mmp2 protein

Overview
Namemmp2 protein (CCC86589.1)
Smed IDSMED30019680
Length (bp)1562
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of mmp2 protein (SMED30019680) t-SNE clustered cells

Violin plots show distribution of expression levels for mmp2 protein (SMED30019680) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of mmp2 protein (SMED30019680) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for mmp2 protein (SMED30019680) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019680

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30019680SMESG000014326.1 dd_Smed_v4_321_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30019680SMESG000014326.1 dd_Smed_v6_321_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30019680SMESG000014326.1 OX_Smed_1.0.22204ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
dorsal region of the whole animalSMED30019680SMESG000014326.1 HE577119.1smed_ncbi_20200123PMID:23405188
Isolani et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
ventral region of the whole animalSMED30019680SMESG000014326.1 HE577119.1smed_ncbi_20200123PMID:23405188
Isolani et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30019680SMESG000014326.1 HE577119.1smed_ncbi_20200123PMID:23405188
Isolani et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
basophilic gland cellSMED30019680SMESG000014326.1 HE577119.1smed_ncbi_20200123PMID:23405188
Isolani et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of mmp2 protein vs. Ensembl Human
Match: MMP7 (matrix metallopeptidase 7 [Source:HGNC Symbol;Acc:HGNC:7174])

HSP 1 Score: 128.257 bits (321), Expect = 5.661e-33
Identity = 88/257 (34.24%), Postives = 124/257 (48.25%), Query Frame = 2
Query:   71 KSVEKFLSNFYDYNEKS---DKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKW-DKGQTYRF--YIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSG---NLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKR 814
            +  + +L  FY Y+ ++   + L   +K +QK  GLP  G +   ++  ++K RCG  D  + S   N+   KW  K  TYR   Y  D  H T      + R +  ALN W     ++F KV      +  + FA   H             D YP D  PGN LAHAF P +G   + HFD  E WT+G   GIN    A HE+GH++G+ HS+DP A+M P YG      +F+L  DD +G   LYG   N ++
Sbjct:   33 EQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSP--KWTSKVVTYRIVSYTRDLPHIT------VDRLVSKALNMWGKEIPLHFRKVVWGTADIM-IGFARGAHG------------DSYPFDG-PGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNG-DPQNFKLSQDDIKGIQKLYGKRSNSRK 266          
BLAST of mmp2 protein vs. Ensembl Human
Match: MMP20 (matrix metallopeptidase 20 [Source:HGNC Symbol;Acc:HGNC:7167])

HSP 1 Score: 131.339 bits (329), Expect = 1.778e-32
Identity = 86/232 (37.07%), Postives = 122/232 (52.59%), Query Frame = 2
Query:  119 SDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQ-TYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSG---NLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTK 802
            S+ +   +K +Q   GL   GK+ +  +  ++K RCG  D    + R    + KW K   TYR      ++  +MS  E+ +A+ +AL  WS+A  + F +++S +  +  +SF + +H             D YP D  P   LAHAF P  G   + HFD+AE+WT G + G NL  VAAHE GHA+GL HS DP ALM P Y  Y +   F LP DD +G  +LYG  K
Sbjct:   65 SNSMIRKIKELQAFFGLQVTGKLDQTTMNVIKKPRCGVPDVA--NYRLFPGEPKWKKNTLTYRI----SKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIM-ISFENGDHG------------DSYPFDG-PRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTN-GFNLFTVAAHEFGHALGLAHSTDPSALMYPTY-KYKNPYGFHLPKDDVKGIQALYGPRK 274          
BLAST of mmp2 protein vs. Ensembl Human
Match: MMP25 (matrix metallopeptidase 25 [Source:HGNC Symbol;Acc:HGNC:14246])

HSP 1 Score: 125.561 bits (314), Expect = 4.175e-30
Identity = 84/246 (34.15%), Postives = 121/246 (49.19%), Query Frame = 2
Query:  113 EKSDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDS------KKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSM--FSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPK----SGNLHFDSAEEWTEGKDDG--INLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESD-FRLPDDDSQGAISLYGNTKN 805
            +  +KL DA+K +Q+ AGLP  G++    +A + K RC   D        ++ +RY  + S W K +T  + +      + +S   ++  +  AL  W   + + F +V S QG      + FA A H+            D YP D + G  LAHAFFP     SG+ HFD  E WT G  DG   +L  VA HE GHA+GL HS+ P ++M P+Y G + + D +RL  DD  G   LYG    
Sbjct:   53 QSPEKLRDAIKVMQRFAGLPETGRMDPGTVATMRKPRCSLPDVLGVAGLVRRRRRYALSGSVWKK-RTLTWRVRSFPQSSQLSQETVRVLMSYALMAWGMESGLTFHEVDSPQGQEPDILIDFARAFHQ------------DSYPFDGL-GGTLAHAFFPGEHPISGDTHFDDEETWTFGSKDGEGTDLFAVAVHEFGHALGLGHSSAPNSIMRPFYQGPVGDPDKYRLSQDDRDGLQQLYGKAPQ 284          
BLAST of mmp2 protein vs. Ensembl Human
Match: MMP3 (matrix metallopeptidase 3 [Source:HGNC Symbol;Acc:HGNC:7173])

HSP 1 Score: 120.939 bits (302), Expect = 6.825e-29
Identity = 104/384 (27.08%), Postives = 163/384 (42.45%), Query Frame = 2
Query:    5 LIFLVLLSASYFQVEAFESSDEKS---VEKFLSNFYDYNEK---------SDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQ-TYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSG---NLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTTNINSAFQFADGHVYVVTGNN---KVFRILLKNHSLIVD--PAFKT-IQLSNQIFDSDALLYDYSGRRFVVFKGNKI 1090
            L+ L +   S + ++     ++ S   V+K+L N+YD  +          S  +   ++ +QK  GL   GK+  + L  + K RCG  D      R      KW K   TYR   +    P       +++AL +    W     + F ++   +  +  +SFA  EH             D YP D  PGNVLAHA+ P  G   + HFD  E+WT+    G NL +VAAHE+GH++GL+HS + +ALM P Y      + FRL  DD  G  SLYG   +                     C+      A     G + +    +   K  R L     LI    P+  + +  + ++   D L++ + G +F   +GN++
Sbjct:    7 LLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPVVKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHF--RTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKV----WEEVTPLTFSRLYEGEADIM-ISFAVREHG------------DFYPFDG-PGNVLAHAYAPGPGINGDAHFDDDEQWTKDTT-GTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKD-LVFIFKGNQFWAIRGNEV 368          
BLAST of mmp2 protein vs. Ensembl Human
Match: MMP8 (matrix metallopeptidase 8 [Source:HGNC Symbol;Acc:HGNC:7175])

HSP 1 Score: 119.398 bits (298), Expect = 1.867e-28
Identity = 110/400 (27.50%), Postives = 178/400 (44.50%), Query Frame = 2
Query:   71 KSVEKFLSNFYDYNEK---------SDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQ-TYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSG---NLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTTNINSAFQFADGHVYVVTGNNKVFRILLKNHSLIVDPAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANGLELENMALSELNITRFGAFQGRVNAA-FVRDKAGKSNTLKFW 1228
            K+V+ +L  FY              ++ + + +K +Q+  GL   GK  +E L  ++K RCG  DS            KW++   TYR       +   +S  E++RA+  A   WS A+ + F ++S  +  + +++F   +H             D  P D  P  +LAHAF P  G   + HFD+ E WT    +  NL +VAAHE GH++GL HS+DP ALM P Y  +   S++ LP DD  G  ++YG + N  +       K    S   +   T      F F D   Y    + ++ R+ +   SL        IQ + + FD D +          +FKGN+ ++ +G ++      +++   F +    ++AA F R K       +FW
Sbjct:   31 KTVQDYLEKFYQLPSNQYQSTRKNGTNVIVEKLKEMQRFFGLNVTGKPNEETLDMMKKPRCGVPDSG--GFMLTPGNPKWERTNLTYRI----RNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADI-NIAFYQRDHG------------DNSPFDG-PNGILAHAFQPGQGIGGDAHFDAEETWTNTSAN-YNLFLVAAHEFGHSLGLAHSSDPGALMYPNY-AFRETSNYSLPQDDIDGIQAIYGLSSNPIQPTGPSTPKPCDPSLTFDAITTLRGEILF-FKD--RYFWRRHPQLQRVEMNFISLFWPSLPTGIQAAYEDFDRDLIF---------LFKGNQYWALSGYDILQGYPKDISNYGFPSSVQAIDAAVFYRSKTYFFVNDQFW 396          
BLAST of mmp2 protein vs. Ensembl Celegans
Match: zmp-5 (Zinc MetalloProtease [Source:UniProtKB/TrEMBL;Acc:O17913])

HSP 1 Score: 97.4413 bits (241), Expect = 1.011e-21
Identity = 72/237 (30.38%), Postives = 110/237 (46.41%), Query Frame = 2
Query:  236 DSKKKSKRYNAAQSKWDKGQ-TYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKV--SSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPK-SGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTTNINSAFQFADGHVYVVTG 934
            +SK + KRY+   S W K   TYR     +R    MSL + +     A   W     ++F  V    +Q +   + FA  +H+            D  P D   GN+LAHAFFP+  G++HFD  E W+  K  G++L  VA HE+GH++GL HS++  ++MAP+Y  Y + +   L  DD      LYG        V+  +   E    + ELC    +++     +G +    G
Sbjct:   24 ESKSRVKRYSIEGSYWGKSVITYRLKQPSQR----MSLSQQKAVFARAFATWEEHTRLWFVAVDDEDEQKANIDIVFAAGDHE------------DGEPFDG-KGNILAHAFFPRYGGDVHFDEDELWSANKTKGVDLYAVAVHEIGHSLGLKHSSNHLSIMAPFYKQY-TGAVMHLHQDDISAVKRLYGAP------VKIRKKASEHHIWRSELCTKPYLDAVTTLKNGTILAFRG 236          
BLAST of mmp2 protein vs. Ensembl Celegans
Match: zmp-3 (Matrix metalloproteinase-C [Source:UniProtKB/Swiss-Prot;Acc:G5EBU3])

HSP 1 Score: 94.3597 bits (233), Expect = 3.046e-20
Identity = 64/201 (31.84%), Postives = 91/201 (45.27%), Query Frame = 2
Query:  137 AVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEG------KDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWY 721
            A++  Q+ AG+   G +     A +  SRCG  D+        ++Q KW K    R     E   + +S  +++RA+  A   WS    + F +V +   S   + F    H             DP+P D   G VLAHA  P+SG  HFD  E WT         ++  +L  VA HE GH +GL HS D  A+MAP+Y
Sbjct:   93 AIRKFQEFAGIAKTGFLDAATKAKMALSRCGVTDAPLALTS-GSSQFKWSKT---RLTYSIESWSSDLSKDDVRRAISEAYGLWSKVTPLEFSEVPAGSTSDIKIRFGVRNHN------------DPWPFDG-EGGVLAHATMPESGMFHFDDDENWTYKDARKIHNNEATDLLAVAIHEGGHTLGLEHSRDENAIMAPFY 276          
BLAST of mmp2 protein vs. Ensembl Celegans
Match: zmp-1 (Matrix metalloproteinase-A [Source:UniProtKB/Swiss-Prot;Acc:G5EGM1])

HSP 1 Score: 92.8189 bits (229), Expect = 7.881e-20
Identity = 97/384 (25.26%), Postives = 159/384 (41.41%), Query Frame = 2
Query:  119 SDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKD----SKKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLD-NVPGNVLAHAFFPKSGNLHFD-----SAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYG---------------NTKNGKRFVRSDRAKREQSSNQKELCNTTNINSAFQFADGHVYVVTGNNKVFRILLKNHSLIVDPAFKTIQLSNQIFDSDALLYDYS---GRRFVVFKGNKIFSANGLELENMALSELNITRFGAFQGRVNAAF 1186
            S+ LSDA+KN+Q+MAGL   G++ +  +  +E+ RCG  D     K + KRY   Q KW K +   +        T +SL +++R +  A + WS  AD+   + SS +  M  +S     H               YP         LAHAFFP +G +H +     +   +TE +    +L  V AHEMGHA+G  HS D  ++M      Y +   ++    D     S YG                 ++ +R    DR +  +  +     N   + +         Y++  +  V+R+      LI+    K + + NQ+F       D +   G    VF G  I+   G    +M  + L ++  G  +  V+ A+
Sbjct:   45 SESLSDALKNMQRMAGLEETGELDERTIQMMERPRCGHPDVEDHQKSRGKRYAPPQFKW-KEKIITYGCKAVGTSTRISLDDLRRTMHQAASQWSELADVEIVE-SSVKNPMMVISAGRENH---------------YPCTVRFDTKTLAHAFFPTNGQIHINDRVQFAMTNYTE-RMGANSLYSVVAHEMGHALGFSHSPDIDSVMF----AYDTPRKWKFTSMDKYNMRSYYGAKASKKENEEEERKTENEDKRRKTEKDRGRTREHESDDIRPNECRVENPIVVQYRGEYLIFKSQWVWRVSSDWKRLII----KAVPI-NQLFPGLPNPIDAAVTVGHNLWVFVGEMIYVIYG---NHMVHAPLRLSDIGINEKYVDLAY 398          
BLAST of mmp2 protein vs. Ensembl Celegans
Match: zmp-6 (MMP-like protein; Zinc MetalloProtease [Source:UniProtKB/TrEMBL;Acc:G5ECC4])

HSP 1 Score: 84.7297 bits (208), Expect = 5.407e-18
Identity = 58/186 (31.18%), Postives = 88/186 (47.31%), Query Frame = 2
Query:  248 KSKRYNAAQSKWDKGQ-TYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVS----SKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLY 790
            + KRY     +W K   T++    +   P       ++  +  A N WST + + F ++     +KQ     ++F   EH             D +P D   G V+AHAF+P+ G LHFD+ E+W+    +G+NL   A HE+GH +GL HS D +A M      Y  +  F L DDD +   SL+
Sbjct:   38 REKRYVIRAKRWKKHTLTWQLQTQNLLDPDVFI---VRNTMHRAFNEWSTVSSVDFREIPPDLVTKQPPDIYIAFEKGEHS------------DGFPFDGQDG-VVAHAFYPRDGRLHFDAEEQWSLNSVEGVNLFQTAVHEIGHLLGLEHSMDVRAAMFAAKRPY--DPAFTLGDDDVRAIRSLF 205          
BLAST of mmp2 protein vs. Ensembl Celegans
Match: zmp-2 (Matrix metalloproteinase-B [Source:UniProtKB/Swiss-Prot;Acc:O44836])

