGTCQDITKNYLRLTCAPDPSTVRPVPVLRKSLIAVKAHWKSNQ-DYVYACEQMKSIRQDLTVQGVRTDFTVEVYETHARIALEKGDHEEFNQCQTQLKALYKD---CPSDNVGEFTAYRLIYYIFTKNSGDLTTELVYLTTELRADPCVAHALELRTAWALGNFHRFFRL--YQKAPRMAAYLIDKFVERERNIALRAILKSFRPSVSVEYVQSSLAFPDLDTCLAFLTGL 815          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Zebrafish
Match: mcm3ap (minichromosome maintenance complex component 3 associated protein [Source:ZFIN;Acc:ZDB-GENE-040715-1])

HSP 1 Score: 61.6178 bits (148), Expect = 5.921e-9
Identity = 71/295 (24.07%), Postives = 128/295 (43.39%), Query Frame = 3
Query: 2481 VGTCQDL---EKKYLRLTR--------------------------------APEPSEVRPIQVLKNSLEH-VKKLWYEDHID----YRHICEQFKSIRQDLTVQ--CIREEFTL----NVYKLHAT--------VALEAN-DHEEFNQCQSQIKLLYEE----GISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQ---HPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFL------SNMLGFPNQDECMKFI 3161
            VGTC D+   +++Y+R TR                                 P P E+RP+ VL  ++++ V ++  +   +    Y  +  + + IR+D+T Q  C  E  +L      + +H          ++ +A  ++E   +C   +K +Y++     + CP   EF  Y ++        LN G  L  +Q+  K+    P ++FA+Q+ AA ++NNF RFF+L  +     L S I+  + ++ R+ A K +  A+    + S +        ML F N  E  +FI
Sbjct:  686 VGTCPDMCPEKERYMRETRNQLSVFEVVPDTEKVDHYAAIKEYSRSSADQEEPLPHELRPLPVLSMTMDYLVTQIMDQGEGNCRDWYDFVWNRTRGIRKDITQQHLCDPETVSLIEKCTRFHIHCAHHLCQEPMMSFDAKINNENMTKCLQSLKEMYQDLATKEVYCPKEAEFRQYNVLVK------LNDGDILREVQQFRKEIRESPEVTFAVQVFAALNSNNFVRFFKLVSAASY--LSSCILHRYFNQVRRQALKILNVAFTVGSQRSTIFPVEDFVRMLMFRNATEATEFI 972          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Zebrafish
Match: mcm3ap (minichromosome maintenance complex component 3 associated protein [Source:ZFIN;Acc:ZDB-GENE-040715-1])

HSP 1 Score: 61.6178 bits (148), Expect = 6.592e-9
Identity = 71/295 (24.07%), Postives = 128/295 (43.39%), Query Frame = 3
Query: 2481 VGTCQDL---EKKYLRLTR--------------------------------APEPSEVRPIQVLKNSLEH-VKKLWYEDHID----YRHICEQFKSIRQDLTVQ--CIREEFTL----NVYKLHAT--------VALEAN-DHEEFNQCQSQIKLLYEE----GISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQ---HPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFL------SNMLGFPNQDECMKFI 3161
            VGTC D+   +++Y+R TR                                 P P E+RP+ VL  ++++ V ++  +   +    Y  +  + + IR+D+T Q  C  E  +L      + +H          ++ +A  ++E   +C   +K +Y++     + CP   EF  Y ++        LN G  L  +Q+  K+    P ++FA+Q+ AA ++NNF RFF+L  +     L S I+  + ++ R+ A K +  A+    + S +        ML F N  E  +FI
Sbjct:  686 VGTCPDMCPEKERYMRETRNQLSVFEVVPDTEKVDHYAAIKEYSRSSADQEEPLPHELRPLPVLSMTMDYLVTQIMDQGEGNCRDWYDFVWNRTRGIRKDITQQHLCDPETVSLIEKCTRFHIHCAHHLCQEPMMSFDAKINNENMTKCLQSLKEMYQDLATKEVYCPKEAEFRQYNVLVK------LNDGDILREVQQFRKEIRESPEVTFAVQVFAALNSNNFVRFFKLVSAASY--LSSCILHRYFNQVRRQALKILNVAFTVGSQRSTIFPVEDFVRMLMFRNATEATEFI 972          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Xenopus
Match: ENSXETT00000020751.1 (leukocyte receptor cluster member 8 homolog [Source:NCBI gene;Acc:100495696])

HSP 1 Score: 244.202 bits (622), Expect = 8.893e-68
Identity = 128/276 (46.38%), Postives = 181/276 (65.58%), Query Frame = 3
Query: 2349 KLANRASRFKDHLLKSAVANESFDVVDRGPIDELSTET--WGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSI 3170
            K   RA+RF+       +  E   V+    +D  ++E   W  +K+VGT QD+ K YLRLT AP+PS VRP+ VLK SL  VK   +++  DY   CEQ KSIRQDLTVQ IR EFT+ VY+ HA +ALE  DHEEFNQCQ+Q+K LY E ++  N  EFTAYR++YY+FT++  ++ T LA L +  K   C++ AL LR AW+ +N+ RFF+L    + P++   +ID F +RERKAA K++IK +RP   +S++ + L F N++EC  F++S+
Sbjct:  433 KKEKRAARFQHGHGPKKLRMEPL-VLQINNMDHSASENLDWNEIKIVGTSQDITKNYLRLTCAPDPSTVRPVPVLKKSLVMVKAD-FKNKQDYAFACEQMKSIRQDLTVQGIRTEFTVEVYETHARIALEKGDHEEFNQCQAQLKALYAENLAG-NVGEFTAYRILYYIFTKNSGDLTTELAHLTKELKADACVAHALSLREAWALSNYHRFFKLY--RESPRMSGYLIDKFAERERKAALKAMIKTFRPDLPVSYIQSELAFANEEECQSFLASL 703          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Xenopus
Match: ENSXETT00000034484.1 (leukocyte receptor cluster member 8 homolog [Source:NCBI gene;Acc:100495696])

HSP 1 Score: 244.588 bits (623), Expect = 1.823e-67
Identity = 127/272 (46.69%), Postives = 180/272 (66.18%), Query Frame = 3
Query: 2361 RASRFKDHLLKSAVANESFDVVDRGPIDELSTET--WGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSI 3170
            RA+RF+       +  E   V+    +D  ++E   W  +K+VGT QD+ K YLRLT AP+PS VRP+ VLK SL  VK   +++  DY   CEQ KSIRQDLTVQ IR EFT+ VY+ HA +ALE  DHEEFNQCQ+Q+K LY E ++  N  EFTAYR++YY+FT++  ++ T LA L +  K   C++ AL LR AW+ +N+ RFF+L    + P++   +ID F +RERKAA K++IK +RP   +S++ + L F N++EC  F++S+
Sbjct:  505 RAARFQHGHGPKKLRMEPL-VLQINNMDHSASENLDWNEIKIVGTSQDITKNYLRLTCAPDPSTVRPVPVLKKSLVMVKAD-FKNKQDYAFACEQMKSIRQDLTVQGIRTEFTVEVYETHARIALEKGDHEEFNQCQAQLKALYAENLAG-NVGEFTAYRILYYIFTKNSGDLTTELAHLTKELKADACVAHALSLREAWALSNYHRFFKLY--RESPRMSGYLIDKFAERERKAALKAMIKTFRPDLPVSYIQSELAFANEEECQSFLASL 771          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Xenopus
Match: ENSXETT00000020760.1 (leukocyte receptor cluster member 8 homolog [Source:NCBI gene;Acc:100495696])

HSP 1 Score: 243.817 bits (621), Expect = 1.931e-67
Identity = 127/272 (46.69%), Postives = 180/272 (66.18%), Query Frame = 3
Query: 2361 RASRFKDHLLKSAVANESFDVVDRGPIDELSTET--WGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSI 3170
            RA+RF+       +  E   V+    +D  ++E   W  +K+VGT QD+ K YLRLT AP+PS VRP+ VLK SL  VK   +++  DY   CEQ KSIRQDLTVQ IR EFT+ VY+ HA +ALE  DHEEFNQCQ+Q+K LY E ++  N  EFTAYR++YY+FT++  ++ T LA L +  K   C++ AL LR AW+ +N+ RFF+L    + P++   +ID F +RERKAA K++IK +RP   +S++ + L F N++EC  F++S+
Sbjct:  472 RAARFQHGHGPKKLRMEPL-VLQINNMDHSASENLDWNEIKIVGTSQDITKNYLRLTCAPDPSTVRPVPVLKKSLVMVKAD-FKNKQDYAFACEQMKSIRQDLTVQGIRTEFTVEVYETHARIALEKGDHEEFNQCQAQLKALYAENLAG-NVGEFTAYRILYYIFTKNSGDLTTELAHLTKELKADACVAHALSLREAWALSNYHRFFKLY--RESPRMSGYLIDKFAERERKAALKAMIKTFRPDLPVSYIQSELAFANEEECQSFLASL 738          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Xenopus
Match: ENSXETT00000023529.1 (leukocyte receptor cluster (LRC) member 8 [Source:NCBI gene;Acc:100488131])