HSP 1 Score: 77.7962 bits (190), Expect = 6.107e-15
Identity = 75/245 (30.61%), Postives = 116/245 (47.35%), Query Frame = 2
Query:  152 QKMAGLPTDGKITKELLAHVEKSRCGGKDSK----KKSKRYN-AAQSKWD--KGQ--TYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHK-MYDVHNNFAESR--DPYPLDNVPG--------NVLAHAFFPK-----SGNLHFDSAEEWTEGKDD---GINLRV---VAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYG 793
            Q++  +   G + +  +    K RC   D +    K++KR+  + ++KW    GQ  T ++YI D  + + +   E ++ +  A   WS+ + I       K     +L+F +A  K   D++  +AE    D +  D   G        NVLAH FFP      +G++HFD AE+W    D    G N R    V AHE+GHA+GL HS    ALM P+Y   +  ++ +L  DD  G I  YG
Sbjct:   87 QEVLEVEQTGNVDEMTVEAASKPRCTQTDVRQEQTKRTKRFTLSKRAKWAHASGQSVTLKWYISD--YTSDIDRLETRKVVEKAFKLWSSQSYI-------KNEKKVTLTFQEASSKDEADINILWAEGNHGDEHDFDGANGKIEGNKKENVLAHTFFPGYARPLNGDIHFDDAEDWEIDVDQVGHGSNKRFFPYVLAHEIGHALGLDHSQKADALMHPYYKN-VPINEIQLDIDDKCGVIWNYG 321          
BLAST of mmp2 protein vs. Ensembl Fly
Match: Mmp1 (gene:FBgn0035049 transcript:FBtr0306656)

HSP 1 Score: 124.79 bits (312), Expect = 2.011e-30
Identity = 114/385 (29.61%), Postives = 165/385 (42.86%), Query Frame = 2
Query:  137 AVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKD----SKKKSKRYNAAQSKWD-KGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPK-SGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRF--VRSDRAKREQSSNQKEL----CNTTNINSAFQFADGHVYVVTGNNKVFRILLKNHSLIVD------PAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANGLELENMALSELNITRFGAFQGRVNAAFVRDKAGKSNTL---KFW 1228
            A++  Q  AGL   G++  E +  +   RCG +D       +SKRY    S+W  K  TY+   + +R        EI RA  +    WS   D+ F + +S    +  + F ++EH   D  +               G  LAHAFFP   G+ HFD AE WT G   G NL  VAAHE GH++GL HS+   ALMAP+Y G+  E  F+L +DD     SLYG   N  R   V     +R  S  +  L    C  + +++ F  A G  Y   G+        K + L  D      P   +        + DA  + Y   +   FKG + +   G +++ +   E++   F      ++AA V    GK       KFW
Sbjct:   64 AIEEFQSFAGLNITGELDAETMKLMSLPRCGVRDRVGTGDSRSKRYALQGSRWRVKNLTYKISKYPKRLKRVDVDAEIGRAFAV----WSEDTDLTFTRKTSGPVHI-EIKFVESEHGDGDAFDG-------------QGGTLAHAFFPVFGGDAHFDDAELWTIGSPRGTNLFQVAAHEFGHSLGLSHSDQSSALMAPFYRGF--EPVFKLDEDDKAAIQSLYGRKTNQLRPTNVYPATTQRPYSPPKVPLDDSICKDSKVDTLFNSAQGETYAFKGD--------KYYKLTTDSVEEGYPQLISKGWPGLPGNIDA-AFTYKNGKTYFFKGTQYWRYQGRQMDGVYPKEIS-EGFTGIPDHLDAAMVWGGNGKIYFFKGSKFW 418          
BLAST of mmp2 protein vs. Ensembl Fly
Match: Mmp1 (gene:FBgn0035049 transcript:FBtr0304010)

HSP 1 Score: 124.79 bits (312), Expect = 2.011e-30
Identity = 114/385 (29.61%), Postives = 165/385 (42.86%), Query Frame = 2
Query:  137 AVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKD----SKKKSKRYNAAQSKWD-KGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPK-SGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRF--VRSDRAKREQSSNQKEL----CNTTNINSAFQFADGHVYVVTGNNKVFRILLKNHSLIVD------PAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANGLELENMALSELNITRFGAFQGRVNAAFVRDKAGKSNTL---KFW 1228
            A++  Q  AGL   G++  E +  +   RCG +D       +SKRY    S+W  K  TY+   + +R        EI RA  +    WS   D+ F + +S    +  + F ++EH   D  +               G  LAHAFFP   G+ HFD AE WT G   G NL  VAAHE GH++GL HS+   ALMAP+Y G+  E  F+L +DD     SLYG   N  R   V     +R  S  +  L    C  + +++ F  A G  Y   G+        K + L  D      P   +        + DA  + Y   +   FKG + +   G +++ +   E++   F      ++AA V    GK       KFW
Sbjct:   64 AIEEFQSFAGLNITGELDAETMKLMSLPRCGVRDRVGTGDSRSKRYALQGSRWRVKNLTYKISKYPKRLKRVDVDAEIGRAFAV----WSEDTDLTFTRKTSGPVHI-EIKFVESEHGDGDAFDG-------------QGGTLAHAFFPVFGGDAHFDDAELWTIGSPRGTNLFQVAAHEFGHSLGLSHSDQSSALMAPFYRGF--EPVFKLDEDDKAAIQSLYGRKTNQLRPTNVYPATTQRPYSPPKVPLDDSICKDSKVDTLFNSAQGETYAFKGD--------KYYKLTTDSVEEGYPQLISKGWPGLPGNIDA-AFTYKNGKTYFFKGTQYWRYQGRQMDGVYPKEIS-EGFTGIPDHLDAAMVWGGNGKIYFFKGSKFW 418          
BLAST of mmp2 protein vs. Ensembl Fly
Match: Mmp1 (gene:FBgn0035049 transcript:FBtr0304008)

HSP 1 Score: 125.176 bits (313), Expect = 2.073e-30
Identity = 114/385 (29.61%), Postives = 165/385 (42.86%), Query Frame = 2
Query:  137 AVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKD----SKKKSKRYNAAQSKWD-KGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPK-SGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRF--VRSDRAKREQSSNQKEL----CNTTNINSAFQFADGHVYVVTGNNKVFRILLKNHSLIVD------PAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANGLELENMALSELNITRFGAFQGRVNAAFVRDKAGKSNTL---KFW 1228
            A++  Q  AGL   G++  E +  +   RCG +D       +SKRY    S+W  K  TY+   + +R        EI RA  +    WS   D+ F + +S    +  + F ++EH   D  +               G  LAHAFFP   G+ HFD AE WT G   G NL  VAAHE GH++GL HS+   ALMAP+Y G+  E  F+L +DD     SLYG   N  R   V     +R  S  +  L    C  + +++ F  A G  Y   G+        K + L  D      P   +        + DA  + Y   +   FKG + +   G +++ +   E++   F      ++AA V    GK       KFW
Sbjct:   64 AIEEFQSFAGLNITGELDAETMKLMSLPRCGVRDRVGTGDSRSKRYALQGSRWRVKNLTYKISKYPKRLKRVDVDAEIGRAFAV----WSEDTDLTFTRKTSGPVHI-EIKFVESEHGDGDAFDG-------------QGGTLAHAFFPVFGGDAHFDDAELWTIGSPRGTNLFQVAAHEFGHSLGLSHSDQSSALMAPFYRGF--EPVFKLDEDDKAAIQSLYGRKTNQLRPTNVYPATTQRPYSPPKVPLDDSICKDSKVDTLFNSAQGETYAFKGD--------KYYKLTTDSVEEGYPQLISKGWPGLPGNIDA-AFTYKNGKTYFFKGTQYWRYQGRQMDGVYPKEIS-EGFTGIPDHLDAAMVWGGNGKIYFFKGSKFW 418          
BLAST of mmp2 protein vs. Ensembl Fly
Match: Mmp1 (gene:FBgn0035049 transcript:FBtr0304009)

HSP 1 Score: 124.79 bits (312), Expect = 2.480e-30
Identity = 114/385 (29.61%), Postives = 165/385 (42.86%), Query Frame = 2
Query:  137 AVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKD----SKKKSKRYNAAQSKWD-KGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPK-SGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRF--VRSDRAKREQSSNQKEL----CNTTNINSAFQFADGHVYVVTGNNKVFRILLKNHSLIVD------PAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANGLELENMALSELNITRFGAFQGRVNAAFVRDKAGKSNTL---KFW 1228
            A++  Q  AGL   G++  E +  +   RCG +D       +SKRY    S+W  K  TY+   + +R        EI RA  +    WS   D+ F + +S    +  + F ++EH   D  +               G  LAHAFFP   G+ HFD AE WT G   G NL  VAAHE GH++GL HS+   ALMAP+Y G+  E  F+L +DD     SLYG   N  R   V     +R  S  +  L    C  + +++ F  A G  Y   G+        K + L  D      P   +        + DA  + Y   +   FKG + +   G +++ +   E++   F      ++AA V    GK       KFW
Sbjct:   64 AIEEFQSFAGLNITGELDAETMKLMSLPRCGVRDRVGTGDSRSKRYALQGSRWRVKNLTYKISKYPKRLKRVDVDAEIGRAFAV----WSEDTDLTFTRKTSGPVHI-EIKFVESEHGDGDAFDG-------------QGGTLAHAFFPVFGGDAHFDDAELWTIGSPRGTNLFQVAAHEFGHSLGLSHSDQSSALMAPFYRGF--EPVFKLDEDDKAAIQSLYGRKTNQLRPTNVYPATTQRPYSPPKVPLDDSICKDSKVDTLFNSAQGETYAFKGD--------KYYKLTTDSVEEGYPQLISKGWPGLPGNIDA-AFTYKNGKTYFFKGTQYWRYQGRQMDGVYPKEIS-EGFTGIPDHLDAAMVWGGNGKIYFFKGSKFW 418          
BLAST of mmp2 protein vs. Ensembl Fly
Match: Mmp1 (gene:FBgn0035049 transcript:FBtr0304011)

HSP 1 Score: 124.79 bits (312), Expect = 2.480e-30
Identity = 114/385 (29.61%), Postives = 165/385 (42.86%), Query Frame = 2
Query:  137 AVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKD----SKKKSKRYNAAQSKWD-KGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPK-SGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRF--VRSDRAKREQSSNQKEL----CNTTNINSAFQFADGHVYVVTGNNKVFRILLKNHSLIVD------PAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANGLELENMALSELNITRFGAFQGRVNAAFVRDKAGKSNTL---KFW 1228
            A++  Q  AGL   G++  E +  +   RCG +D       +SKRY    S+W  K  TY+   + +R        EI RA  +    WS   D+ F + +S    +  + F ++EH   D  +               G  LAHAFFP   G+ HFD AE WT G   G NL  VAAHE GH++GL HS+   ALMAP+Y G+  E  F+L +DD     SLYG   N  R   V     +R  S  +  L    C  + +++ F  A G  Y   G+        K + L  D      P   +        + DA  + Y   +   FKG + +   G +++ +   E++   F      ++AA V    GK       KFW
Sbjct:   64 AIEEFQSFAGLNITGELDAETMKLMSLPRCGVRDRVGTGDSRSKRYALQGSRWRVKNLTYKISKYPKRLKRVDVDAEIGRAFAV----WSEDTDLTFTRKTSGPVHI-EIKFVESEHGDGDAFDG-------------QGGTLAHAFFPVFGGDAHFDDAELWTIGSPRGTNLFQVAAHEFGHSLGLSHSDQSSALMAPFYRGF--EPVFKLDEDDKAAIQSLYGRKTNQLRPTNVYPATTQRPYSPPKVPLDDSICKDSKVDTLFNSAQGETYAFKGD--------KYYKLTTDSVEEGYPQLISKGWPGLPGNIDA-AFTYKNGKTYFFKGTQYWRYQGRQMDGVYPKEIS-EGFTGIPDHLDAAMVWGGNGKIYFFKGSKFW 418          
BLAST of mmp2 protein vs. Ensembl Zebrafish
Match: mmp19 (matrix metallopeptidase 19 [Source:ZFIN;Acc:ZDB-GENE-100308-3])

HSP 1 Score: 124.405 bits (311), Expect = 2.956e-30
Identity = 86/223 (38.57%), Postives = 113/223 (50.67%), Query Frame = 2
Query:  137 AVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDS-KKKSKRYNAAQSKW-DKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRD--PYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYG 793
            A+   Q+++GLP  G + +  +  + + RCG +D   +KS +Y      W  K  TYR Y     +   M     Q A+  A  YWS                   LSF +      D+  +F   RD  P P D  PG+VLAHA  P SG +HFD  E WTEGK  G NLR+VAAHE+GHA+GL HS    ALMA  Y GY  + +FRL  DD +G  ++YG
Sbjct:   62 ALSLFQRVSGLPVTGNLDRATVFKMREPRCGVEDPFNQKSFKYRRFGGYWRKKNLTYRIY----NYTPDMGKSATQTAIRTAFKYWSDVT---------------PLSFTEIHFGTADIRISF-HKRDGCPSPFDG-PGHVLAHAEAPPSGIVHFDEDEFWTEGKYYGSNLRIVAAHEIGHALGLGHSQYSSALMAAHYTGY--QVNFRLHIDDIRGIQAIYG 261          
BLAST of mmp2 protein vs. Ensembl Zebrafish
Match: mmp24 (matrix metallopeptidase 24 [Source:ZFIN;Acc:ZDB-GENE-040724-262])