HSP 1 Score: 233.417 bits (594), Expect = 7.695e-65
Identity = 125/276 (45.29%), Postives = 176/276 (63.77%), Query Frame = 3
Query: 2349 KLANRASRFKDHLLKSAVANESFDVVDRGPIDELSTET--WGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSI 3170
            K   RA+RF+       +  E   V+    +D  ++E   W  +K+VGT QD+ K YLRLT AP+PS VRP+ VLK SL  VK   +++  DY     Q KSIRQDL VQ IR EFT+ VY+ HA +ALE  DHEEFN+CQ+Q+K LY E ++  N  EFTAYR++YY+FT +  ++ T LA L +  K   C++ AL LR AW+  N+ RFF+L    + P++   +ID F +RERKAA K++IK +RP   +S++ + L F N++EC  F+SS+
Sbjct:  334 KKEKRAARFQHGHGPKKLRMEPL-VLQINNMDHSASENLDWNEIKIVGTSQDITKNYLRLTCAPDPSTVRPVPVLKKSLAMVKAD-FKNKQDYAFARNQMKSIRQDLMVQGIRTEFTVEVYETHARIALEKGDHEEFNKCQAQLKALYAENLAG-NVGEFTAYRILYYIFTENSGDLTTELAHLTKELKADACVAHALSLREAWALKNYHRFFKLY--RESPRMSGYLIDKFAERERKAALKAMIKTFRPDLPVSYIQSELAFANEEECQSFLSSL 604          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Xenopus
Match: ENSXETT00000036604.1 (leukocyte receptor cluster (LRC) member 8 [Source:NCBI gene;Acc:100488131])

HSP 1 Score: 233.802 bits (595), Expect = 2.038e-64
Identity = 125/276 (45.29%), Postives = 176/276 (63.77%), Query Frame = 3
Query: 2349 KLANRASRFKDHLLKSAVANESFDVVDRGPIDELSTET--WGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSI 3170
            K   RA+RF+       +  E   V+    +D  ++E   W  +K+VGT QD+ K YLRLT AP+PS VRP+ VLK SL  VK   +++  DY     Q KSIRQDL VQ IR EFT+ VY+ HA +ALE  DHEEFN+CQ+Q+K LY E ++  N  EFTAYR++YY+FT +  ++ T LA L +  K   C++ AL LR AW+  N+ RFF+L    + P++   +ID F +RERKAA K++IK +RP   +S++ + L F N++EC  F+SS+
Sbjct:  410 KKEKRAARFQHGHGPKKLRMEPL-VLQINNMDHSASENLDWNEIKIVGTSQDITKNYLRLTCAPDPSTVRPVPVLKKSLAMVKAD-FKNKQDYAFARNQMKSIRQDLMVQGIRTEFTVEVYETHARIALEKGDHEEFNKCQAQLKALYAENLAG-NVGEFTAYRILYYIFTENSGDLTTELAHLTKELKADACVAHALSLREAWALKNYHRFFKLY--RESPRMSGYLIDKFAERERKAALKAMIKTFRPDLPVSYIQSELAFANEEECQSFLSSL 680          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Mouse
Match: Leng8 (leukocyte receptor cluster (LRC) member 8 [Source:MGI Symbol;Acc:MGI:2142195])

HSP 1 Score: 232.646 bits (592), Expect = 1.967e-63
Identity = 124/236 (52.54%), Postives = 157/236 (66.53%), Query Frame = 3
Query: 2463 WGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSI 3170
            W  L++VGTC D+ K YLRLT AP+PS VRP+ VLK SL  VK  W E   DY   CEQ KSIRQDLTVQ IR EFT+ VY+ HA +ALE  DHEEFNQCQ+Q+K LY E ++  N  EFTAYR++YY+FT++  +I T LA L    K  PC++ AL LRAAW+  N+ RFFRL C    P +   ++D F DRERKAA K++IK +RP   +S+L   L F  +  C  F+  +
Sbjct:  546 WQELQIVGTCPDITKHYLRLTCAPDPSTVRPVAVLKKSLCMVKSHWKEKQ-DYAFACEQMKSIRQDLTVQGIRTEFTVEVYETHARIALEKGDHEEFNQCQTQLKSLYAENLAG-NVGEFTAYRILYYIFTKNSGDITTELAYLTREMKADPCVAHALALRAAWALGNYHRFFRLYC--HAPCMSGYLVDKFADRERKAALKAMIKTFRPALPVSYLQAELAFEGEAACRAFLEPL 777          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Mouse
Match: Leng8 (leukocyte receptor cluster (LRC) member 8 [Source:MGI Symbol;Acc:MGI:2142195])

HSP 1 Score: 215.698 bits (548), Expect = 7.203e-58
Identity = 117/208 (56.25%), Postives = 144/208 (69.23%), Query Frame = 3
Query: 2463 WGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAY 3086
            W  L++VGTC D+ K YLRLT AP+PS VRP+ VLK SL  VK  W E   DY   CEQ KSIRQDLTVQ IR EFT+ VY+ HA +ALE  DHEEFNQCQ+Q+K LY E ++  N  EFTAYR++YY+FT++  +I T LA L    K  PC++ AL LRAAW+  N+ RFFRL C    P +   ++D F DRERKAA K++IK Y
Sbjct:  546 WQELQIVGTCPDITKHYLRLTCAPDPSTVRPVAVLKKSLCMVKSHWKEKQ-DYAFACEQMKSIRQDLTVQGIRTEFTVEVYETHARIALEKGDHEEFNQCQTQLKSLYAENLAG-NVGEFTAYRILYYIFTKNSGDITTELAYLTREMKADPCVAHALALRAAWALGNYHRFFRLYC--HAPCMSGYLVDKFADRERKAALKAMIKTY 749          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Mouse
Match: Mcm3ap (minichromosome maintenance complex component 3 associated protein [Source:MGI Symbol;Acc:MGI:1930089])

HSP 1 Score: 63.5438 bits (153), Expect = 1.651e-9
Identity = 68/297 (22.90%), Postives = 130/297 (43.77%), Query Frame = 3
Query: 2481 VGTCQDL---EKKYLRLTRA--------------------------------PEPSEVRPIQVLKNSLEHV-------KKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNV------YKLHAT--------VALEAN-DHEEFNQCQSQIKLLYEE----GISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHH---KQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCE------ISFLSNMLGFPNQDECMKFI 3161
            VGTC D+   +++YLR TR+                                P P E+RP  VL  +++++       K+    D  D+  +  + + IR+D+T Q + +  T+++      + +H           + +A  ++E   +C   +K +Y++    G+ C +  EF  Y ++        LN G  L  +Q+ H   +  P ++FA+Q  AA ++NNF RFF+L  S      C  ++  + ++ RK A +++  AY  + +      +  +  ML F + +E   F+
Sbjct:  627 VGTCPDMCPEKERYLRETRSQLSVFEVVPGTDQVDHAAAVKEYSRSSADQEEPLPHELRPSAVLSRTMDYLVTQIMDQKEGSLRDWYDF--VWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAHFMCEEPMSSFDAKINNENMTKCLQSLKEMYQDLRNKGVFCASEAEFQGYNVLLN------LNKGDILREVQQFHPDVRNSPEVNFAVQAFAALNSNNFVRFFKLVQSASYLNAC--LLHCYFNQIRKDALRALNVAYTVSTQRSTVFPLDGVVRMLLFRDSEEATNFL 913          
BLAST of Leukocyte receptor cluster member 8-like protein vs. UniProt/SwissProt
Match: sp|A4QNR8|LENG8_DANRE (Leukocyte receptor cluster member 8 homolog OS=Danio rerio OX=7955 GN=leng8 PE=2 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 3.233e-68
Identity = 128/277 (46.21%), Postives = 181/277 (65.34%), Query Frame = 3
Query: 2349 KLANRASRFKDHL-LKSAVANESFDVVDRGPIDELSTETWGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCP--NYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSI 3170
            K  +RA+RF   L  +  V N +   +  G  + LS   W    +VGTCQD+ K YLRLT AP+PS VRP+ VL+ SL  VK  W  +  DY + CEQ KSIRQDLTVQ +R +FT+ VY+ HA +ALE  DHEEFNQCQ+Q+K LY++   CP  N  EFTAYRLIYY+FT++  ++ T L  L    +  PC++ AL+LR AW+  NF RFFRL    K P++ + +ID F++RER  A ++I+K++RP+  + ++ + L FP+ D C+ F++ +
Sbjct:  548 KKQSRAARFHTKLRTEPLVLNINVFDLPNGTQEGLS---WDDCPIVGTCQDITKNYLRLTCAPDPSTVRPVPVLRKSLIAVKAHWKSNQ-DYVYACEQMKSIRQDLTVQGVRTDFTVEVYETHARIALEKGDHEEFNQCQTQLKALYKD---CPSDNVGEFTAYRLIYYIFTKNSGDLTTELVYLTTELRADPCVAHALELRTAWALGNFHRFFRL--YQKAPRMAAYLIDKFVERERNIALRAILKSFRPSVSVEYVQSSLAFPDLDTCLAFLTGL 815          
BLAST of Leukocyte receptor cluster member 8-like protein vs. UniProt/SwissProt
Match: sp|Q96PV6|LENG8_HUMAN (Leukocyte receptor cluster member 8 OS=Homo sapiens OX=9606 GN=LENG8 PE=1 SV=3)