HSP 1 Score: 123.635 bits (309), Expect = 9.501e-30
Identity = 91/264 (34.47%), Postives = 132/264 (50.00%), Query Frame = 2
Query:  128 LSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDS-----KKKSKRYNAAQSKW-DKGQTYRFYIHDERHPTTMSLGE--IQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAES--RDPYPLDNVPGNVLAHAFFPKSG---NLHFDSAEEWTEGK--DDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTK---NGKRFVRSDRAKREQSSNQKE 865
            +  AV  +Q+  G+P  G + +  +  + K RCG  D      ++++KRY     KW DK  TY        H  T  +GE   QRA+  A + W T   + F +V+  +           E K  D+   FA     D  P D   G  LAHA+FP  G   + HFDS E WT G    DG +L +VA HE+GHA+GL HS+DP A+MAP+Y  Y+   +F+LP DD QG   +YG         R + +  A+R  S+++++
Sbjct:    1 MQSAVAAMQRFYGIPVTGILDQTTIEWMRKPRCGVPDHPHISRRRRNKRYALTGQKWRDKKITYSI------HNFTPKVGEKDTQRAIRQAFDVWQTVTPLSFQEVAYSE--------IKNEGKEADIMIFFASGFHGDSSPFDGE-GGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSSDPSAIMAPFY-QYMETHNFKLPLDDLQGIQKIYGIPTAMLEPTRPLPTFPARRPHSTSERK 248          
BLAST of mmp2 protein vs. Ensembl Zebrafish
Match: mmp24 (matrix metallopeptidase 24 [Source:ZFIN;Acc:ZDB-GENE-040724-262])

HSP 1 Score: 124.02 bits (310), Expect = 1.074e-29
Identity = 91/264 (34.47%), Postives = 132/264 (50.00%), Query Frame = 2
Query:  128 LSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDS-----KKKSKRYNAAQSKW-DKGQTYRFYIHDERHPTTMSLGE--IQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAES--RDPYPLDNVPGNVLAHAFFPKSG---NLHFDSAEEWTEGK--DDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTK---NGKRFVRSDRAKREQSSNQKE 865
            +  AV  +Q+  G+P  G + +  +  + K RCG  D      ++++KRY     KW DK  TY        H  T  +GE   QRA+  A + W T   + F +V+  +           E K  D+   FA     D  P D   G  LAHA+FP  G   + HFDS E WT G    DG +L +VA HE+GHA+GL HS+DP A+MAP+Y  Y+   +F+LP DD QG   +YG         R + +  A+R  S+++++
Sbjct:   67 MQSAVAAMQRFYGIPVTGILDQTTIEWMRKPRCGVPDHPHISRRRRNKRYALTGQKWRDKKITYSI------HNFTPKVGEKDTQRAIRQAFDVWQTVTPLSFQEVAYSE--------IKNEGKEADIMIFFASGFHGDSSPFDGE-GGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSSDPSAIMAPFY-QYMETHNFKLPLDDLQGIQKIYGIPTAMLEPTRPLPTFPARRPHSTSERK 314          
BLAST of mmp2 protein vs. Ensembl Zebrafish
Match: mmp20a (matrix metallopeptidase 20a (enamelysin) [Source:ZFIN;Acc:ZDB-GENE-100603-2])

HSP 1 Score: 121.709 bits (304), Expect = 2.258e-29
Identity = 89/285 (31.23%), Postives = 144/285 (50.53%), Query Frame = 2
Query:    5 LIFLVL----LSASYFQVEAFESSDEKSVEKFLSNFYD-----YNEK-SDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQ-TYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSG---NLHFDSAEEWTEGKD-DGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKR 814
            L+F +L    +  S   +++    D +  E++L +FY      YN++ ++++ D ++ +Q    L     +  + L  ++++RCG  D +  S  +   + KW     TYR      R    +   E++ +L +AL  WS AA + F ++   +  + + SF    H             D +P D  PG VLAHAF P  G   ++HFD  E WT G+   G NL  VAAHE+GH++GL HS DP ALM P Y  +I+ + ++LP DD+ G  +LYG ++   R
Sbjct:    9 LLFWMLKMDSVRTSRVALQSCTQEDFQHAEEYLRHFYHLKMRVYNKRRAERMKDKIRAMQHFFDLKETAFLDHKTLNGMKEARCGVPDVENFS--FYPGRPKWKSNIITYRI----ARFTPDLRPEEVENSLHLALKIWSDAAPLKFVQIKEGRADI-TFSFNSKAHG------------DFFPFDG-PGGVLAHAFEPGEGLGGDVHFDDDEIWTVGRGRPGYNLFTVAAHELGHSLGLSHSKDPTALMYPKY-KFINAATYKLPRDDTLGIQALYGESRKKTR 272          
BLAST of mmp2 protein vs. Ensembl Zebrafish
Match: mmp20a (matrix metallopeptidase 20a (enamelysin) [Source:ZFIN;Acc:ZDB-GENE-100603-2])

HSP 1 Score: 120.939 bits (302), Expect = 3.541e-29
Identity = 89/291 (30.58%), Postives = 145/291 (49.83%), Query Frame = 2
Query:    5 LIFLVL----LSASYFQVEAFESSDEKSVEKFLSNFYD-----YNEK-SDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQ-TYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSG---NLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRA 835
            L+F +L    +  S   +++    D +  E++L +FY      YN++ ++++ D ++ +Q    L     +  + L  ++++RCG  D +  S  +   + KW     TYR      R    +   E++ +L +AL  WS AA + F ++   +  + + SF    H             D +P D  PG VLAHAF P  G   ++HFD  E WT G+  G NL  VAAHE+GH++GL HS DP ALM P Y  +I+ + ++LP DD+ G  +LYG     +  V  ++ 
Sbjct:    9 LLFWMLKMDSVRTSRVALQSCTQEDFQHAEEYLRHFYHLKMRVYNKRRAERMKDKIRAMQHFFDLKETAFLDHKTLNGMKEARCGVPDVENFS--FYPGRPKWKSNIITYRI----ARFTPDLRPEEVENSLHLALKIWSDAAPLKFVQIKEGRADI-TFSFNSKAHG------------DFFPFDG-PGGVLAHAFEPGEGLGGDVHFDDDEIWTVGR--GYNLFTVAAHELGHSLGLSHSKDPTALMYPKY-KFINAATYKLPRDDTLGIQALYGKKTRQQELVIPNKC 276          
BLAST of mmp2 protein vs. Ensembl Xenopus
Match: rexo2 (RNA exonuclease 2 [Source:Xenbase;Acc:XB-GENE-994555])

HSP 1 Score: 132.109 bits (331), Expect = 1.370e-34
Identity = 92/281 (32.74%), Postives = 137/281 (48.75%), Query Frame = 2
Query:    2 SLIFLVLLSASYFQVEA------FESSDEKSVEKFLSNFYDYNEKS-DKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQ-TYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSG---NLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGK 811
            +++F +L  +    + A         SD +  E +L  +Y    KS +  ++ +K +QK  G+   G++  + +A ++  RCG  D  +   R    + +W K Q TYR   +    P +M    +  A+ +A   WS    + F ++SS++  +  + F    H             D  P D  P  VLAHAF P SG   + HFD  E WT     G NL +VAAHE GH++GL HS DP+ALM P Y  Y++  +FRLP DD  G  S+YG  K GK
Sbjct:    4 AIVFAILALSCIHAMPAPITDNNISPSDRQFAEGYLDKYYLMTAKSKNTFAEKIKEMQKFFGMSVTGRLDSDTMAMMKTPRCGMPDVAEF--RQFPGRQRWTKTQLTYRIVNYTPDLPRSM----VDEAIRLAFKVWSDVTPLKFTRISSRRADIM-IQFGARSHG------------DFIPFDG-PNGVLAHAFAPGSGIGGDAHFDEDERWTS-TSAGFNLFLVAAHEFGHSLGLDHSRDPRALMFPSY-RYMNTRNFRLPQDDVNGIQSIYGR-KTGK 261          
BLAST of mmp2 protein vs. Ensembl Xenopus
Match: MMP20 (matrix metallopeptidase 20 [Source:NCBI gene;Acc:100489409])

HSP 1 Score: 134.42 bits (337), Expect = 9.105e-34
Identity = 90/253 (35.57%), Postives = 128/253 (50.59%), Query Frame = 2
Query:  128 LSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQ-TYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSG---NLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCN 874
            +S  ++ +QK  GL   GK+    LA ++K RCG  D    +      + KW +   TYR      ++ +++S  ++ RA+ + L  WS AA + F K +  +  +  +SF   +H             D YP D  P   LAHAF P  G   + HFD+AE WT GK+ G NL  VAAHE GHA+GL HS+DP ALM P Y  Y     F+LP DD +G  +LYG    GK          +Q +N+ + C+
Sbjct:   34 MSRKIRKMQKFFGLQVTGKLDHSTLAVMQKPRCGMPD--LANYHVFPGEPKWQRSSLTYRI----TKYTSSLSTQDVDRAVDLGLKAWSDAAPLNFIKTTQGEADIM-ISFESGDHG------------DSYPFDG-PRGTLAHAFAPGEGLGGDTHFDNAERWTTGKN-GFNLFTVAAHEFGHALGLGHSSDPSALMYPTY-RYQHPIGFQLPTDDVKGIQALYGTKGIGKE----KPMAPQQPANKPDQCD 260          
BLAST of mmp2 protein vs. Ensembl Xenopus
Match: MMP20 (matrix metallopeptidase 20 [Source:NCBI gene;Acc:100489409])

HSP 1 Score: 133.65 bits (335), Expect = 2.572e-33
Identity = 90/253 (35.57%), Postives = 128/253 (50.59%), Query Frame = 2
Query:  128 LSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQ-TYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSG---NLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCN 874
            +S  ++ +QK  GL   GK+    LA ++K RCG  D    +      + KW +   TYR      ++ +++S  ++ RA+ + L  WS AA + F K +  +  +  +SF   +H             D YP D  P   LAHAF P  G   + HFD+AE WT GK+ G NL  VAAHE GHA+GL HS+DP ALM P Y  Y     F+LP DD +G  +LYG    GK          +Q +N+ + C+
Sbjct:   67 MSRKIRKMQKFFGLQVTGKLDHSTLAVMQKPRCGMPD--LANYHVFPGEPKWQRSSLTYRI----TKYTSSLSTQDVDRAVDLGLKAWSDAAPLNFIKTTQGEADIM-ISFESGDHG------------DSYPFDG-PRGTLAHAFAPGEGLGGDTHFDNAERWTTGKN-GFNLFTVAAHEFGHALGLGHSSDPSALMYPTY-RYQHPIGFQLPTDDVKGIQALYGTKGIGKE----KPMAPQQPANKPDQCD 293          
BLAST of mmp2 protein vs. Ensembl Xenopus
Match: MMP20 (matrix metallopeptidase 20 [Source:NCBI gene;Acc:100489409])

HSP 1 Score: 132.494 bits (332), Expect = 3.601e-33
Identity = 96/292 (32.88%), Postives = 140/292 (47.95%), Query Frame = 2
Query:   53 FESSDEKSVEKFLSNFYDYNEKSDK--------------LSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQ-TYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSG---NLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCN 874
            F S +E+   ++L  +Y     SD+              +S  ++ +QK  GL   GK+    LA ++K RCG  D    +      + KW +   TYR      ++ +++S  ++ RA+ + L  WS AA + F K +  +  +  +SF   +H             D YP D  P   LAHAF P  G   + HFD+AE WT GK+ G NL  VAAHE GHA+GL HS+DP ALM P Y  Y     F+LP DD +G  +LYG  K             +Q +N+ + C+
Sbjct:    2 FSSREEQQTYEYLDKYY-----SDRGTMRVAEMVADDVSMSRKIRKMQKFFGLQVTGKLDHSTLAVMQKPRCGMPD--LANYHVFPGEPKWQRSSLTYRI----TKYTSSLSTQDVDRAVDLGLKAWSDAAPLNFIKTTQGEADIM-ISFESGDHG------------DSYPFDG-PRGTLAHAFAPGEGLGGDTHFDNAERWTTGKN-GFNLFTVAAHEFGHALGLGHSSDPSALMYPTY-RYQHPIGFQLPTDDVKGIQALYGKEKP---------MAPQQPANKPDQCD 257          
BLAST of mmp2 protein vs. Ensembl Xenopus
Match: MMP20 (matrix metallopeptidase 20 [Source:NCBI gene;Acc:100489409])

HSP 1 Score: 132.109 bits (331), Expect = 5.509e-33
Identity = 89/253 (35.18%), Postives = 127/253 (50.20%), Query Frame = 2
Query:  128 LSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQ-TYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSG---NLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCN 874
            +S  ++ +QK  GL   GK+    LA ++K RCG  D    +      + KW +   TYR      ++ +++S  ++ RA+ + L  WS AA + F K +  +  +  +SF   +H             D YP D  P   LAHAF P  G   + HFD+AE WT GK+ G NL  VAAHE GHA+GL HS+DP ALM P Y  Y     F+LP DD +G  +LYG  K             +Q +N+ + C+
Sbjct:   35 MSRKIRKMQKFFGLQVTGKLDHSTLAVMQKPRCGMPD--LANYHVFPGEPKWQRSSLTYRI----TKYTSSLSTQDVDRAVDLGLKAWSDAAPLNFIKTTQGEADIM-ISFESGDHG------------DSYPFDG-PRGTLAHAFAPGEGLGGDTHFDNAERWTTGKN-GFNLFTVAAHEFGHALGLGHSSDPSALMYPTY-RYQHPIGFQLPTDDVKGIQALYGKEKP---------MAPQQPANKPDQCD 256          
BLAST of mmp2 protein vs. Ensembl Mouse
Match: Mmp19 (matrix metallopeptidase 19 [Source:MGI Symbol;Acc:MGI:1927899])

HSP 1 Score: 136.732 bits (343), Expect = 2.909e-34
Identity = 117/388 (30.15%), Postives = 179/388 (46.13%), Query Frame = 2
Query:    5 LIFLVLLSASYFQVEAFESSDEKSVEKFLSNFYDYNEKS---------DKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDS-KKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTTNINSA-------------FQFADGHVYVVT--GNNKVFRILLKNHSLIVDPAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIF 1093
            L FL+ ++ S     A   +++++V  +L   Y Y +K          + +++A++  Q+ +GLP  G++     A +++ RCG +D   +KS +Y        K  T+R +      P+T+SL  ++ AL  A  YWS+ A + F +V +    +  LSF      +Y   N F          + PG VLAHA  P+ G++HFD  E WTEG   G+NLR++AAHE+GHA+GL HS   +ALMAP Y GY  +  F+L  DD  G  +LYG      R    +      S    +     N  S              + F   +V+ VT  G   +F+I      L   P            + DA +Y    RR   FKGNK++
Sbjct:    8 LAFLLPMTVS---GRALGPTEKEAVLDYLLQ-YGYLQKPLEGADDFRLEDITEALRTFQEASGLPISGQMDDATRARMKQPRCGLEDPFNQKSLKYLLLGHWRKKNLTFRIF----NVPSTLSLPRVRAALHQAFKYWSSVAPLTFREVKAGWADI-RLSF-HGRQSLY-CSNTF----------DGPGKVLAHADIPELGSIHFDKDELWTEGTYQGVNLRIIAAHEVGHALGLGHSRYTQALMAPVYAGY--QPFFKLHPDDVAGIQALYGKRSPETRDEEEETEMLTVSPVTAKPGPMPNPCSGEVDAMVLGPRGKTYAFKGDYVWTVTDSGPGPLFQISALWEGL---PG-----------NLDAAVYSPRTRRTHFFKGNKVW 358          
BLAST of mmp2 protein vs. Ensembl Mouse
Match: Mmp20 (matrix metallopeptidase 20 (enamelysin) [Source:MGI Symbol;Acc:MGI:1353466])

HSP 1 Score: 131.724 bits (330), Expect = 1.063e-32
Identity = 87/233 (37.34%), Postives = 123/233 (52.79%), Query Frame = 2
Query:  116 KSDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKG-QTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSG---NLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTK 802
            +S+ +   +K +Q   GL   GK+ +  +  ++K RCG  D    + R    + KW K   TYR      ++  +MS  E+ +A+ +AL+ WSTA  + F +++S +  +  +SF   +H             D YP D  P   LAHAF P  G   + HFD+AE+WT G + G NL  VAAHE GHA+GL HS DP ALM P Y  Y +   F LP DD +G  +LYG  K
Sbjct:   63 ESNPMIRRIKELQIFFGLKVTGKLDQNTMNVIKKPRCGVPDVA--NYRLFPGEPKWKKNILTYRI----SKYTPSMSPTEVDKAIQMALHAWSTAVPLNFVRINSGEADIM-ISFETGDHG------------DSYPFDG-PRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTN-GFNLFTVAAHEFGHALGLGHSTDPSALMYPTY-KYQNPYRFHLPKDDVKGIQALYGPRK 273          
BLAST of mmp2 protein vs. Ensembl Mouse
Match: Mmp25 (matrix metallopeptidase 25 [Source:MGI Symbol;Acc:MGI:2443938])

HSP 1 Score: 130.954 bits (328), Expect = 5.192e-32
Identity = 86/242 (35.54%), Postives = 125/242 (51.65%), Query Frame = 2
Query:  122 DKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRC------GGKDSKKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSK-QGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPK----SGNLHFDSAEEWTEGK--DDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISE-SDFRLPDDDSQGAISLYGNTKN 805
            +KL DA+K +Q+ AGLP  G++    +  + K RC      G     ++ +RY+ + S W K +T  + I      + +S   ++  L  AL  W+T + + F +V+S+ Q     + FA A H+            D YP D   G  LAHAFFP     SG+ HFD  E WT G   D+GI+L  VA HE GHA+GL HS+ P ++M P+Y G + + + +RLP DD  G   LYG    
Sbjct:  111 EKLQDAIKVMQRFAGLPETGQMDPMTIKTMRKPRCSLPDVLGAAGLVRRRRRYSLSGSVWKK-RTLTWSIRSFSQKSQLSPQIVRTLLSYALAVWATESGLTFQEVNSQYQEPDIIIHFARAYHQ------------DSYPFDGS-GGTLAHAFFPGEHPISGDTHFDDEETWTFGSTDDNGIDLFAVAVHEFGHALGLGHSSAPNSIMRPFYQGPVGDPATYRLPQDDRDGLQQLYGRVSQ 338          
BLAST of mmp2 protein vs. Ensembl Mouse
Match: Mmp7 (matrix metallopeptidase 7 [Source:MGI Symbol;Acc:MGI:103189])

HSP 1 Score: 120.553 bits (301), Expect = 2.116e-30
Identity = 84/248 (33.87%), Postives = 120/248 (48.39%), Query Frame = 2
Query:   71 KSVEKFLSNFYDYNEKSDK---LSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKW-DKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSG---NLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYG 793
            +  + +L  FY ++ K+ K   L D +K +QK  GLP  GK++  ++  ++K RCG  D  + S   N+   KW  +  TYR   +    P  +    + + +  AL  WS    + F +VS     +  + FA  +H             D +P D  PGN L HAF P  G   + HFD  E WT+G+D G+N    A HE GH++GL HS+ P  +M P Y    SE DF L  DD  G   LYG
Sbjct:   36 EQAQNYLRKFYPHDSKTKKVNSLVDNLKEMQKFFGLPMTGKLSPYIMEIMQKPRCGVPDVAEYSLMPNSP--KWHSRIVTYRIVSYTSDLPRIV----VDQIVKKALRMWSMQIPLNFKRVSWGTADII-IGFARRDHG------------DSFPFDG-PGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDAGVNFLFAATHEFGHSLGLSHSSVPGTVMYPTYQRDYSE-DFSLTKDDIAGIQKLYG 262          
BLAST of mmp2 protein vs. Ensembl Mouse
Match: Mmp19 (matrix metallopeptidase 19 [Source:MGI Symbol;Acc:MGI:1927899])

HSP 1 Score: 120.168 bits (300), Expect = 7.176e-29
Identity = 101/313 (32.27%), Postives = 143/313 (45.69%), Query Frame = 2
Query:  203 AHVEKSRCGGKDS-KKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTTNINSA-------------FQFADGHVYVVT--GNNKVFRILLKNHSLIVDPAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIF 1093
            A +++ RCG +D   +KS +Y        K  T+R +      P+T+SL  ++ AL  A  YWS+ A + F +V +    +  LSF      +Y   N F          + PG VLAHA  P+ G++HFD  E WTEG   G+NLR++AAHE+GHA+GL HS   +ALMAP Y GY  +  F+L  DD  G  +LYG      R    +      S    +     N  S              + F   +V+ VT  G   +F+I      L   P            + DA +Y    RR   FKGNK++
Sbjct:    7 ARMKQPRCGLEDPFNQKSLKYLLLGHWRKKNLTFRIF----NVPSTLSLPRVRAALHQAFKYWSSVAPLTFREVKAGWADI-RLSF-HGRQSLY-CSNTF----------DGPGKVLAHADIPELGSIHFDKDELWTEGTYQGVNLRIIAAHEVGHALGLGHSRYTQALMAPVYAGY--QPFFKLHPDDVAGIQALYGKRSPETRDEEEETEMLTVSPVTAKPGPMPNPCSGEVDAMVLGPRGKTYAFKGDYVWTVTDSGPGPLFQISALWEGL---PG-----------NLDAAVYSPRTRRTHFFKGNKVW 286          
BLAST of mmp2 protein vs. UniProt/SwissProt
Match: sp|Q9JHI0|MMP19_MOUSE (Matrix metalloproteinase-19 OS=Mus musculus OX=10090 GN=Mmp19 PE=2 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 2.035e-33
Identity = 117/388 (30.15%), Postives = 179/388 (46.13%), Query Frame = 2
Query:    5 LIFLVLLSASYFQVEAFESSDEKSVEKFLSNFYDYNEKS---------DKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDS-KKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTTNINSA-------------FQFADGHVYVVT--GNNKVFRILLKNHSLIVDPAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIF 1093
            L FL+ ++ S     A   +++++V  +L   Y Y +K          + +++A++  Q+ +GLP  G++     A +++ RCG +D   +KS +Y        K  T+R +      P+T+SL  ++ AL  A  YWS+ A + F +V +    +  LSF      +Y   N F          + PG VLAHA  P+ G++HFD  E WTEG   G+NLR++AAHE+GHA+GL HS   +ALMAP Y GY  +  F+L  DD  G  +LYG      R    +      S    +     N  S              + F   +V+ VT  G   +F+I      L   P            + DA +Y    RR   FKGNK++
Sbjct:    8 LAFLLPMTVS---GRALGPTEKEAVLDYLLQ-YGYLQKPLEGADDFRLEDITEALRTFQEASGLPISGQMDDATRARMKQPRCGLEDPFNQKSLKYLLLGHWRKKNLTFRIF----NVPSTLSLPRVRAALHQAFKYWSSVAPLTFREVKAGWADI-RLSF-HGRQSLY-CSNTF----------DGPGKVLAHADIPELGSIHFDKDELWTEGTYQGVNLRIIAAHEVGHALGLGHSRYTQALMAPVYAGY--QPFFKLHPDDVAGIQALYGKRSPETRDEEEETEMLTVSPVTAKPGPMPNPCSGEVDAMVLGPRGKTYAFKGDYVWTVTDSGPGPLFQISALWEGL---PG-----------NLDAAVYSPRTRRTHFFKGNKVW 358          
BLAST of mmp2 protein vs. UniProt/SwissProt
Match: sp|P09237|MMP7_HUMAN (Matrilysin OS=Homo sapiens OX=9606 GN=MMP7 PE=1 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 2.719e-32
Identity = 88/257 (34.24%), Postives = 124/257 (48.25%), Query Frame = 2
Query:   71 KSVEKFLSNFYDYNEKS---DKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKW-DKGQTYRF--YIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSG---NLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKR 814
            +  + +L  FY Y+ ++   + L   +K +QK  GLP  G +   ++  ++K RCG  D  + S   N+   KW  K  TYR   Y  D  H T      + R +  ALN W     ++F KV      +  + FA   H             D YP D  PGN LAHAF P +G   + HFD  E WT+G   GIN    A HE+GH++G+ HS+DP A+M P YG      +F+L  DD +G   LYG   N ++
Sbjct:   33 EQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSP--KWTSKVVTYRIVSYTRDLPHIT------VDRLVSKALNMWGKEIPLHFRKVVWGTADIM-IGFARGAHG------------DSYPFDG-PGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNG-DPQNFKLSQDDIKGIQKLYGKRSNSRK 266          
BLAST of mmp2 protein vs. UniProt/SwissProt
Match: sp|O18767|MMP20_BOVIN (Matrix metalloproteinase-20 OS=Bos taurus OX=9913 GN=MMP20 PE=1 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 4.315e-32
Identity = 83/222 (37.39%), Postives = 119/222 (53.60%), Query Frame = 2
Query:  140 VKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQ-TYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPK---SGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYG 793
            +K +Q+  GL   GK+ +  +  +++ RCG  D    + R    + KW K   TYR      ++  +M+  E+ RA+ +AL  WS+A  + F ++++ +  +  +SF   +H             D YP D  P   LAHAF P     G+ HFD+AE+WT G + G NL  VAAHE GHA+GL HS DP ALM P Y  Y +   FRLP DD +G  +LYG
Sbjct:   70 IKELQEFFGLRVTGKLDRATMDVIKRPRCGVPDVA--NYRLFPGEPKWKKNTLTYRI----SKYTPSMTPAEVDRAMEMALRAWSSAVPLNFVRINAGEADIM-ISFETGDHG------------DSYPFDG-PRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTN-GFNLFTVAAHEFGHALGLAHSTDPSALMFPTY-KYQNPYGFRLPKDDVKGIQALYG 269          
BLAST of mmp2 protein vs. UniProt/SwissProt
Match: sp|P57748|MMP20_MOUSE (Matrix metalloproteinase-20 OS=Mus musculus OX=10090 GN=Mmp20 PE=2 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 7.438e-32
Identity = 87/233 (37.34%), Postives = 123/233 (52.79%), Query Frame = 2
Query:  116 KSDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKG-QTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSG---NLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTK 802
            +S+ +   +K +Q   GL   GK+ +  +  ++K RCG  D    + R    + KW K   TYR      ++  +MS  E+ +A+ +AL+ WSTA  + F +++S +  +  +SF   +H             D YP D  P   LAHAF P  G   + HFD+AE+WT G + G NL  VAAHE GHA+GL HS DP ALM P Y  Y +   F LP DD +G  +LYG  K
Sbjct:   63 ESNPMIRRIKELQIFFGLKVTGKLDQNTMNVIKKPRCGVPDVA--NYRLFPGEPKWKKNILTYRI----SKYTPSMSPTEVDKAIQMALHAWSTAVPLNFVRINSGEADIM-ISFETGDHG------------DSYPFDG-PRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTN-GFNLFTVAAHEFGHALGLGHSTDPSALMYPTY-KYQNPYRFHLPKDDVKGIQALYGPRK 273          
BLAST of mmp2 protein vs. UniProt/SwissProt
Match: sp|O60882|MMP20_HUMAN (Matrix metalloproteinase-20 OS=Homo sapiens OX=9606 GN=MMP20 PE=1 SV=3)

HSP 1 Score: 131.339 bits (329), Expect = 8.537e-32
Identity = 86/232 (37.07%), Postives = 122/232 (52.59%), Query Frame = 2
Query:  119 SDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQ-TYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSG---NLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTK 802
            S+ +   +K +Q   GL   GK+ +  +  ++K RCG  D    + R    + KW K   TYR      ++  +MS  E+ +A+ +AL  WS+A  + F +++S +  +  +SF + +H             D YP D  P   LAHAF P  G   + HFD+AE+WT G + G NL  VAAHE GHA+GL HS DP ALM P Y  Y +   F LP DD +G  +LYG  K
Sbjct:   65 SNSMIRKIKELQAFFGLQVTGKLDQTTMNVIKKPRCGVPDVA--NYRLFPGEPKWKKNTLTYRI----SKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIM-ISFENGDHG------------DSYPFDG-PRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTN-GFNLFTVAAHEFGHALGLAHSTDPSALMYPTY-KYKNPYGFHLPKDDVKGIQALYGPRK 274          
BLAST of mmp2 protein vs. TrEMBL
Match: K0JBI8 (Mmp2 protein OS=Schmidtea mediterranea OX=79327 GN=mmp2 PE=2 SV=1)