HSP 1 Score: 244.202 bits (622), Expect = 1.273e-66
Identity = 122/236 (51.69%), Postives = 154/236 (65.25%), Query Frame = 3
Query: 2463 WGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSI 3170
            W  L++VGTC D+ K YLRLT AP+PS VRP+ VLK SL  VK  W E   DY   CEQ KSIRQDLTVQ IR EFT+ VY+ HA +ALE  DHEEFNQCQ+Q+K LY E +   N  EFTAYR++YY+FT++  +I T LA L    K  PC++ AL LR AW+  N+ RFFRL C    P +   ++D F DRERK A K++IK +RP   +S+L   L F  +  C  F+  +
Sbjct:  545 WQELQIVGTCPDITKHYLRLTCAPDPSTVRPVAVLKKSLCMVKCHWKEKQ-DYAFACEQMKSIRQDLTVQGIRTEFTVEVYETHARIALEKGDHEEFNQCQTQLKSLYAENLPG-NVGEFTAYRILYYIFTKNSGDITTELAYLTRELKADPCVAHALALRTAWALGNYHRFFRLYC--HAPCMSGYLVDKFADRERKVALKAMIKTFRPALPVSYLQAELAFEGEAACRAFLEPL 776          
BLAST of Leukocyte receptor cluster member 8-like protein vs. UniProt/SwissProt
Match: sp|Q32NW2|LENG8_XENLA (Leukocyte receptor cluster member 8 homolog OS=Xenopus laevis OX=8355 GN=leng8 PE=2 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 1.636e-65
Identity = 118/236 (50.00%), Postives = 163/236 (69.07%), Query Frame = 3
Query: 2463 WGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSI 3170
            W  +K+VG  QD+ K YLRLT AP+PS VRP+ VLK SL  VK   +++  DY   CEQ KSIRQDLTVQ IR EFT+ VY+ HA +ALE  DHEEFNQCQ+Q+K LY E ++  N  EFTAYR++YY+FT++  ++ T LA L +  K   C++ AL LR AW+ +N+ RFF+L    + P++   +ID F +RERKAA K++IK +RP   +SF+ + L F N++EC  F++ +
Sbjct:  545 WDEIKIVGNSQDITKHYLRLTCAPDPSTVRPVPVLKKSLTMVKAD-FKNKQDYVFACEQMKSIRQDLTVQGIRTEFTVEVYETHARIALEKGDHEEFNQCQAQLKSLYAENLAG-NVGEFTAYRILYYIFTKNSGDLTTELAHLTKELKADACVAHALSLREAWALSNYHRFFKLY--RQAPRMSGYLIDKFAERERKAALKAMIKTFRPLLPVSFVQSELAFANEEECQSFLAPL 776          
BLAST of Leukocyte receptor cluster member 8-like protein vs. UniProt/SwissProt
Match: sp|Q8CBY3|LENG8_MOUSE (Leukocyte receptor cluster member 8 homolog OS=Mus musculus OX=10090 GN=Leng8 PE=1 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 5.038e-57
Identity = 117/208 (56.25%), Postives = 144/208 (69.23%), Query Frame = 3
Query: 2463 WGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAY 3086
            W  L++VGTC D+ K YLRLT AP+PS VRP+ VLK SL  VK  W E   DY   CEQ KSIRQDLTVQ IR EFT+ VY+ HA +ALE  DHEEFNQCQ+Q+K LY E ++  N  EFTAYR++YY+FT++  +I T LA L    K  PC++ AL LRAAW+  N+ RFFRL C    P +   ++D F DRERKAA K++IK Y
Sbjct:  546 WQELQIVGTCPDITKHYLRLTCAPDPSTVRPVAVLKKSLCMVKSHWKEKQ-DYAFACEQMKSIRQDLTVQGIRTEFTVEVYETHARIALEKGDHEEFNQCQTQLKSLYAENLAG-NVGEFTAYRILYYIFTKNSGDITTELAYLTREMKADPCVAHALALRAAWALGNYHRFFRLYC--HAPCMSGYLVDKFADRERKAALKAMIKTY 749          
BLAST of Leukocyte receptor cluster member 8-like protein vs. UniProt/SwissProt
Match: sp|Q1MTP1|THP3_SCHPO (THP3 homolog C2A9.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2A9.11c PE=3 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 1.215e-50
Identity = 101/241 (41.91%), Postives = 158/241 (65.56%), Query Frame = 3
Query: 2478 VVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSILPTTDNYTPS 3200
            ++G   +LEK+YLRLT AP+P  VRP+ VLK +LE +KK  +++  +Y +IC+QFKS+RQDLTVQ I+ EF++ VY++HA +ALE  D  E+NQCQ+Q+  LY  GI   N  EF AYR++Y +FT++   + + LA+L+E  K +  ++ AL++R+A +T ++ +FF L      P +   ++D F++RER  A   + KAYRP+  + FL+N L F   ++C+ F  S     D+  P+
Sbjct:  132 IIGRSTELEKRYLRLTSAPDPDTVRPLPVLKQTLELLKKK-WKEEKNYAYICDQFKSLRQDLTVQRIQNEFSVLVYEIHARIALEKGDVGEYNQCQTQLFHLYSFGIPG-NTKEFLAYRILYMLFTKNRSEMNSLLANLKEEDKTNAAVTHALEVRSAMATGDYYKFFHLYLV--APNMGGYLMDLFIERERVQAMIMMCKAYRPSLTMEFLANTLAFEEMEDCVNFFRSCNAVYDSKDPN 368          
BLAST of Leukocyte receptor cluster member 8-like protein vs. TrEMBL
Match: A0A095BT36 (Leukocyte receptor cluster member 8-like protein (Fragment) OS=Schistosoma haematobium OX=6185 GN=MS3_00058 PE=4 SV=1)