HSP 1 Score: 1036.56 bits (2679), Expect = 0.000e+0
Identity = 499/501 (99.60%), Postives = 499/501 (99.60%), Query Frame = 2
Query:    5 LIFLVLLSASYFQVEAFESSDEKSVEKFLSNFYDYNEKSDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTTNINSAFQFADGHVYVVTGNNKVFRILLKNHSLIVDPAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANGLELENMALSELNITRFGAFQGRVNAAFVRDKAGKSNTLKFWALQDGELIAGRVKGNQVKFSRRTTKLSEILKMPTGTKTLSNIDGAFVLGKKDNKRLILFVGNSVYVGNPNGRKLVKYSIPAQYPKTFKQIIHC 1507
            LI  VLLSASYFQVEAFESSDEKSVEKFLSNFYDYNEKSDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTTNINSAFQFADGHVYVVTGNNKVFRILLKNHSLIVDPAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANGLELENMALSELNITRFGAFQGRVNAAFVRDKAGKSNTLKFWALQDGELIAGRVKGNQVKFSRRTTKLSEILKMPTGTKTLSNIDGAFVLGKKDNKRLILFVGNSVYVGNPNGRKLVKYSIPAQYPKTFKQIIHC
Sbjct:    2 LILFVLLSASYFQVEAFESSDEKSVEKFLSNFYDYNEKSDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTTNINSAFQFADGHVYVVTGNNKVFRILLKNHSLIVDPAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANGLELENMALSELNITRFGAFQGRVNAAFVRDKAGKSNTLKFWALQDGELIAGRVKGNQVKFSRRTTKLSEILKMPTGTKTLSNIDGAFVLGKKDNKRLILFVGNSVYVGNPNGRKLVKYSIPAQYPKTFKQIIHC 502          
BLAST of mmp2 protein vs. TrEMBL
Match: K0JBS3 (Mmp1 protein OS=Schmidtea mediterranea OX=79327 GN=mmp1 PE=2 SV=1)

HSP 1 Score: 511.146 bits (1315), Expect = 1.039e-174
Identity = 249/499 (49.90%), Postives = 350/499 (70.14%), Query Frame = 2
Query:   14 LVLLSASYF-QVEAFESSDEKSVEKFLSNFYDYNEKSDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTTNINSAFQFADGHVYVVTGNNKVFRILLKNHSLIVDPAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANGLELENMALSELNITRFGAFQGRVNAAFVRDKAGKSNTLKFWALQDGELIAGRVKGNQVKFSRRTTKLSEILKMPTGTKTLSNIDGAFVLGKKDNKRLILFVGNSVYVGNPNGRKLVKYSIPAQYPKTFKQIIHC 1507
            +VLLS  +F  V +F+SS+EK  EK+L+ FYDY++ +  L D++K++QKMAG+  DGK++ E+++H+ K RCGGKD  KKSKRY AA ++WD+G TY++Y+H +  P TMS  E++RA+ +AL+YW   +++ F     K G MFS+SF+  +H  YDV+ NF  S+DPYPLDNVP  VLAHAFFP++GNLH+D+AE WTEGKD GINLR+V AHEMGHAIGL+HSNDP ALMAPWYGGYISE+D+RLP+DD+ GA SLYG    GKR +     KR+    Q  LCN  N +  F F+D   YV+   + +FR+   N    VD  F+ ++++  + ++D++ YD   +R VVFKG+K++SA+G +++ + + E+ I   GA+ G+ +AAF R  + +     FW +QD E+I+G V  N++ FSRRT  LSE++ M  G K   +ID A + G+KDN +L LFVGNS YVG P GRK  +YSI A YPK++KQ++ C
Sbjct:    5 IVLLSTLFFLSVHSFKSSEEKDAEKYLTEFYDYDKSTGSLKDSLKDLQKMAGIEADGKLSDEVISHMNKGRCGGKDKDKKSKRYVAANARWDRGVTYKYYLHLDWMPRTMSEAEVRRAIQVALDYWVRVSNLGFAASRDKAGCMFSVSFSGRDHLQYDVNKNFQPSKDPYPLDNVPSGVLAHAFFPRNGNLHYDNAETWTEGKDSGINLRIVTAHEMGHAIGLHHSNDPSALMAPWYGGYISEADYRLPNDDTLGAQSLYG--ARGKRAL--PLKKRDLGKLQSRLCNAKNYDGVFAFSDDKTYVIADGSNLFRLDGTN----VDETFEPVEINEALKNADSMFYDKVNKRLVVFKGDKVYSASGSDVKTLKVEEMKIGGHGAYLGKSSAAFARQVSAEEGMQYFWLIQDNEVISGEVLKNKIVFSRRTRPLSEVITMSNGAKFPPSIDAALLSGEKDNLQLYLFVGNSYYVGKPTGRKQFQYSISADYPKSYKQVLKC 495          
BLAST of mmp2 protein vs. TrEMBL
Match: H9GM69 (Matrix metallopeptidase 19 OS=Anolis carolinensis OX=28377 GN=MMP19 PE=3 SV=2)

HSP 1 Score: 153.295 bits (386), Expect = 4.209e-37
Identity = 108/348 (31.03%), Postives = 164/348 (47.13%), Query Frame = 2
Query:   68 EKSVEKFLSNFYDYNEKSDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQ-TYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTTN-------------INSAFQFADGHVYVVT--GNNKVFRI--LLKNHSLIVDPAFKTIQLSNQIFDSDALLYDYSG 1057
            +K +E+F +NF +     +++ +A+++ Q  +GLP  G++    L+ + + RCG +D   +         +W K   TYR Y H E     M     + A+  A  YWS    + F +V + +  +  L+F  +        + +  SR   P D  PG+VLAHA  P+ G +HFDSAE WTEG   G+NLR++AAHE+GHA+GL HS  P ALMAP Y GY     FRL  DD +G  +LYG        V +  A+    +   +     N              +  + F   +V+ VT  G N   +I  L K     +D A  + +     F   + L+ Y G
Sbjct:   43 QKPLEQFSNNFTE-----EEIEEALRSFQLASGLPVTGRVDVATLSQMRQPRCGVEDPFNERTLKYLLLGRWRKRHLTYRLYSHSE----DMGAAATRTAIKTAFKYWSDVTRLTFQEVRTGRADI-RLAFHGS--------SPWGCSR---PFDG-PGHVLAHADIPELGTVHFDSAEHWTEGTPRGVNLRIIAAHEIGHALGLGHSRHPTALMAPSYSGY--RPRFRLHHDDIEGIQALYGKKTLSTTTVMTSPARTTVPTVSVKPSKVPNPCKDGLDAIMLGPYDKTYAFRGDYVWTVTDFGTNPPLKISALWKGLPGWLDAAVHSPRTGRTYFFKGSKLWRYQG 366          
BLAST of mmp2 protein vs. TrEMBL
Match: A0A336MF57 (CSON000784 protein OS=Culicoides sonorensis OX=179676 GN=CSON000784 PE=3 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 5.958e-37
Identity = 136/427 (31.85%), Postives = 196/427 (45.90%), Query Frame = 2
Query:   35 YFQVEAFESSDEKSVEKFLSNFYDY------NEKSDKLSDA------VKNIQKMAGLPTDGKITKELLAHVEKSRCGGKD-----SKKKSKRYNAAQSKWD-KGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSM-FSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFP-KSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNG-----KRFVRSDRAKREQSSNQKELCNTTNINSAFQFADGHVYVVTGNNKVFRILLKNHSLIVDPAFKTIQLSNQIFDSDA-LLYDYSGRRFVVFKGNKIFSANGLELENMALSELNITRFGAFQGRVNAAFVRDKAGK---SNTLKFW 1228
            Y   ++ E +D+  V+ +LS F  Y      N  S  L DA      +   Q  AGL   G + +E +  ++  RCG KD     S  +SKRY    S+W  K  TYR      ++P  ++  E+   +  A N WS   D+ F   + KQ  +   + F ++EH   D            P D  PG  LAHA+FP   G+ HFD AE WT     G NL  VAAHE GH++GL HS+   ALMAP+Y GY  +S+FRL  DD QG  +LYG   +G          + +    Q+ N  ELC +  I++ F  ADG+ YV  G +K +R+     + I D   K I       +S+    + Y   +   FKG K +  +G  ++     +++   F      ++AA V    GK       KFW
Sbjct:   27 YLNFDSIEGTDD--VDLYLSQF-GYLSPSLRNPTSGNLIDANTWERAIMEFQSFAGLNATGDLDEETMELMQTPRCGVKDKVGFGSDTRSKRYALQGSRWKVKALTYRI----SKYPKRLNRKEVDDEIAKAFNVWSEYTDLTF--TAKKQNPVHIDIRFEESEHGDGD------------PFDG-PGGTLAHAYFPVYGGDAHFDDAEYWTIKSTRGTNLFQVAAHEFGHSLGLSHSDVRSALMAPFYRGY--DSNFRLDSDDIQGIQALYGRKTSGGGSQQPTIKTTKKPTVVQNDNSNELCKSPKIDAVFNTADGNTYVFKG-DKYYRL---TENAIADGYPKKISEGWPGLESNIDAAFTYKNGKTYFFKGTKYWRYSGRTVDGDYPKKIS-DGFTGIPDHLDAALVWGGNGKIYFYKGSKFW 424          
BLAST of mmp2 protein vs. TrEMBL
Match: A0A336MHW6 (CSON000784 protein OS=Culicoides sonorensis OX=179676 GN=CSON000784 PE=3 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 6.349e-37
Identity = 136/427 (31.85%), Postives = 196/427 (45.90%), Query Frame = 2
Query:   35 YFQVEAFESSDEKSVEKFLSNFYDY------NEKSDKLSDA------VKNIQKMAGLPTDGKITKELLAHVEKSRCGGKD-----SKKKSKRYNAAQSKWD-KGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSM-FSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFP-KSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNG-----KRFVRSDRAKREQSSNQKELCNTTNINSAFQFADGHVYVVTGNNKVFRILLKNHSLIVDPAFKTIQLSNQIFDSDA-LLYDYSGRRFVVFKGNKIFSANGLELENMALSELNITRFGAFQGRVNAAFVRDKAGK---SNTLKFW 1228
            Y   ++ E +D+  V+ +LS F  Y      N  S  L DA      +   Q  AGL   G + +E +  ++  RCG KD     S  +SKRY    S+W  K  TYR      ++P  ++  E+   +  A N WS   D+ F   + KQ  +   + F ++EH   D            P D  PG  LAHA+FP   G+ HFD AE WT     G NL  VAAHE GH++GL HS+   ALMAP+Y GY  +S+FRL  DD QG  +LYG   +G          + +    Q+ N  ELC +  I++ F  ADG+ YV  G +K +R+     + I D   K I       +S+    + Y   +   FKG K +  +G  ++     +++   F      ++AA V    GK       KFW
Sbjct:   27 YLNFDSIEGTDD--VDLYLSQF-GYLSPSLRNPTSGNLIDANTWERAIMEFQSFAGLNATGDLDEETMELMQTPRCGVKDKVGFGSDTRSKRYALQGSRWKVKALTYRI----SKYPKRLNRKEVDDEIAKAFNVWSEYTDLTF--TAKKQNPVHIDIRFEESEHGDGD------------PFDG-PGGTLAHAYFPVYGGDAHFDDAEYWTIKSTRGTNLFQVAAHEFGHSLGLSHSDVRSALMAPFYRGY--DSNFRLDSDDIQGIQALYGRKTSGGGSQQPTIKTTKKPTVVQNDNSNELCKSPKIDAVFNTADGNTYVFKG-DKYYRL---TENAIADGYPKKISEGWPGLESNIDAAFTYKNGKTYFFKGTKYWRYSGRTVDGDYPKKIS-DGFTGIPDHLDAALVWGGNGKIYFYKGSKFW 424          
BLAST of mmp2 protein vs. Ensembl Cavefish
Match: ENSAMXT00000030273.1 (matrix metalloproteinase-19 [Source:NCBI gene;Acc:103027674])

HSP 1 Score: 141.739 bits (356), Expect = 2.387e-36
Identity = 137/508 (26.97%), Postives = 215/508 (42.32%), Query Frame = 2
Query:    5 LIFLVLLSASYFQVEAFESSDEKSVEKFLSNF----------YDYNEKSDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDS-KKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRD---PYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTT-------NINSAFQFADGHVYVVT--GNNKVFRI--LLKNHSLIVDPAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANGLELEN----MALSELNITRFGAFQGRVNAAFVRDKAGKSNTLKFWALQDGELIAGRVKGNQVKFSRRTTKLSEILKMPTGTKTLSNIDGAFVLGKKDNKRLILFVGNSVYVGNPNG 1441
            LI ++ +        A    D K    +L+ +           D + +  ++S+A++  QK+  LP  G++    L  +++ RCG KD    ++ +Y        K  +YR Y     H +++ + + + A+  A  YWS  + + F +++     +  +SF                 RD   P P D  PG VLAHA  P+SG +HFD  E WTEGK  G NLR+VAAHE+GHA+GL HS    ALM P Y GY   ++FRL  DD +G  +LYG          +   K    S   + C  +        ++  F F+  +V+ ++  G N   RI  L K+    ++ A  + + S   F                 KG K++  +G +L++    + L   NI    AF    N   +  K       ++W  Q  EL      G+  +  +    L E++     T   SN D AF      N    LF G+  +  NP G
Sbjct:   13 LILMLCMFMWMPLYAALHKKDLKEATVYLTKYGYLPTSLHHPKDQDGQVKQISEALRVFQKVMELPVSGRLDNATLVMMKQPRCGLKDPFNNRTLKYRVLGHWRKKTLSYRIY----NHASSLGVAKTRAAIQTAFRYWSEVSPLRFHELNKGHPDI-KISF---------------HGRDRVCPVPFDG-PGEVLAHADSPESGLVHFDEEELWTEGKSTGSNLRIVAAHEIGHALGLGHSQYRSALMGPVYTGY--RNNFRLHPDDVRGIQALYGKPVEKPPPAPAVPNKPPADSAAPDPCTASLDAIMLGPLHKTFAFSGDYVWTISDAGYNTPIRINVLWKDLPGHINAAVHSPRTSKSYF----------------LKGEKVWRYSGFKLDHSYPKVLLIPPNID--SAFYSNANKKLIFIKGS-----EYW--QWDEL------GSSNELRQYPKSLKELV-----TGLPSNPDAAFTW---TNGHTYLFKGDQYWRINPRG 458          
BLAST of mmp2 protein vs. Ensembl Cavefish
Match: ENSAMXT00000007864.2 (matrix metalloproteinase-19 [Source:NCBI gene;Acc:103027674])

HSP 1 Score: 141.354 bits (355), Expect = 2.679e-36
Identity = 131/465 (28.17%), Postives = 203/465 (43.66%), Query Frame = 2
Query:  104 DYNEKSDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDS-KKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRD---PYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTT-------NINSAFQFADGHVYVVT--GNNKVFRI--LLKNHSLIVDPAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANGLELEN----MALSELNITRFGAFQGRVNAAFVRDKAGKSNTLKFWALQDGELIAGRVKGNQVKFSRRTTKLSEILKMPTGTKTLSNIDGAFVLGKKDNKRLILFVGNSVYVGNPNG 1441
            D + +  ++S+A++  QK+  LP  G++    L  +++ RCG KD    ++ +Y        K  +YR Y     H +++ + + + A+  A  YWS  + + F +++     +  +SF                 RD   P P D  PG VLAHA  P+SG +HFD  E WTEGK  G NLR+VAAHE+GHA+GL HS    ALM P Y GY   ++FRL  DD +G  +LYG          +   K    S   + C  +        ++  F F+  +V+ ++  G N   RI  L K+    ++ A  + + S   F                 KG K++  +G +L++    + L   NI    AF    N   +  K       ++W  Q  EL      G+  +  +    L E++     T   SN D AF      N    LF G+  +  NP G
Sbjct:   29 DQDGQVKQISEALRVFQKVMELPVSGRLDNATLVMMKQPRCGLKDPFNNRTLKYRVLGHWRKKTLSYRIY----NHASSLGVAKTRAAIQTAFRYWSEVSPLRFHELNKGHPDI-KISF---------------HGRDRVCPVPFDG-PGEVLAHADSPESGLVHFDEEELWTEGKSTGSNLRIVAAHEIGHALGLGHSQYRSALMGPVYTGY--RNNFRLHPDDVRGIQALYGKPVEKPPPAPAVPNKPPADSAAPDPCTASLDAIMLGPLHKTFAFSGDYVWTISDAGYNTPIRINVLWKDLPGHINAAVHSPRTSKSYF----------------LKGEKVWRYSGFKLDHSYPKVLLIPPNID--SAFYSNANKKLIFIKGS-----EYW--QWDEL------GSSNELRQYPKSLKELV-----TGLPSNPDAAFTW---TNGHTYLFKGDQYWRINPRG 431          
BLAST of mmp2 protein vs. Ensembl Cavefish
Match: mmp19 (matrix metalloproteinase-19 [Source:NCBI gene;Acc:103033524])

HSP 1 Score: 133.265 bits (334), Expect = 2.149e-33
Identity = 88/233 (37.77%), Postives = 124/233 (53.22%), Query Frame = 2
Query:  122 DKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDS-KKKSKRYNAAQSKWDK-GQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRD--PYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNG 808
            +++ +A+   Q+++ LP  G+I +  +  + + RCG +D   +KS RY      W +   TYR Y     +   M     QRA+  A  YWS                   LSF + ++   D+  +F  +R+  P P D  PG+VLAHA  P SG +HFD  E WTEGK  G NLR+VAAHE+GHA+GL HS    ALMA  Y GY  +++FRL  DD +G  +LYG   +G
Sbjct:   57 EEIKEALSLFQRVSELPITGQIDEATIGQMRQPRCGVEDPFNQKSMRYRTFGGVWRRRSLTYRIY----NYTPDMGKAATQRAIRSAFKYWSDVT---------------PLSFKEIDYGRADIRISF-HTREGCPSPFDG-PGHVLAHAEAPTSGIVHFDEDEFWTEGKYYGSNLRIVAAHEIGHALGLGHSQYKSALMAAHYTGY--KANFRLHPDDIRGIQALYGKRISG 266          
BLAST of mmp2 protein vs. Ensembl Cavefish
Match: mmp19 (matrix metalloproteinase-19 [Source:NCBI gene;Acc:103033524])

HSP 1 Score: 133.265 bits (334), Expect = 2.149e-33
Identity = 88/233 (37.77%), Postives = 124/233 (53.22%), Query Frame = 2
Query:  122 DKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDS-KKKSKRYNAAQSKWDK-GQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRD--PYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNG 808
            +++ +A+   Q+++ LP  G+I +  +  + + RCG +D   +KS RY      W +   TYR Y     +   M     QRA+  A  YWS                   LSF + ++   D+  +F  +R+  P P D  PG+VLAHA  P SG +HFD  E WTEGK  G NLR+VAAHE+GHA+GL HS    ALMA  Y GY  +++FRL  DD +G  +LYG   +G
Sbjct:   57 EEIKEALSLFQRVSELPITGQIDEATIGQMRQPRCGVEDPFNQKSMRYRTFGGVWRRRSLTYRIY----NYTPDMGKAATQRAIRSAFKYWSDVT---------------PLSFKEIDYGRADIRISF-HTREGCPSPFDG-PGHVLAHAEAPTSGIVHFDEDEFWTEGKYYGSNLRIVAAHEIGHALGLGHSQYKSALMAAHYTGY--KANFRLHPDDIRGIQALYGKRISG 266          
BLAST of mmp2 protein vs. Ensembl Cavefish
Match: mmp24 (matrix metallopeptidase 24 [Source:NCBI gene;Acc:103022628])

HSP 1 Score: 127.102 bits (318), Expect = 7.469e-31
Identity = 119/387 (30.75%), Postives = 180/387 (46.51%), Query Frame = 2
Query:  110 NEKSDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKD-----SKKKSKRYNAAQSKW-DKGQTYRFYIHDERHPTTMSLGE--IQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAES--RDPYPLDNVPGNVLAHAFFPKSG---NLHFDSAEEWTEGKD--DGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYG--------------------NTKNGKRFVRSDRAKREQSSNQKE--------LCNTTNINSA-------FQFADGHVYVVTGNNKVFRILLKNHSLIVDPAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANGLELEN 1120
            +EKS  +  AV  +Q+  G+P  G + +  +  ++K RCG  D      ++++KRY     KW DK  +Y        H  T  +GE   QRA+  A + W T   + F +V+  +           + K  D+   FA     D  P D   G  LAHA+FP  G   + HFDS E WT G    DG +L +VA HE+GHA+GL HSNDP A+MAP+Y  Y+   DF+LP DD QG   +YG                    ++ + ++  R  R  R  S ++          +C+  N N+        F F D   + +  NNKV     + + +++D  +K   L  +I   DA  Y+ S  +FV FKG+K +    + +E+
Sbjct:   64 SEKS--MQSAVAAMQRFYGIPVTGVLDQTTIEWMKKPRCGVPDHPHFSRRRRNKRYALTGQKWRDKKISYSI------HNFTPKVGEKDTQRAIRQAFDVWQTVTPLTFQEVAYPE--------IKKDGKEADIMIFFASGFHGDSSPFDGE-GGFLAHAYFPGPGIGGDTHFDSDEPWTLGNSNHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFY-QYMETHDFKLPLDDLQGIQKIYGIPTAMLEPTRPLPTLPARRTHSTSERKHDRQTRPPRPPSGDRPSSPGYGRPNICD-GNFNTVAFFRREMFVFKDRWFWRLR-NNKV----QEGYPMLIDQFWKG--LPPRI---DA-AYERSDGKFVFFKGDKYWVFREVTVES 420          
BLAST of mmp2 protein vs. Ensembl Sea Lamprey
Match: MMP14 (matrix metallopeptidase 14 [Source:HGNC Symbol;Acc:HGNC:7160])

HSP 1 Score: 115.161 bits (287), Expect = 2.726e-28
Identity = 83/239 (34.73%), Postives = 117/239 (48.95%), Query Frame = 2
Query:  128 LSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKD-------SKKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQ--RALIIALNYWSTAADIYFGKVSSKQGSM----FSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPK---SGNLHFDSAEEWTEGKDD--GINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLY 790
            LS+AV ++Q   G+P  G + +     ++K RCG  D       +  + KRY     KW     +  +I  +    T  +GE +  +A+  A + W     + F +VS + GS       + FA   H             D  P D V G  LAHA+FP     G+ HFD+ E WT G  D  G +L +VA HE+GHA+GL HSNDP A+MAP+Y  Y+   DF+LP DD  G   +Y
Sbjct:   28 LSEAVSSMQAFYGIPVTGTMDELTRQWMQKPRCGVPDRYGTTVTAGSRHKRYAINHLKW-----HHQHITYDIQNYTPKVGEYETHQAIRHAFDVWQAVTPLTFTQVSGRDGSGNDADIIIFFASGYHG------------DRSPFDGV-GGFLAHAYFPGKGIGGDTHFDADEPWTLGGHDYTGNDLFIVAVHELGHALGLEHSNDPSAIMAPFY-QYMDTDDFQLPYDDLLGIQQIY 247          
BLAST of mmp2 protein vs. Ensembl Sea Lamprey
Match: mmp19 (matrix metallopeptidase 19 [Source:ZFIN;Acc:ZDB-GENE-100308-3])

HSP 1 Score: 109.768 bits (273), Expect = 4.687e-26
Identity = 69/198 (34.85%), Postives = 93/198 (46.97%), Query Frame = 2
Query:  350 EIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTTNINSAFQFA---DGHVYVVTG 934
            E+++ +  A + WS    + F +  +   +   + F+  +H       +FA      P D  PG VLAHA+FP+ G  HFD  E+W+EG   GINL +VA HE GH +GL HS +  ALMAP+Y GY     FRL  DD  G  SLYG      R V    A        +  C     N+        DG  Y  +G
Sbjct:  129 EVKKIIARAFHEWSRVTPLRFYETPTSPKADIHIQFSRLQH------GDFA------PFDG-PGRVLAHAYFPEDGRAHFDEDEQWSEGTAQGINLHIVATHEFGHLLGLGHSKEQAALMAPFYMGY--RPKFRLHADDIAGIQSLYGT-----RLVFPREAPSRSLFMTRSACTPIKKNTHICVGTGPDGRTYAFSG 306          
BLAST of mmp2 protein vs. Ensembl Sea Lamprey
Match: mmp19 (matrix metallopeptidase 19 [Source:ZFIN;Acc:ZDB-GENE-100308-3])

HSP 1 Score: 108.612 bits (270), Expect = 5.318e-26
Identity = 65/161 (40.37%), Postives = 88/161 (54.66%), Query Frame = 2
Query:  350 EIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDR 832
            E+++ +  A + WS    + F +  +   +   + F+  +H       +FA      P D  PG VLAHA+FP+ G  HFD  E+W+EG   GINL +VA HE GH +GL HS +  ALMAP+Y GY     FRL  DD  G  SLYG T+ GKR   + R
Sbjct:   25 EVKKIIARAFHEWSRVTPLRFYETPTSPKADIHIQFSRLQH------GDFA------PFDG-PGRVLAHAYFPEDGRAHFDEDEQWSEGTAQGINLHIVATHEFGHLLGLGHSKEQAALMAPFYMGY--RPKFRLHADDIAGIQSLYG-TRLGKRHHTATR 169          
BLAST of mmp2 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001966.1 (pep scaffold:Pmarinus_7.0:GL476330:946825:981591:-1 gene:ENSPMAG00000001746.1 transcript:ENSPMAT00000001966.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.227 bits (269), Expect = 2.782e-25
Identity = 76/234 (32.48%), Postives = 117/234 (50.00%), Query Frame = 2
Query:  128 LSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCG-------GKDSKKKSKRYNAAQSKWDKGQ-TYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSG---NLHFDSAEEWTEGKDD--GINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLY 790
            +S AV  +Q+  G+   G +  + L  +++ RCG       G  +  + KRY     +W +   TY      + +   +   + +RAL  A + W     + F +VS+ +      S  +A+  ++    N  +S    P D   G  LAHA+FP  G   + HFD+ E WT G  +  G +L +VA HE+GHA+GL HSNDP A+MAP+Y  Y+   +F LP DD QG   +Y
Sbjct:   24 MSAAVSAMQRFYGINVTGTVDADTLRWMKRPRCGVPDRIDQGLQAGLRRKRYALTGQRWQQKHITYSL----QNYTPKVGEADTRRALRRAFDVWQQVTPLVFEEVSNHE---IRSSRREADIMIFFASGNHGDSS---PFDGE-GGFLAHAYFPGPGIGGDTHFDADEPWTLGNGNAGGNDLFLVAIHELGHALGLEHSNDPAAIMAPFY-QYMDTENFVLPRDDLQGIQQIY 245          
BLAST of mmp2 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005331.1 (pep scaffold:Pmarinus_7.0:GL476741:9169:28768:-1 gene:ENSPMAG00000004733.1 transcript:ENSPMAT00000005331.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.5969 bits (244), Expect = 1.271e-22
Identity = 91/324 (28.09%), Postives = 140/324 (43.21%), Query Frame = 2
Query:  266 AAQSKW-DKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSG---NLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTTNINSAFQFADGHVYVVTGNNKVFRILLKNHSLIVDPAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANGLELENMALSELNITRFGAFQGRVNAAFVRDKAGKSNTLKF 1225
             +++KW  K  TYRF      +P+ MS    + AL  A + W + + + F  +   +  +  +SF    H             D +P D  P  VLAHA+ P  G   +LHFD  E+W+ G   G NLRVVAAHE+GHA+GL HSN+  ++M P Y  +I      L +DD  G  +LYG  K           K+        LC       A  F    +Y+  G  + F  +  + +    P   +          DAL  +      V F G ++++  G E++  +  +L+         +V+AA      G+ +TL F
Sbjct:   23 PSRNKWLKKNLTYRFV----NYPSGMSRERAEDALAEAFDLWRSVSTLTFQMLREGEADIM-ISFERRYHG------------DEFPFDG-PHGVLAHAYEPSPGLGGDLHFDDEEQWSVGLI-GYNLRVVAAHELGHALGLQHSNERGSIMNPSYQVWIHPY---LSEDDKAGIRALYGTVK----------LKQCPVPCAPRLCGGNLRVDAASFIHRQLYIFQG--EYFWRVSSSLTGAGLPGLVSSHWPGAPNRIDALYANARNHTLVFFSGERVWALRGFEVDTGSPRDLHSLGLPPGTLKVDAAV----PGRDHTLLF 308          
BLAST of mmp2 protein vs. Ensembl Nematostella
Match: EDO46663 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPC7])