HSP 1 Score: 293.508 bits (750), Expect = 1.278e-81
Identity = 142/282 (50.35%), Postives = 200/282 (70.92%), Query Frame = 3
Query: 2349 KLANRASRFKDHLLKSAVANESFDVVDRGPI-------DELSTETWGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLAC---SDKVPKL-CSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFI 3161
            +L  RASRFKDHL++S + + S        +       D+L+ + +G+ +++GT Q++EK+YLRLTRAP+P+EVRP+ +LK SLEHVK+ W   + DY  +CEQFKSIRQDLTVQ I ++F ++VY+ HA VALEA D EEF+QCQSQ+  L++EG+     LEFTAYRL+YY+FT D L I T +A L+  HK +PC+SFAL+LR+AWS +N+ RFF+L C    D+ P L C  +++WF+DRERK A + + K +RPT  +SF+S ++GF +   C  FI
Sbjct:  463 RLTQRASRFKDHLVQSPIGSGSIGRTTSHLLSNYTDERDDLAVD-FGSCQIIGTMQEIEKQYLRLTRAPDPTEVRPLAILKLSLEHVKEKW-RSNTDYHWVCEQFKSIRQDLTVQGIEDDFAVSVYEAHADVALEAGDFEEFHQCQSQLLRLHKEGLGVSRLLEFTAYRLLYYIFTLDILGINTIMAGLRPTHKTNPCVSFALKLRSAWSLSNYHRFFKLLCPANDDQQPPLRCKHVVNWFVDRERKEAIRLMFKVFRPTISLSFISKLIGFSSTALCKDFI 742          
BLAST of Leukocyte receptor cluster member 8-like protein vs. TrEMBL
Match: A0A4V3SGR7 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001554 PE=4 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 6.035e-80
Identity = 143/288 (49.65%), Postives = 191/288 (66.32%), Query Frame = 3
Query: 2340 TTEKLANRASRFKDHL----------LKSAVANESFDVVDRGPIDELSTETWGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLAC----SDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFI 3161
            +  +L++RA+RFKDHL          +    +    ++ D G  DELS E +   ++VGT Q+LEK YLRLTRAPEP EVRP+ VLK +LEHVK+ W     DY   CEQFKSIRQDLTVQ I +EF + VY+ HA  AL+A D EEF+QCQSQ+  LY EG+     LEFTAYRL+YYMFT D L + T +A L+  HK +PC+ +AL +R+AWS +N+ RFFRL C     ++ P  C +++ WFL+RERK A K+I K +RP   + F+S+ +G P+ DEC K +
Sbjct:  371 SVARLSDRANRFKDHLSVSSLSGSGSIARTTSQLLLNLGDEG--DELSAE-FQACQIVGTMQELEKPYLRLTRAPEPYEVRPVSVLKLALEHVKQKWITKS-DYHWTCEQFKSIRQDLTVQGIEDEFAVAVYETHADAALDAGDFEEFHQCQSQLLRLYNEGLGSVRVLEFTAYRLLYYMFTLDLLGMNTIMAGLRPTHKSNPCVRYALDVRSAWSLHNYRRFFRLVCPPDGGEQPPLRCGQVLQWFLERERKNALKTIFKVFRPNVSLQFISDSVGLPSTDECTKLL 654          
BLAST of Leukocyte receptor cluster member 8-like protein vs. TrEMBL
Match: A0A4S2MAA8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001554 PE=4 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 3.408e-79
Identity = 143/288 (49.65%), Postives = 191/288 (66.32%), Query Frame = 3
Query: 2340 TTEKLANRASRFKDHL----------LKSAVANESFDVVDRGPIDELSTETWGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLAC----SDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFI 3161
            +  +L++RA+RFKDHL          +    +    ++ D G  DELS E +   ++VGT Q+LEK YLRLTRAPEP EVRP+ VLK +LEHVK+ W     DY   CEQFKSIRQDLTVQ I +EF + VY+ HA  AL+A D EEF+QCQSQ+  LY EG+     LEFTAYRL+YYMFT D L + T +A L+  HK +PC+ +AL +R+AWS +N+ RFFRL C     ++ P  C +++ WFL+RERK A K+I K +RP   + F+S+ +G P+ DEC K +
Sbjct:  504 SVARLSDRANRFKDHLSVSSLSGSGSIARTTSQLLLNLGDEG--DELSAE-FQACQIVGTMQELEKPYLRLTRAPEPYEVRPVSVLKLALEHVKQKWITKS-DYHWTCEQFKSIRQDLTVQGIEDEFAVAVYETHADAALDAGDFEEFHQCQSQLLRLYNEGLGSVRVLEFTAYRLLYYMFTLDLLGMNTIMAGLRPTHKSNPCVRYALDVRSAWSLHNYRRFFRLVCPPDGGEQPPLRCGQVLQWFLERERKNALKTIFKVFRPNVSLQFISDSVGLPSTDECTKLL 787          
BLAST of Leukocyte receptor cluster member 8-like protein vs. TrEMBL
Match: A0A4Z2DTU6 (Leukocyte receptor cluster member 8 isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_005656 PE=4 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 3.156e-78
Identity = 142/282 (50.35%), Postives = 196/282 (69.50%), Query Frame = 3
Query: 2349 KLANRASRFKDHLLKS-AVANESFDVVDRGPIDELSTETWG------TLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRL---ACSDKVPKL-CSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFI 3161
            +L  RASRFKDHL +S A+ + S        +   + E  G      + ++VGT Q++EK+YLRLTRAP+P+EVRP+ VLK SL+HVK+ W+ +  DY  +CEQFKSIRQDLTVQ I ++F ++VY+ HA VAL+A D EEF+QCQSQ+  L++EG+     LEFTAYRL+YY+FT D L I T +A L+  HK +PC++FAL+LR+AWS +N+ RFF+L   A  D+ P L C  +++WF+DRERK A +   K +RPT  +SFLS ++GF +   C  FI
Sbjct:  512 RLTQRASRFKDHLAQSSAIGSGSIAQTTSQLLSSFTDERDGLAVDFSSCQIVGTMQEIEKQYLRLTRAPDPTEVRPLAVLKLSLQHVKEKWHSN-TDYHWVCEQFKSIRQDLTVQGIEDDFAVSVYEAHADVALDAGDFEEFHQCQSQLLRLHKEGLGVGRLLEFTAYRLLYYIFTLDILGINTIMAGLRPTHKTNPCIAFALKLRSAWSLSNYHRFFQLLYPATEDQQPPLRCKHVVNWFVDRERKEAIRLTFKVFRPTISLSFLSKLVGFSSTALCKDFI 792          
BLAST of Leukocyte receptor cluster member 8-like protein vs. TrEMBL
Match: A0A210QYA1 (Leukocyte receptor cluster member 8-like OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05108 PE=4 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 4.811e-77
Identity = 147/312 (47.12%), Postives = 200/312 (64.10%), Query Frame = 3
Query: 2349 KLANRASRFKDHL---LKSAVANESFDVVDRGPIDELSTETWGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSILPTTDNYTPSISDIYLNGDITSDKLDMKSCANTFQ 3275
            KL  RA+RF+ HL    K    N +  +      DE   +   +  VVGTCQD+EK YLRLT AP+ S++RP++VL+ SL+HVK+ W E    Y  +CEQFKSIRQDLTVQ IR  FT+ VY+ HA VALE  DHEEFNQCQ+Q+KLLY+EG+   N LEF AYR++YY+FT + L++ T LASL    +Q  C+SFAL++R+AW+ NNF +FF+L  S+  P++   ++DWF DR RK A K+I+K+YRP   + F+   LGFPN ++C+ F+                  L  D T  ++D K+CA   Q
Sbjct:  525 KLMKRAARFEHHLGNEAKKQKQNRTLTINTYTNSDEEDLD-LSSFDVVGTCQDIEKPYLRLTSAPDASQIRPLEVLRKSLDHVKECW-EKKNKYHFVCEQFKSIRQDLTVQGIRSNFTVEVYETHARVALEKGDHEEFNQCQTQLKLLYQEGLHG-NQLEFLAYRILYYIFTSNTLDMTTALASLSSTCRQDECVSFALKVRSAWALNNFHKFFKL--SNHAPRMSGYLLDWFADRARKTALKTIVKSYRPMLSVDFILAELGFPNMEDCIVFLKE------------KGAVLTPDGT--RVDCKTCATAIQ 817          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000034136.1 (leukocyte receptor cluster member 8 [Source:NCBI gene;Acc:103044145])

HSP 1 Score: 227.254 bits (578), Expect = 1.688e-61
Identity = 131/287 (45.64%), Postives = 187/287 (65.16%), Query Frame = 3
Query: 2349 KLANRASRFKDHLLKSAVAN-ESFDVVDRGPIDELSTETWGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCP--NYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSILPTTDNYTPS 3200
            K  +RA+RF     +  V N  SFD+ + G  + LS   W    +VGTCQD+ K YLRLT AP+PS VRP+ VL+ SL  VK  W  +  DY++ CEQ KSIRQDLTVQ +R +FT+ VY+ HA +ALE  DHEEFNQCQ+Q+K LY++   CP  N  EFTAYRL+YY+FT++  ++ T L  L    ++  C+S AL LRAAW+  N+ +FF+L    + P++ + +ID F++RERK A  +I+K +RP+  + ++ + L FP  D C+ F++ +  T   +TPS
Sbjct:  558 KKQSRAARFHTKRTEPLVLNINSFDLPN-GTQEGLS---WEDCPIVGTCQDITKNYLRLTCAPDPSTVRPVSVLRKSLVAVKGHWKTNQ-DYQYACEQMKSIRQDLTVQGVRTDFTVEVYETHARIALEKGDHEEFNQCQTQLKALYKD---CPSDNVGEFTAYRLLYYIFTKNSGDLTTELVYLTPELREDDCVSHALALRAAWALGNYHKFFQLY--KRAPRMAAYLIDKFVERERKLALGAILKTFRPSVPMEYVQSSLAFPCLDTCLAFLTGLGVT---FTPS 831          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Cavefish
Match: mcm3ap (minichromosome maintenance complex component 3 associated protein [Source:ZFIN;Acc:ZDB-GENE-040715-1])