HSP 1 Score: 134.42 bits (337), Expect = 1.430e-36
Identity = 84/222 (37.84%), Postives = 115/222 (51.80%), Query Frame = 2
Query:  140 VKNIQKMAGLPTDGKITKELLAHVEKSRCGGKD---SKKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGN 796
            +KN Q   GLP  G++ +  +A + K RCG  D   S  + +RYNA +  W K ++  +YI    +   +S  E      +AL +W+  + + F +V S   +   +SF    H          ES+ P+  D  PG VLAHA+FP  G  HFD  E +T G   GINL  VAAHE GH++GL HSN   ALM P+Y GY  + D +L  DD  G   LYG 
Sbjct:    1 IKNFQTFFGLPLSGELDQATVALMRKPRCGMPDVDDSGLRVRRYNA-RDPWSK-KSLTYYI---EYGADLSASEQDDIFRLALKFWADESGLSFRQVKSGTAADIKISFGSGAHM-----GTHVESQCPFDFDG-PGKVLAHAYFPSDGRAHFDEDETFTHGTSSGINLMWVAAHEFGHSLGLGHSNVQGALMYPYYTGY--KPDMKLHADDIAGIQHLYGG 209          
BLAST of mmp2 protein vs. Ensembl Nematostella
Match: EDO41167 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S526])

HSP 1 Score: 134.035 bits (336), Expect = 6.109e-34
Identity = 102/379 (26.91%), Postives = 181/379 (47.76%), Query Frame = 2
Query:  128 LSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKD------SKKKSKRYNAAQSKWDKGQ-TYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPK-SGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTTNINSAFQFADGHVYVVTGNNKVFRI----LLKNHSLIVDPAFKTI--QLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANGLELENMALSELNITRFGAFQGRVNAAFVRDKAGKSNTLK 1222
            LS A++  Q+  GL   G +     + +E+ RCG  D      + ++ +RY    S+W+K + TYRF      +   +S   ++R    A   WS    +   + S  +   F++SF   +H   D            P D  PG  LAHAFFP+  G+LHFD +E +TEGKD G+NL  VAAHE+GH +GL HS+  +++MAP+Y GY  +++  L +DD +G   LYG+  +      S     + +    + C TT++++     DG+ Y    +  V+++        +  ++   +  +   L   +   + + + + G+ +  ++G K++      + N  L            G+++AAFV  + G++  +K
Sbjct:   49 LSRAIRQFQRYTGLQETGIMDAATKSKMEQPRCGLPDIVGTSENARRKRRYALQGSRWEKSEITYRF----ASYGNDLSRTAVRRIFARAAKLWSDKMQLNIKETSDAKAD-FTVSFNSYDHGDGD------------PFDG-PGGTLAHAFFPQYGGDLHFDDSETYTEGKDAGVNLLFVAAHELGHTLGLSHSDVWQSVMAPYYPGY--KANLELHEDDVKGIRHLYGSRTSSTIPTSSSGGPDKPAGGGPDTC-TTDLDTVVVAGDGNTYAFK-DAYVWKLRETGFAPGYPQLISKLWPGLPDSLDAAVGWGEDITFFFKGKLYWKYQGFKVYPDYPKRISNWGLP-----------GKIDAAFVWGRNGRTYFIK 394          
BLAST of mmp2 protein vs. Ensembl Nematostella
Match: EDO48756 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIQ1])

HSP 1 Score: 127.102 bits (318), Expect = 7.872e-34
Identity = 79/219 (36.07%), Postives = 112/219 (51.14%), Query Frame = 2
Query:  137 AVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYG 793
            A++  Q++AGLP  G++  + +A ++K RCG  D  +   R  +    WDK    R   +   +   +     +R    AL YWS  + + F   ++   +   +SF    H      N  A     Y  D  PG VLAHAFFP +G  HFD  E +T+G   G NL  VA HE GHA+GL HS+   A+M P+Y GY+  ++FRL DDD +G   LYG
Sbjct:   20 ALEKFQEIAGLPVTGEMDPDTIAQMKKPRCGMPDVDESGLRIRS----WDK----RHLTYHITYGRDLDKDSQRRIFARALQYWSDVSGLSFSPTNNGGSADIKISFGARSHGGPHDGNRCA-----YAFDG-PGKVLAHAFFPSNGRAHFDEDETYTDGTPSGTNLMWVATHEFGHALGLEHSDVRNAVMYPYYTGYV--ANFRLQDDDIRGIQVLYG 222          
BLAST of mmp2 protein vs. Ensembl Nematostella
Match: EDO29931 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T286])

HSP 1 Score: 126.331 bits (316), Expect = 1.219e-33
Identity = 78/219 (35.62%), Postives = 109/219 (49.77%), Query Frame = 2
Query:  137 AVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYG 793
            A+KN Q+ AGL   G++    +A ++  RCG  D      R       W+K        + +  P ++      R    AL +WS  + + F +VS    +   +SF    H      N   ESR   P D  PG VLAHA+FP +G  HFD  E +T+G   GINL  VA HE GHA+GL+HS+   A+M P+Y GY  +  F L +DD +G  + YG
Sbjct:   17 AIKNFQRFAGLEVTGELDDATIAQMKMPRCGDADVDDNGDR-------WNKNALTYHLSYGKDLPNSVQ----DRVFEKALKFWSDGSALSFSRVSDVSKADLKISFGSRSH------NGPGESRCGSPFDG-PGRVLAHAYFPSNGRCHFDEDERYTDGASSGINLLWVATHEFGHALGLHHSDVRNAVMYPYYTGY--KPGFGLQEDDIKGIQAHYG 215          
BLAST of mmp2 protein vs. Ensembl Nematostella
Match: EDO43652 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY78])

HSP 1 Score: 125.946 bits (315), Expect = 5.190e-33
Identity = 79/221 (35.75%), Postives = 109/221 (49.32%), Query Frame = 2
Query:  137 AVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKD--SKKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYG 793
            A+KN Q+ AGL   G + +  +  ++K RCG  D   K K +R     SKW K        + +  P  +      R    AL +W+  + + F +      +   +SF    H+         ES   YP D   G VLAHAF+P +G  HFD  E +T+G  DGINL  VA HE GHA+GL HSN   A+M P+Y  Y  + + +L DDD  G  +LYG
Sbjct:   50 AIKNFQRFAGLKVTGDLDEPTVRQMKKPRCGDPDVDDKGKRRRRYLLASKWRKNALTYHLSYGKDLPNFVQ----DRVFEKALQFWADVSKLSFSRTRYVWNADLKISFGSVTHR------GPGESHCAYPFDGR-GKVLAHAFYPPNGRCHFDDDETYTDGISDGINLLWVATHEFGHALGLEHSNVRGAVMFPYYHSY--QPNLKLHDDDINGIRALYG 257          
BLAST of mmp2 protein vs. Ensembl Medaka
Match: ENSORLT00000039885.1 (matrix metalloproteinase-19-like [Source:NCBI gene;Acc:101156575])

HSP 1 Score: 126.716 bits (317), Expect = 3.227e-31
Identity = 84/234 (35.90%), Postives = 121/234 (51.71%), Query Frame = 2
Query:  104 DYNEKSDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQ-TYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTK 802
            D N   +K+++A++  QK+  +   G +    LA + ++RCG +DS   +         W K   TYR Y     +   + L + ++A+  A   WS  + + F ++   +  +  +SF    H+         +   P P D   G VLAHA  P+SG +HFD+ E WTEGK  G +LR+VAAHE+GHA+GL HS    ALM P Y GY   SDF+L  DD  G  SLYG  K
Sbjct:   48 DVNYPPEKIAEALRIFQKVTNMQMSGNLDSATLAMMNRARCGLEDSFIDNSLSYRVMGYWRKKMLTYRIY----NYTPHLGLEKTRQAIQSAFKLWSDVSPLRFKELQQGRPDI-KISF----HR--------KDKSCPVPFDGR-GRVLAHADAPESGIVHFDADELWTEGKSHGFSLRIVAAHEIGHALGLAHSQYYSALMGPIYSGY--RSDFKLHPDDINGIQSLYGKPK 261          
BLAST of mmp2 protein vs. Ensembl Medaka
Match: ENSORLT00000018958.2 (matrix metalloproteinase-19-like [Source:NCBI gene;Acc:101156575])

HSP 1 Score: 125.946 bits (315), Expect = 3.470e-31
Identity = 84/234 (35.90%), Postives = 121/234 (51.71%), Query Frame = 2
Query:  104 DYNEKSDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQ-TYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTK 802
            D N   +K+++A++  QK+  +   G +    LA + ++RCG +DS   +         W K   TYR Y +       + L + ++A+  A   WS  + + F ++   +  +  +SF    H+         +   P P D   G VLAHA  P+SG +HFD+ E WTEGK  G +LR+VAAHE+GHA+GL HS    ALM P Y GY   SDF+L  DD  G  SLYG  K
Sbjct:    8 DVNYPPEKIAEALRIFQKVTNMQMSGNLDSATLAMMNRARCGLEDSFIDNSLSYRVMGYWRKKMLTYRIYNYTPH----LGLEKTRQAIQSAFKLWSDVSPLRFKELQQGRPDI-KISF----HR--------KDKSCPVPFDGR-GRVLAHADAPESGIVHFDADELWTEGKSHGFSLRIVAAHEIGHALGLAHSQYYSALMGPIYSGY--RSDFKLHPDDINGIQSLYGKPK 221          
BLAST of mmp2 protein vs. Ensembl Medaka
Match: coll (collagenase [Source:NCBI gene;Acc:100049293])

HSP 1 Score: 124.79 bits (312), Expect = 1.450e-30
Identity = 128/462 (27.71%), Postives = 200/462 (43.29%), Query Frame = 2
Query:   14 LVLLSASYFQVEAFESSDEKS-VEKFLSNFYDYNEKS--------DKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQ-TYRF--YIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSG---NLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQ-KELCNTTNINSAFQFADGHVYVVTGNNKVFRILLKNHSLIVDPAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANGLELEN---MALSELNITRFGAFQGRVNAAFVRDKAGKSNTLKF-------WALQDGELIAGRVKGNQVKFSRRTTKLSEILK 1321
            L LL+A +    + E+ +E+   + +L NF++  E++         +++  +  +Q   GL   G +  E LA ++K RCG  DS+           KW+K   TYR   Y  D      MS  E+  ++  AL  W+    + F K+ S    +  +SF    H  Y            YP D  P   LAHAF P  G   + HFD  E +T   + G  L +VAAHE GH++GL HS+DP ALM P Y  Y +   F LP DD +G  SLYG           D A+ E ++    + C++T +  A     G ++    +   F   +   S      F T    +     DA   +    R  +FKG ++++  G +L      A+S   + +      +V+AA    ++GK  TL F       +    G + AG  K    KFS  + +++  L+
Sbjct:    8 LGLLAAVHCMPVSQETMEEQRFAQSYLKNFFNLTEEAGPAVRRGFSQVTSKLIEMQTFFGLQITGTLDAETLAMMKKPRCGVSDSRVARFSTFGNNLKWEKNSLTYRITNYTPD------MSKEEVDESIEKALQVWARVTPLRFTKIYSSTADIM-VSFGQRAHGDY------------YPFDG-PDGTLAHAFAPAPGIGGDAHFDDDETFTFRSNTGYVLFMVAAHEFGHSLGLSHSDDPGALMYPIY-SYRNPETFVLPRDDVRGIQSLYGPNL--------DPAQPEPTAPPTPDACDSTMVLDAVATLRGEMFFFKDS---FFWRVHPQSYTPQQTFITNFWPDAPLSVDAAYENQQSDRIFLFKGRQVWAFRGYDLVQGYPQAISSFGLPKRIE---KVDAALYDAQSGK--TLFFVGRNYYSYDEAKGTMDAGFPKAVDQKFSGMSGRVTAALQ 432          
BLAST of mmp2 protein vs. Ensembl Medaka
Match: ENSORLT00000025461.2 (collagenase 3-like [Source:NCBI gene;Acc:101159886])

HSP 1 Score: 124.405 bits (311), Expect = 1.941e-30
Identity = 113/385 (29.35%), Postives = 165/385 (42.86%), Query Frame = 2
Query:    8 IFLVLLSASYFQVEAFESSDEKSVEKFLSNFYDYNEKS--------DKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQ-TYRF--YIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSG---NLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYG-GYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTTNINSAFQFADGHVYVVTGNNKVF----RILLKNHSLIVDPAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANG 1105
            + L+L +A    V A    +    E +L  F++  E+S          +S  ++ +Q+  GL   G +  + L  ++K RCG  D             KW K   TYR   Y  D      MS  E+Q ++  AL  W++   + F + +S    +  +SF    H  Y            YP D  P   LAHAF P SG   ++HFD  E +T     G  L +VAAHE GH++GL HS+D  ALM P Y  GY     F LP DD +G  SLYG        V+S  A   Q  +  E C++  +  A     G + +    N VF     +  K+   ++  AF      N   + DA   D       +FKGN++++  G
Sbjct:    8 VLLLLAAAVSCSVSAAAVEEPSFAETYLKRFFNLTEQSGPSARWGVSPMSRRLREMQRFFGLQVTGTLDTDTLEVMKKPRCGIPDINIGQFSTFGNNVKWQKNTLTYRIVNYTPD------MSQAEVQDSIQRALQVWASVTPLRFTRTNSGPADIM-VSFGRGAHGDY------------YPFDG-PHGTLAHAFSPSSGIGGDVHFDDDETFTFRSSKGYVLFMVAAHEFGHSLGLSHSSDRGALMYPLYSFGY--PDTFVLPKDDVRGIQSLYGPNS-----VQSPLASAPQPPSTTESCDSAVVLDAGTTYQGELLLF--QNSVFWQWDPLSGKSEKRLITDAFP-----NAPVNIDAAYEDPQSGNIFLFKGNRVWAFTG 358          
BLAST of mmp2 protein vs. Ensembl Medaka
Match: mmp19 (matrix metallopeptidase 19 [Source:NCBI gene;Acc:101162361])