HSP 1 Score: 59.3066 bits (142), Expect = 2.752e-8
Identity = 67/292 (22.95%), Postives = 126/292 (43.15%), Query Frame = 3
Query: 2481 VGTCQDL---EKKYLRLTR--------------------------------APEPSEVRPIQVLKNSLEH-VKKLWYEDHIDYRH----ICEQFKSIRQDLTVQCIREEFTLNV------YKLHATVAL---------EANDHEEFNQCQSQIKLLYEE----GISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAY-----RPTC-EISFLSNMLGFPNQDECMKFI 3161
            VGTC D+   +++Y+R TR                                 P P E+RP+ VL  ++++ V ++  +   +YR     +  + + IR+D+T Q + +  T+ +      + +H    L            ++E   +C   +K +Y++     + CP+  EF  Y ++  +   D L     +   +E  +    + FA+Q  AA ++NNF RFF+L  +     L S I+  + ++ R++A K++  AY     R T   +  L+ ML F +  E   F+
Sbjct:  706 VGTCPDMCPEKERYMRETRNQLSVFELVPETEKVDHFAAIKEYSRSSADQEEPLPHELRPLPVLSMTMDYLVTQIMDQGEGNYRDWYDFVWNRTRGIRKDITQQHLCDPDTVALIEKCTRFHIHCAHHLCQEPMMSFDTKINNENMTKCLQSLKEMYQDLATKEVYCPHEAEFRQYNVLLKLNEGDMLR---EVQQFREEVRNSAEVKFAVQAFAALNSNNFVRFFKLVKAASY--LASCILHRYFNQMRRSALKALNIAYTVGSQRSTVFPVEDLARMLMFRSAAEATHFL 992          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007904.1 (pep scaffold:Pmarinus_7.0:GL480340:6186:21414:1 gene:ENSPMAG00000007140.1 transcript:ENSPMAT00000007904.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 1.811e-6
Identity = 60/269 (22.30%), Postives = 112/269 (41.64%), Query Frame = 3
Query: 2454 TETWGTLKVVGTCQDL---EKKYLRLTRA--------------------------------PEPSEVRP-------IQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVY----KLH------------ATVALEANDHEEFNQCQSQIKLLYEE----GISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSI 3074
            TE      +VGTC D+   +++YLR  R                                 P P E+RP       +Q L NS+ ++ +  + +  D+  +  + + IR+D+T Q + E  ++++     + H            AT   + N+ E   +C   +K +Y++    GI C    EF  Y ++  +   D L     +   +E  +    + FA+Q+ +A ++NNF RFF+L  S      C  ++  +  + R+ A K++
Sbjct:  194 TELEKAKAIVGTCSDMCPEKERYLREIRKQLSIYEVIPGTDKVNHAAVIKEYSRSSADQEEPLPHELRPPHVLDMTMQYLVNSVMNIGEDNWAEWYDF--VWNRTRGIRKDITQQHLCEPISVSLIEKCTRFHVLCAHHLCQQPMATFEPKINN-ENLTKCLQSLKEMYQDLANKGIYCSGEPEFRGYSVLLNLNHGDILR---EVQQFREEIRNSSPVKFAVQVFSALNSNNFVRFFKLVKSASYLNAC--LLHRYFTQVRRDALKAL 454          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Yeast
Match: THP3 (Protein that may have a role in transcription elongation; forms a complex with Csn12p that is recruited to transcribed genes; possibly involved in splicing based on pre-mRNA accumulation defect for many intron-containing genes [Source:SGD;Acc:S000006249])

HSP 1 Score: 122.479 bits (306), Expect = 8.781e-30
Identity = 89/286 (31.12%), Postives = 135/286 (47.20%), Query Frame = 3
Query: 2346 EKLANRASRFKDHLLKSAVANESF--DVVDRGPIDELSTETWGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEE-GISCPNYLEFTAYRLIYYMFTRDFLNI----------GTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFIS 3164
            E+   RA RF      +  +N++   D  +   I   S +    + VVG CQ LEK YLRLT  P P  +RP  +L+     +   +      Y ++C+QFKS+RQDL VQ I   FT+ VY+ HA +ALE  D  EFNQCQ++I  L+E   I   +Y EF  Y ++Y M T D+ +I          G++     EH K         +L       N+  F +     K+ K    +I+ FL+ E+      I K+Y     + F+ +   F + +E   F++
Sbjct:  143 ERRKRRAERFSQGPSATTNSNDNLNEDFANLNAISSKSHQYDKKIHVVGRCQTLEKSYLRLTSEPNPDLIRPPNILQKMYCLLMDKYQSKTATYTYLCDQFKSMRQDLRVQMIENSFTIKVYQTHARIALENGDLGEFNQCQNRIMALFENPTIPKKSYSEFICYSVLYSMLTEDYPSISHLKLKLIDDGSSEILEDEHVK------MIFELSDMKLVGNYHYFMKNYL--KLHKFEKCLINSFLNLEKLIFLTIICKSYN-QVNLDFVKSEFNFNSIEETTNFLN 419          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Nematostella
Match: EDO48284 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJL8])

HSP 1 Score: 219.164 bits (557), Expect = 1.301e-63
Identity = 122/267 (45.69%), Postives = 163/267 (61.05%), Query Frame = 3
Query: 2349 KLANRASRFKDHLLKSAVANESFDVVDRGP--IDELSTET-WGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYL-EFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPN 3137
            K+  RA RFK  L  S  ++ S          ID  + E+ W    V+G CQ LEKKY RL  AP+ + VRP +VLK SLE VK  W     DY + CEQFKSIRQDLTVQ IR+EFT+ VY+ HA VALE  D EEFNQCQ+Q+K LY    + P ++ EFTAYRL+Y++   + L + T +  L    K  P +  ALQ  +A + +N+  FF+L  S   P + + ++D F+ RER  A K +IK+YRPT  +SF+ + LGFP+
Sbjct:   81 KIQQRAQRFKGTLTTSTRSSPSILSTINATMFIDRDNEESDWSKFHVIGICQSLEKKYYRLNTAPDATTVRPKEVLKKSLEMVKDHWKTKQ-DYVYACEQFKSIRQDLTVQGIRDEFTVEVYETHARVALEKGDREEFNQCQTQLKALY--ASNAPGHVREFTAYRLLYHIMIGNTLEVTTEVLKLTPGEKADPAIKHALQFYSARALSNYHNFFQLYLSS--PNMSAYLVDLFIQRERTTAIKVLIKSYRPTLPVSFVQSELGFPD 342          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Nematostella
Match: EDO31533 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXM6])

HSP 1 Score: 59.3066 bits (142), Expect = 3.407e-9
Identity = 58/245 (23.67%), Postives = 109/245 (44.49%), Query Frame = 3
Query: 2532 PEPSEVRPIQVLKNSLEHV--------KKLWYEDHIDYRHICEQFKSIRQDLT---------VQCIREEFTLNVYKLHATVALEAN------DHEEFNQCQSQIKLLY-----EEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLA-CSDKVPKLCSKIIDWFLDRERKAAFKSI-IKAYRPTCEISF----LSNMLGFPNQDECMKFIS 3164
            P P E+RPI VLK +++++        +  W E   D+  +  + + IR+D+T         V+ I +    +++  H     +        + E   +C   +K  Y      +G++CP+  EF AY ++  +   D L         +E  ++ P + FA  +  A  +NNF RFF+L  C+D    +C+ I+  +  + R  A +++      P  E+ +    L+ +L F + DE   F +
Sbjct:   57 PLPHELRPIPVLKMTMDYLVTNVMDIGEGRWAE-WFDF--VWNRTRGIRKDITQQHLCDVDAVELIEKTARFHIFCAHYLCGEDMMTFDSRINTENLTKCLQTLKQFYGDLQKNQGVTCPHEAEFRAYDILLNLNEGDILRQAM---KYREEIQRSPIVKFATSVFHALDSNNFVRFFKLVKCAD---YMCACILHRYFTQVRSMALRTMNYSLTTPNKEMYYPLEELAQVLAFEDADEASDFCT 292          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Medaka
Match: leng8 (leukocyte receptor cluster member 8 [Source:NCBI gene;Acc:101162239])

HSP 1 Score: 224.942 bits (572), Expect = 4.800e-61
Identity = 129/276 (46.74%), Postives = 180/276 (65.22%), Query Frame = 3
Query: 2349 KLANRASRFKDHLLKS--AVANESFDVVDRGPIDELSTETWGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSI 3170
            K  +RA+RF   L      ++  + D+ D G  + LS   W    +VG+CQD+ K YLRLT AP+P+ VRP+QVL+ SL  VK  W + H DY + CEQ KSIRQDLTVQ +R EFT+ VY+ HA +ALE  DHEEFNQCQ+Q+K LY++  S  N  EFTAYRL+YY+FT++F ++ T L  L    +   C++FAL LRAAW+  N+ RFF+L    + P++ S +ID F+DRERK A  +I+K +RP   + ++   LGF   D C+ F++ +
Sbjct:  502 KKQSRAARFHKQLRSEPLVLSINTLDLPD-GTQEGLS---WEDCPIVGSCQDITKSYLRLTCAPDPTTVRPVQVLRKSLLSVKAHW-KTHQDYAYACEQMKSIRQDLTVQGVRTEFTVEVYECHARIALEKGDHEEFNQCQTQLKALYKDNPS-ENIGEFTAYRLLYYIFTKNFGDLTTELVYLTPALRADVCVAFALALRAAWALGNYRRFFKLYL--EAPRMASYLIDKFVDRERKIALWAIVKTFRPDLPVQYVQTALGFTCLDSCLAFLNGL 769          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Medaka
Match: leng8 (leukocyte receptor cluster member 8 [Source:NCBI gene;Acc:101162239])

HSP 1 Score: 224.942 bits (572), Expect = 4.800e-61
Identity = 129/276 (46.74%), Postives = 180/276 (65.22%), Query Frame = 3
Query: 2349 KLANRASRFKDHLLKS--AVANESFDVVDRGPIDELSTETWGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSI 3170
            K  +RA+RF   L      ++  + D+ D G  + LS   W    +VG+CQD+ K YLRLT AP+P+ VRP+QVL+ SL  VK  W + H DY + CEQ KSIRQDLTVQ +R EFT+ VY+ HA +ALE  DHEEFNQCQ+Q+K LY++  S  N  EFTAYRL+YY+FT++F ++ T L  L    +   C++FAL LRAAW+  N+ RFF+L    + P++ S +ID F+DRERK A  +I+K +RP   + ++   LGF   D C+ F++ +
Sbjct:  502 KKQSRAARFHKQLRSEPLVLSINTLDLPD-GTQEGLS---WEDCPIVGSCQDITKSYLRLTCAPDPTTVRPVQVLRKSLLSVKAHW-KTHQDYAYACEQMKSIRQDLTVQGVRTEFTVEVYECHARIALEKGDHEEFNQCQTQLKALYKDNPS-ENIGEFTAYRLLYYIFTKNFGDLTTELVYLTPALRADVCVAFALALRAAWALGNYRRFFKLYL--EAPRMASYLIDKFVDRERKIALWAIVKTFRPDLPVQYVQTALGFTCLDSCLAFLNGL 769          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Medaka
Match: mcm3ap (minichromosome maintenance complex component 3 associated protein [Source:NCBI gene;Acc:101157016])

HSP 1 Score: 65.4698 bits (158), Expect = 3.892e-10
Identity = 73/297 (24.58%), Postives = 123/297 (41.41%), Query Frame = 3
Query: 2472 LKVVGTCQDL---EKKYLRLTR--------------------------------APEPSEVRPIQVLKNSLEH----VKKLWYEDHID-YRHICEQFKSIRQDLTVQ--CIREEFTL--NVYKLHATVALE-ANDH----------EEFNQCQSQIKLLYEEGIS----CPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHH---KQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSI-----IKAYRPTCEISFLSNMLGFPNQDECMKFI 3161
            L  VGTC D+   +++Y+R TR                                 P P E+RP+ VLK ++++    +  L  +++ D Y  +  + +SIR+D+T Q  C  +  +L     + H   A     +H          E   +C   +K +YE+  +    CP+  EF  Y ++        LN G  L S+Q+     +  P L FA+Q  AA ++NNF RFF+L         C  ++  + ++ R  A K +     +        +  ++ ML FPN  E   F+
Sbjct:  615 LAFVGTCPDMCPEKERYMRETRNQLSVFEVIPNTEMVNHTAAIKEYSRSSADQEEPLPHELRPLPVLKMTMDYLVTQIMDLGQDNYRDWYDFVWNRTRSIRKDITQQRLCCPQTVSLIEKCTRFHVHCAHHLCEEHMSSFDPKINTENMTKCLQSLKEMYEDLAAHQTFCPSEAEFRQYSVLLK------LNDGDILRSVQQFRDEVRNSPELKFAVQAFAAVNSNNFVRFFKLVKGASYLAGC--LLHRYFNQVRAKALKVLNMALTVGPRSTPLPVEDVARMLMFPNSAEATDFV 903          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Planmine SMEST
Match: SMESG000075783.1 (SMESG000075783.1)

HSP 1 Score: 730.709 bits (1885), Expect = 0.000e+0
Identity = 395/397 (99.50%), Postives = 395/397 (99.50%), Query Frame = 3
Query: 2088 GFESERIVKQQVPSANLGGVLXXXXXXXXXXXXXXXXXXXXXXLRFENSFVDXXXXXXXXXXXXXXXXXXXXXXGIEKFTNENYTTEKLANRASRFKDHLLKSAVANESFDVVDRGPIDELSTETWGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSILPTTDNYTPSISDIYLNGDITSDKLDMKSCANTFQL 3278
             FESERIVKQQVPSANLGGVLNITVGNKKGKNKKRIVNKKNNKLRFENSFVDNFNNNEKFNNGNNNNFNANKKFGIEKFTNENYTTEKLANRASRFKDHLLKSAVANESFDVVDRGPIDELSTETWGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSD VPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSILPTTDNYTPSISDIYLNGDITSDKLDMKSCANTFQL
Sbjct:  394 SFESERIVKQQVPSANLGGVLNITVGNKKGKNKKRIVNKKNNKLRFENSFVDNFNNNEKFNNGNNNNFNANKKFGIEKFTNENYTTEKLANRASRFKDHLLKSAVANESFDVVDRGPIDELSTETWGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDNVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSILPTTDNYTPSISDIYLNGDITSDKLDMKSCANTFQL 790          

HSP 2 Score: 77.0258 bits (188), Expect = 4.945e-29
Identity = 39/40 (97.50%), Postives = 39/40 (97.50%), Query Frame = 1
Query:  400 NTVSPALPTVEDTEVKPNINSTEVTTISNENTTVEINNEG 519
            NTVSPALPTVEDTEVKPNINSTEVTTISNENTTVEINNE 
Sbjct:  131 NTVSPALPTVEDTEVKPNINSTEVTTISNENTTVEINNEA 170          

HSP 3 Score: 71.633 bits (174), Expect = 4.945e-29
Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = 2
Query:  611 KISGLILMEINIRQNKHSNLLKRHQQPVFKIL 706
            KISGLILMEINIRQNKHSNLLKRHQQPVFKIL
Sbjct:  179 KISGLILMEINIRQNKHSNLLKRHQQPVFKIL 210          

HSP 4 Score: 102.449 bits (254), Expect = 8.478e-22
Identity = 67/72 (93.06%), Postives = 69/72 (95.83%), Query Frame = 3
Query: 1893 SYVQRSFNSVXXXXXXXXXXXXXXXXXSAYSKDMVNKIDWHKEPLPKIPQSPSNATKNQSSKKTYGFESERI 2108
            SYVQRSFNSVDEEDKDKMQDLLKDKLESAYSKDMVNKIDWHKEPLPKIPQSPSNATKNQSSKKTYG +  R+
Sbjct:  211 SYVQRSFNSVDEEDKDKMQDLLKDKLESAYSKDMVNKIDWHKEPLPKIPQSPSNATKNQSSKKTYGLQKARV 282          

HSP 5 Score: 93.2041 bits (230), Expect = 5.482e-19
Identity = 43/43 (100.00%), Postives = 43/43 (100.00%), Query Frame = 2
Query:   59 MDNASTKPYYDYNYYTQLGYYPPKPSDIKPSETNKDPRLSTQE 187
            MDNASTKPYYDYNYYTQLGYYPPKPSDIKPSETNKDPRLSTQE
Sbjct:    1 MDNASTKPYYDYNYYTQLGYYPPKPSDIKPSETNKDPRLSTQE 43          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Planmine SMEST
Match: SMESG000080104.1 (SMESG000080104.1)

HSP 1 Score: 654.825 bits (1688), Expect = 0.000e+0
Identity = 370/397 (93.20%), Postives = 370/397 (93.20%), Query Frame = 3
Query: 2088 GFESERIVKQQVPSANLGGVLXXXXXXXXXXXXXXXXXXXXXXLRFENSFVDXXXXXXXXXXXXXXXXXXXXXXGIEKFTNENYTTEKLANRASRFKDHLLKSAVANESFDVVDRGPIDELSTETWGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLACSDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSILPTTDNYTPSISDIYLNGDITSDKLDMKSCANTFQL 3278
             FESERIVKQQVPSANLGGVLNITVGNKKGKNKKRIVNKKNNKLRFENSFVDNFNNNEKFNNGNNNNFNANKKFGIEKFTNENYTTEKLANRASRFKDHLLKSAVANESFDVVDRGPIDELSTETWGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNI                         AWSTNNFCRFFRLACSD VPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSILPTTDNYTPSISDIYLNGDITSDKLDMKSCANTFQL
Sbjct:   34 SFESERIVKQQVPSANLGGVLNITVGNKKGKNKKRIVNKKNNKLRFENSFVDNFNNNEKFNNGNNNNFNANKKFGIEKFTNENYTTEKLANRASRFKDHLLKSAVANESFDVVDRGPIDELSTETWGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNI-------------------------AWSTNNFCRFFRLACSDNVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQDECMKFISSILPTTDNYTPSISDIYLNGDITSDKLDMKSCANTFQL 405          
BLAST of Leukocyte receptor cluster member 8-like protein vs. Planmine SMEST
Match: SMESG000080104.1 (SMESG000080104.1)

HSP 1 Score: 494.967 bits (1273), Expect = 4.718e-162
Identity = 289/301 (96.01%), Postives = 290/301 (96.35%), Query Frame = 3
Query: 2043 SPSNATKNQSSKKTYGFESERIVKQQVPSANLGGVLXXXXXXXXXXXXXXXXXXXXXXLRFENSFVDXXXXXXXXXXXXXXXXXXXXXXGIEKFTNENYTTEKLANRASRFKDHLLKSAVANESFDVVDRGPIDELSTETWGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLR 2945
            S S+    Q S     FESERIVKQQVPSANLGGVLNITVGNKKGKNKKRIVNKKNNKLRFENSFVDNFNNNEKFNNGNNNNFNANKKFGIEKFTNENYTTEKLANRASRFKDHLLKSAVANESFDVVDRGPIDELSTETWGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLR
Sbjct:  320 SESDHKSEQFSDVDKSFESERIVKQQVPSANLGGVLNITVGNKKGKNKKRIVNKKNNKLRFENSFVDNFNNNEKFNNGNNNNFNANKKFGIEKFTNENYTTEKLANRASRFKDHLLKSAVANESFDVVDRGPIDELSTETWGTLKVVGTCQDLEKKYLRLTRAPEPSEVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFTLNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIYYMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLR 620          

HSP 2 Score: 78.1814 bits (191), Expect = 4.941e-28
Identity = 93/103 (90.29%), Postives = 96/103 (93.20%), Query Frame = 1
Query:  211 FYKWCCVGE*HTSNYSTXXXXXXXXXXXXXXXXXXXXXXXXSQTXXXXXXXXXXXXXXXXXXXNTVSPALPTVEDTEVKPNINSTEVTTISNENTTVEINNEG 519
            +Y +    + HTSNYSTNYLYYPGYYDYYQYYNYYNTAGNYSQTPPNPPVPPVQPPLPDAAPVNTVSPALPTVEDTEVKPNINSTEVTTISNENTTVEINNE 
Sbjct:    9 YYDYNYYTQLHTSNYSTNYLYYPGYYDYYQYYNYYNTAGNYSQTPPNPPVPPVQPPLPDAAPVNTVSPALPTVEDTEVKPNINSTEVTTISNENTTVEINNEA 111          

HSP 3 Score: 67.0106 bits (162), Expect = 4.941e-28
Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = 2
Query:  611 KISGLILMEINIRQNKHSNLLKRHQQPVFKIL 706
            KISGLILMEINIRQNKHSNLLKRHQQPVFKIL
Sbjct:  120 KISGLILMEINIRQNKHSNLLKRHQQPVFKIL 151          

HSP 4 Score: 102.834 bits (255), Expect = 3.709e-22
Identity = 67/72 (93.06%), Postives = 69/72 (95.83%), Query Frame = 3
Query: 1893 SYVQRSFNSVXXXXXXXXXXXXXXXXXSAYSKDMVNKIDWHKEPLPKIPQSPSNATKNQSSKKTYGFESERI 2108
            SYVQRSFNSVDEEDKDKMQDLLKDKLESAYSKDMVNKIDWHKEPLPKIPQSPSNATKNQSSKKTYG +  R+
Sbjct:  152 SYVQRSFNSVDEEDKDKMQDLLKDKLESAYSKDMVNKIDWHKEPLPKIPQSPSNATKNQSSKKTYGLQKARV 223          

HSP 5 Score: 59.3066 bits (142), Expect = 1.412e-8
Identity = 26/27 (96.30%), Postives = 26/27 (96.30%), Query Frame = 1
Query: 2947 QLGRQIISVDFFDWPARIKFQSCVAKL 3027
            QLGRQIISVDFFDWPARI FQSCVAKL
Sbjct:  621 QLGRQIISVDFFDWPARIMFQSCVAKL 647          
The following BLAST results are available for this feature:
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LENG82.650e-6751.69leukocyte receptor cluster member 8 [Source:HGNC S... [more]
LENG82.650e-6751.69leukocyte receptor cluster member 8 [Source:HGNC S... [more]
LENG82.650e-6751.69leukocyte receptor cluster member 8 [Source:HGNC S... [more]
LENG82.650e-6751.69leukocyte receptor cluster member 8 [Source:HGNC S... [more]
LENG88.405e-6255.29leukocyte receptor cluster member 8 [Source:HGNC S... [more]
back to top
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hpo-108.904e-5747.22pep chromosome:WBcel235:III:5879845:5882428:1 gene... [more]
hpo-108.904e-5747.22pep chromosome:WBcel235:III:5879826:5882428:1 gene... [more]
hpo-109.599e-5747.22pep chromosome:WBcel235:III:5879506:5882428:1 gene... [more]
F20D12.25.553e-628.17pep chromosome:WBcel235:IV:7948643:7953548:1 gene:... [more]
F20D12.25.553e-628.17pep chromosome:WBcel235:IV:7948674:7953548:1 gene:... [more]
back to top
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG67001.790e-7149.36gene:FBgn0032305 transcript:FBtr0301710[more]
CG67001.790e-7149.36gene:FBgn0032305 transcript:FBtr0080187[more]
xmas3.176e-726.49gene:FBgn0286809 transcript:FBtr0474622[more]
xmas3.872e-726.49gene:FBgn0286809 transcript:FBtr0474624[more]
back to top
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
leng84.242e-6946.21leukocyte receptor cluster (LRC) member 8 [Source:... [more]
leng84.283e-6946.21leukocyte receptor cluster (LRC) member 8 [Source:... [more]
mcm3ap5.921e-924.07minichromosome maintenance complex component 3 ass... [more]
mcm3ap6.592e-924.07minichromosome maintenance complex component 3 ass... [more]
back to top
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000020751.18.893e-6846.38leukocyte receptor cluster member 8 homolog [Sourc... [more]
ENSXETT00000034484.11.823e-6746.69leukocyte receptor cluster member 8 homolog [Sourc... [more]
ENSXETT00000020760.11.931e-6746.69leukocyte receptor cluster member 8 homolog [Sourc... [more]
ENSXETT00000023529.17.695e-6545.29leukocyte receptor cluster (LRC) member 8 [Source:... [more]
ENSXETT00000036604.12.038e-6445.29leukocyte receptor cluster (LRC) member 8 [Source:... [more]
back to top
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Leng81.967e-6352.54leukocyte receptor cluster (LRC) member 8 [Source:... [more]
Leng87.203e-5856.25leukocyte receptor cluster (LRC) member 8 [Source:... [more]
Mcm3ap1.651e-922.90minichromosome maintenance complex component 3 ass... [more]
back to top
BLAST of Leukocyte receptor cluster member 8-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A4QNR8|LENG8_DANRE3.233e-6846.21Leukocyte receptor cluster member 8 homolog OS=Dan... [more]
sp|Q96PV6|LENG8_HUMAN1.273e-6651.69Leukocyte receptor cluster member 8 OS=Homo sapien... [more]
sp|Q32NW2|LENG8_XENLA1.636e-6550.00Leukocyte receptor cluster member 8 homolog OS=Xen... [more]
sp|Q8CBY3|LENG8_MOUSE5.038e-5756.25Leukocyte receptor cluster member 8 homolog OS=Mus... [more]
sp|Q1MTP1|THP3_SCHPO1.215e-5041.91THP3 homolog C2A9.11c OS=Schizosaccharomyces pombe... [more]
back to top
BLAST of Leukocyte receptor cluster member 8-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A095BT361.278e-8150.35Leukocyte receptor cluster member 8-like protein (... [more]
A0A4V3SGR76.035e-8049.65Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2MAA83.408e-7949.65Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4Z2DTU63.156e-7850.35Leukocyte receptor cluster member 8 isoform 1 OS=S... [more]
A0A210QYA14.811e-7747.12Leukocyte receptor cluster member 8-like OS=Mizuho... [more]
back to top
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000034136.11.688e-6145.64leukocyte receptor cluster member 8 [Source:NCBI g... [more]
mcm3ap2.752e-822.95minichromosome maintenance complex component 3 ass... [more]
back to top
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000007904.11.811e-622.30pep scaffold:Pmarinus_7.0:GL480340:6186:21414:1 ge... [more]
back to top
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
THP38.781e-3031.12Protein that may have a role in transcription elon... [more]
back to top
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO482841.301e-6345.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315333.407e-923.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Leukocyte receptor cluster member 8-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
leng84.800e-6146.74leukocyte receptor cluster member 8 [Source:NCBI g... [more]
leng84.800e-6146.74leukocyte receptor cluster member 8 [Source:NCBI g... [more]
mcm3ap3.892e-1024.58minichromosome maintenance complex component 3 ass... [more]
back to top
BLAST of Leukocyte receptor cluster member 8-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000075783.14.945e-2999.50SMESG000075783.1[more]
SMESG000080104.10.000e+093.20SMESG000080104.1[more]
SMESG000080104.14.718e-16296.01SMESG000080104.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019682 ID=SMED30019682|Name=Leukocyte receptor cluster member 8-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3324bp
AATAAACATAGTTTATTTACATAACTGCTGTAAATAAATTTTTCAACATA
TAAAGAATATGGATAATGCATCAACAAAACCATACTATGATTACAATTAT
TATACTCAATTGGGCTATTATCCACCAAAGCCATCAGATATAAAGCCTAG
TGAAACGAACAAAGATCCTAGGTTAAGCACTCAAGAAACAAGTCTAAGCA
ATACTTCCAATTCTACAAATGGTGTTGTGTCGGTGAATAGCACACAAGCA
ACTACTCAACCAACTACTTATATTATCCCGGATATTACGATTACTATCAA
TATTATAATTACTACAACACAGCGGGAAACTATTCACAAACCCCCCCAAA
CCCACCGGTTCCACCAGTTCAACCTCCTTTACCTGATGCTGCTCCAGTAA
ATACTGTTTCACCAGCATTACCAACCGTTGAGGACACAGAAGTAAAACCT
AATATAAATTCAACTGAAGTAACTACCATTTCCAATGAAAATACAACTGT
AGAAATAAATAATGAAGGTGCGGTTAATAAACCTCTTCATCAATCATATC
CTCAAGTATATTATCCTCCTCCTATTAATTATAGCGTTCCACCACCTTGG
TTTGCTACACAAAATTTCTGGGCTAATTCTTATGGAAATCAATATAAGGC
AGAACAAACACAGCAACCTGCTCAAACGGCATCAGCAACCAGTATTCAAA
ATATTGTAAAACCGAAAGCTAACTCTAGGCCGTCTAGATTCCAAACCCAG
CCTGTGACAAAAAATGATAAACCAAAACCGAATTCGGTAGGCCTTAAAGA
CGAAAAGGTTGAAACAGCTAAAACGCCTGTATGGCCAGACGCATTGAAGT
AGTTGTGTTTTTATTATTCTTTTATTCTTTATAATTGTCTTGAATTTTAA
ATTTCAGGTTAGAAATACTAAATATTAGATGAAATAGAAAAATCATTTGG
CCTATATTAAATTAAATCTAGATTATATTAATTAATCTAACTTAATTAAT
AATTTCCAGTATAATTACTTTCTAAACAATATTAAAAGTCATTTTTAGCT
ATAAATTCGAAGTGCTTGGTTATGTGATTGGATGAATTCGGATGTTCCTT
TTTATGATATTTTAGCGTCAAATCAATATTTACGATAAAAAAATTCATAG
ATTAATTTATAAATAATCCAGTATTTATTCCTGATCTGTCTTAGTAGTGA
GAATTCAAAACAAGTATTGCAAAATCAATATAATGTATATAATATTTCTG
GACTCTCGTCATTACATATAATGTATCACAGATTGTCATTTTCAAAATGC
ATAAAACAACTTTCAAATTACGATTAGTTTGGAGTATTAAGCGCTTTCTA
GAAACTTTTGTGATATCGATAAATTTGTAAAAAGTTCTAATTATAAAAGG
AATTACAATCAAGTCCTCTGTAAAACTATTTGTGGAAAATCAAAAAAATT
TGTGCAGTGTGATAAAAGTTTAGATACATTGTTAATTTTCAGGTCAGAAT
CCGAAGACAAAGTTCAGGCTCAACTTTTTGAACTATCAATACATTAGTTA
AGGCAATATTTTGCAAGACGTAGTAATATTGAATTCGAGTACTTTGCATT
TTAAGATTGCCAATTTTAAACTATCTCCGTGCTATATATCGACTTAGTTA
TTTATCACTTCATTTAAATTTAAACTAAACCGATCTACATTCTAATCTAA
AAAATAAGTTTATTGGAAACAATAACTAAACGTATGCTAAATGTTAACGT
AAACATAGTTAATTGTAGAATTTTAATTATATATGGAAATGATTTTTGTT
TTAGATTAAAATAGCAGTTTAATTGCTCTAAAAAGCGGTCCACATAATTC
ATTTGATTACAAATGTATTGTTTGATATGAATACTTTTTAGAAGTTACGT
ACAGCGTTCATTTAATAGTGTTGATGAAGAGGATAAAGATAAAATGCAAG
ATTTATTAAAGGATAAATTAGAATCCGCATATAGTAAAGACATGGTAAAT
AAAATTGACTGGCATAAGGAGCCACTTCCTAAAATCCCCCAGTCACCATC
CAATGCAACTAAAAATCAAAGTTCTAAGAAAACCTATGGTTTCGAATCAG
AAAGAATAGTCAAACAGCAAGTTCCATCGGCCAATTTGGGTGGAGTTTTG
AATATTACAGTGGGTAATAAAAAAGGTAAAAATAAAAAGAGAATTGTTAA
TAAGAAAAATAATAAATTGCGATTCGAAAATTCATTTGTTGACAATTTTA
ATAACAATGAAAAATTCAATAACGGTAATAATAATAATTTTAATGCCAAT
AAAAAATTTGGTATTGAAAAATTCACCAATGAAAATTACACGACTGAAAA
ATTGGCTAATCGTGCCAGTAGGTTCAAAGATCATTTATTAAAAAGCGCAG
TTGCCAATGAATCGTTCGACGTGGTTGACAGAGGTCCAATTGATGAATTA
AGTACCGAAACGTGGGGAACATTGAAAGTTGTCGGAACTTGTCAAGACTT
AGAGAAAAAATATTTACGACTAACAAGGGCGCCTGAACCGTCGGAAGTCC
GTCCGATTCAAGTGTTAAAAAATTCACTGGAACACGTAAAGAAATTGTGG
TACGAAGACCACATCGATTACCGGCACATATGTGAGCAATTTAAAAGTAT
TAGGCAAGACTTAACGGTGCAGTGCATTCGGGAAGAGTTTACCTTAAACG
TTTATAAACTTCACGCCACGGTTGCCCTGGAAGCCAATGACCACGAAGAA
TTTAATCAATGTCAGAGCCAGATAAAGCTATTGTACGAAGAAGGAATCTC
CTGTCCGAATTATTTGGAATTTACCGCATATCGATTAATTTACTACATGT
TCACTAGAGATTTCCTGAATATCGGTACGACATTAGCATCGCTACAAGAG
CACCATAAGCAACATCCTTGTCTTTCTTTTGCGTTACAATTGCGAGCAGC
TTGGTCGACAAATAATTTCTGTCGATTTTTTCGATTGGCCTGCTCGGATA
AAGTTCCAAAGTTGTGTAGCAAAATTATAGATTGGTTTCTCGATAGAGAA
CGTAAGGCAGCATTTAAATCGATAATTAAAGCGTACCGACCCACTTGTGA
AATATCGTTTTTATCTAACATGCTCGGGTTTCCTAATCAGGACGAATGTA
TGAAGTTTATTTCCAGCATCCTCCCGACCACTGACAATTACACCCCATCA
ATATCCGACATCTATCTCAATGGGGATATTACCAGTGATAAATTAGATAT
GAAATCTTGTGCCAATACTTTTCAATTATAATTCCTTGATTATATATATA
TATATATAAATATAGGAGATCCTG
back to top

protein sequence of SMED30019682-orf-1

>SMED30019682-orf-1 ID=SMED30019682-orf-1|Name=SMED30019682-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=114bp
MDNASTKPYYDYNYYTQLGYYPPKPSDIKPSETNKDPRLSTQETSLSNTS
NSTNGVVSVNSTQATTQPTTYIIPDITITINIIITTTQRETIHKPPQTHR
FHQFNLLYLMLLQ*
back to top

protein sequence of SMED30019682-orf-2

>SMED30019682-orf-2 ID=SMED30019682-orf-2|Name=SMED30019682-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=446bp
MQDLLKDKLESAYSKDMVNKIDWHKEPLPKIPQSPSNATKNQSSKKTYGF
ESERIVKQQVPSANLGGVLNITVGNKKGKNKKRIVNKKNNKLRFENSFVD
NFNNNEKFNNGNNNNFNANKKFGIEKFTNENYTTEKLANRASRFKDHLLK
SAVANESFDVVDRGPIDELSTETWGTLKVVGTCQDLEKKYLRLTRAPEPS
EVRPIQVLKNSLEHVKKLWYEDHIDYRHICEQFKSIRQDLTVQCIREEFT
LNVYKLHATVALEANDHEEFNQCQSQIKLLYEEGISCPNYLEFTAYRLIY
YMFTRDFLNIGTTLASLQEHHKQHPCLSFALQLRAAWSTNNFCRFFRLAC
SDKVPKLCSKIIDWFLDRERKAAFKSIIKAYRPTCEISFLSNMLGFPNQD
ECMKFISSILPTTDNYTPSISDIYLNGDITSDKLDMKSCANTFQL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000463cholinergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR005062SAC3/GANP/THP3
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process