HSP 1 Score: 122.094 bits (305), Expect = 1.382e-29
Identity = 84/225 (37.33%), Postives = 118/225 (52.44%), Query Frame = 2
Query:  122 DKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKW-DKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYG 793
            +++ +A++  Q++  LP  G++ +  LA + + RCG +D   K         +W  K  TYR Y     +   M   ++  A+  A  YWS    + F +V   +  +  +SF    HK  D H +        P D   G+VLAHA  P+SG +HFD  E WTE    G NLR+VAAHE+GHA+GL HS    ALMAP Y GY   ++FRL  DD QG  +LYG
Sbjct:   56 EEVIEALRVFQRVNDLPPSGELDEATLAVMRQPRCGMEDPFNKKLHKFRIMGRWRKKNLTYRIY----NYTPDMKQSDVSAAIRSAFKYWSDVTPLTFKEVDYGRADI-KISF----HKK-DGHCSV-------PFDGR-GHVLAHAESPESGIVHFDEDEFWTEQSYYGTNLRIVAAHEIGHALGLGHSQFRSALMAPVYAGY--RANFRLHSDDVQGIQALYG 260          
BLAST of mmp2 protein vs. Planmine SMEST
Match: SMESG000014326.1 (SMESG000014326.1)

HSP 1 Score: 1041.57 bits (2692), Expect = 0.000e+0
Identity = 502/502 (100.00%), Postives = 502/502 (100.00%), Query Frame = 2
Query:    2 SLIFLVLLSASYFQVEAFESSDEKSVEKFLSNFYDYNEKSDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTTNINSAFQFADGHVYVVTGNNKVFRILLKNHSLIVDPAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANGLELENMALSELNITRFGAFQGRVNAAFVRDKAGKSNTLKFWALQDGELIAGRVKGNQVKFSRRTTKLSEILKMPTGTKTLSNIDGAFVLGKKDNKRLILFVGNSVYVGNPNGRKLVKYSIPAQYPKTFKQIIHC 1507
            SLIFLVLLSASYFQVEAFESSDEKSVEKFLSNFYDYNEKSDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTTNINSAFQFADGHVYVVTGNNKVFRILLKNHSLIVDPAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANGLELENMALSELNITRFGAFQGRVNAAFVRDKAGKSNTLKFWALQDGELIAGRVKGNQVKFSRRTTKLSEILKMPTGTKTLSNIDGAFVLGKKDNKRLILFVGNSVYVGNPNGRKLVKYSIPAQYPKTFKQIIHC
Sbjct:    3 SLIFLVLLSASYFQVEAFESSDEKSVEKFLSNFYDYNEKSDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTTNINSAFQFADGHVYVVTGNNKVFRILLKNHSLIVDPAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANGLELENMALSELNITRFGAFQGRVNAAFVRDKAGKSNTLKFWALQDGELIAGRVKGNQVKFSRRTTKLSEILKMPTGTKTLSNIDGAFVLGKKDNKRLILFVGNSVYVGNPNGRKLVKYSIPAQYPKTFKQIIHC 504          
BLAST of mmp2 protein vs. Planmine SMEST
Match: SMESG000014326.1 (SMESG000014326.1)

HSP 1 Score: 1018.45 bits (2632), Expect = 0.000e+0
Identity = 491/493 (99.59%), Postives = 491/493 (99.59%), Query Frame = 2
Query:   29 ASYFQVEAFESSDEKSVEKFLSNFYDYNEKSDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTTNINSAFQFADGHVYVVTGNNKVFRILLKNHSLIVDPAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANGLELENMALSELNITRFGAFQGRVNAAFVRDKAGKSNTLKFWALQDGELIAGRVKGNQVKFSRRTTKLSEILKMPTGTKTLSNIDGAFVLGKKDNKRLILFVGNSVYVGNPNGRKLVKYSIPAQYPKTFKQIIHC 1507
             S FQVEAFESSDEKSVEKFLSNFYDYNEKSDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTTNINSAFQFADGHVYVVTGNNKVFRILLKNHSLIVDPAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANGLELENMALSELNITRFGAFQGRVNAAFVRDKAGKSNTLKFWALQDGELIAGRVKGNQVKFSRRTTKLSEILKMPTGTKTLSNIDGAFVLGKKDNKRLILFVGNSVYVGNPNGRKLVKYSIPAQYPKTFKQIIHC
Sbjct:   12 VSDFQVEAFESSDEKSVEKFLSNFYDYNEKSDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTTNINSAFQFADGHVYVVTGNNKVFRILLKNHSLIVDPAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANGLELENMALSELNITRFGAFQGRVNAAFVRDKAGKSNTLKFWALQDGELIAGRVKGNQVKFSRRTTKLSEILKMPTGTKTLSNIDGAFVLGKKDNKRLILFVGNSVYVGNPNGRKLVKYSIPAQYPKTFKQIIHC 504          
BLAST of mmp2 protein vs. Planmine SMEST
Match: SMESG000040772.1 (SMESG000040772.1)

HSP 1 Score: 507.679 bits (1306), Expect = 6.449e-177
Identity = 247/499 (49.50%), Postives = 349/499 (69.94%), Query Frame = 2
Query:   14 LVLLSASYF-QVEAFESSDEKSVEKFLSNFYDYNEKSDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTTNINSAFQFADGHVYVVTGNNKVFRILLKNHSLIVDPAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANGLELENMALSELNITRFGAFQGRVNAAFVRDKAGKSNTLKFWALQDGELIAGRVKGNQVKFSRRTTKLSEILKMPTGTKTLSNIDGAFVLGKKDNKRLILFVGNSVYVGNPNGRKLVKYSIPAQYPKTFKQIIHC 1507
            +VLLS  +F  V +F+SS+EK  EK+L+ FYDY++ +  L D++K++QKMAG+  DGK++ E+++H+ K RCGGKD  KKSKRY AA ++WD+G TY++Y+H +  P TMS  E++RA+ +AL+YW   +++ F     K G MFS+SF+  +H  YDV+ NF  S+DPYPLDNVP  VLAHAFFP++GNLH+D+AE WTEGKD GINLR+V AHEMGHAIGL+HSNDP ALMAPWYGGYISE+D+RLP+DD+ GA SLYG    GKR +     KR+    Q  LCN  N +  F F+D   YV+   + +FR+   N    VD  F+ ++++  + ++D++ YD   +R VVFKG+K++SA+G +++ + + E+ I   GA+ G+ +AAF R  + +     FW +QD E+I+G +  N++ FSRR   LSE++ M  G K   +ID A + G+KDN +L LFVGNS YVG P GRK  +YSI A YPK++KQ++ C
Sbjct:    5 IVLLSTLFFLSVHSFKSSEEKDAEKYLTEFYDYDKSTGSLKDSLKDLQKMAGIEADGKLSDEVISHMNKGRCGGKDKDKKSKRYVAANARWDRGVTYKYYLHLDWMPRTMSEAEVRRAIQVALDYWVRVSNLGFAASRDKAGCMFSVSFSGRDHLQYDVNKNFQPSKDPYPLDNVPSGVLAHAFFPRNGNLHYDNAETWTEGKDSGINLRIVTAHEMGHAIGLHHSNDPSALMAPWYGGYISEADYRLPNDDTLGAQSLYG--ARGKRAL--PLKKRDLGKLQSRLCNAKNYDGVFAFSDDKTYVIADGSNLFRLDGTN----VDETFEPVEINEALKNADSMFYDKVNKRLVVFKGDKVYSASGSDVKTLKVEEMKIGGHGAYLGKSSAAFARQVSAEEGMQYFWLIQDNEVISGELLKNKIVFSRRARPLSEVITMSNGAKFPPSIDAALLSGEKDNLQLYLFVGNSYYVGKPTGRKQFQYSISADYPKSYKQVLKC 495          
BLAST of mmp2 protein vs. Planmine SMEST
Match: SMESG000040780.1 (SMESG000040780.1)

HSP 1 Score: 501.901 bits (1291), Expect = 1.931e-174
Identity = 243/499 (48.70%), Postives = 343/499 (68.74%), Query Frame = 2
Query:   14 LVLLSASYF-QVEAFESSDEKSVEKFLSNFYDYNEKSDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTTNINSAFQFADGHVYVVTGNNKVFRILLKNHSLIVDPAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANGLELENMALSELNITRFGAFQGRVNAAFVRDKAGKSNTLKFWALQDGELIAGRVKGNQVKFSRRTTKLSEILKMPTGTKTLSNIDGAFVLGKKDNKRLILFVGNSVYVGNPNGRKLVKYSIPAQYPKTFKQIIHC 1507
            +VLLS  +F  V +F+SS+EK  EK+L+ FYDY++ +  L D++K++QKMAG+  DGK++ E+++H+ K RCG KD  KKSKRY A   KWD+G TY++Y+H +  P TMS  E++RA+ +AL+YW   +++ F     K G MFS+SFA  +H++YDV+NNF   +D  PLDNVP  VLAH F+PK+GNLH+D+AE WTEG D GINLR+V AHEMGHAIGL HSNDP ALMAPWYGGYISE+D+RLP+DD+ GA SLYG    GKR +     KR+    Q  LCN  N +  F F+D   YV+   + +FR+   N    VD  F+ ++++  + ++D++ YD   +R VVFKG+K++SA+G +++ + + E+ I   GA+ G+ +AAF R  + +     FW +QD E+I+G +  N++ FSRR   LSE++ M  G K   +ID A + G+KDN +L LFVGNS YVG P GRK  +YSI A YPK++KQ++ C
Sbjct:   24 IVLLSTLFFLSVHSFKSSEEKDAEKYLTEFYDYDKSTGSLKDSLKDLQKMAGIEADGKLSDEVISHMNKGRCGDKDKDKKSKRYVAHAKKWDRGVTYKYYLHLDWMPRTMSEAEVRRAIQVALDYWVQVSNLGFAASRDKAGCMFSVSFAGRDHELYDVYNNFQSRKDHIPLDNVPSGVLAHGFYPKNGNLHYDNAETWTEGTDSGINLRIVTAHEMGHAIGLKHSNDPSALMAPWYGGYISEADYRLPNDDTLGAQSLYG--ARGKRAL--PLKKRDLGKLQSRLCNAKNYDGVFAFSDDKTYVIADGSNLFRLDGTN----VDETFEPVEINEALKNADSMFYDKVNKRLVVFKGDKVYSASGSDVKTLKVEEMKIGGHGAYLGKSSAAFARQVSAEEGMQYFWLIQDNEVISGELLKNKIVFSRRARPLSEVITMSNGAKFPPSIDAALLSGEKDNLQLYLFVGNSYYVGKPTGRKQFQYSISADYPKSYKQVLKC 514          
BLAST of mmp2 protein vs. Planmine SMEST
Match: SMESG000040780.1 (SMESG000040780.1)

HSP 1 Score: 501.516 bits (1290), Expect = 2.238e-174
Identity = 243/499 (48.70%), Postives = 343/499 (68.74%), Query Frame = 2
Query:   14 LVLLSASYF-QVEAFESSDEKSVEKFLSNFYDYNEKSDKLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQTYRFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTTNINSAFQFADGHVYVVTGNNKVFRILLKNHSLIVDPAFKTIQLSNQIFDSDALLYDYSGRRFVVFKGNKIFSANGLELENMALSELNITRFGAFQGRVNAAFVRDKAGKSNTLKFWALQDGELIAGRVKGNQVKFSRRTTKLSEILKMPTGTKTLSNIDGAFVLGKKDNKRLILFVGNSVYVGNPNGRKLVKYSIPAQYPKTFKQIIHC 1507
            +VLLS  +F  V +F+SS+EK  EK+L+ FYDY++ +  L D++K++QKMAG+  DGK++ E+++H+ K RCG KD  KKSKRY A   KWD+G TY++Y+H +  P TMS  E++RA+ +AL+YW   +++ F     K G MFS+SFA  +H++YDV+NNF   +D  PLDNVP  VLAH F+PK+GNLH+D+AE WTEG D GINLR+V AHEMGHAIGL HSNDP ALMAPWYGGYISE+D+RLP+DD+ GA SLYG    GKR +     KR+    Q  LCN  N +  F F+D   YV+   + +FR+   N    VD  F+ ++++  + ++D++ YD   +R VVFKG+K++SA+G +++ + + E+ I   GA+ G+ +AAF R  + +     FW +QD E+I+G +  N++ FSRR   LSE++ M  G K   +ID A + G+KDN +L LFVGNS YVG P GRK  +YSI A YPK++KQ++ C
Sbjct:   20 IVLLSTLFFLSVHSFKSSEEKDAEKYLTEFYDYDKSTGSLKDSLKDLQKMAGIEADGKLSDEVISHMNKGRCGDKDKDKKSKRYVAHAKKWDRGVTYKYYLHLDWMPRTMSEAEVRRAIQVALDYWVQVSNLGFAASRDKAGCMFSVSFAGRDHELYDVYNNFQSRKDHIPLDNVPSGVLAHGFYPKNGNLHYDNAETWTEGTDSGINLRIVTAHEMGHAIGLKHSNDPSALMAPWYGGYISEADYRLPNDDTLGAQSLYG--ARGKRAL--PLKKRDLGKLQSRLCNAKNYDGVFAFSDDKTYVIADGSNLFRLDGTN----VDETFEPVEINEALKNADSMFYDKVNKRLVVFKGDKVYSASGSDVKTLKVEEMKIGGHGAYLGKSSAAFARQVSAEEGMQYFWLIQDNEVISGELLKNKIVFSRRARPLSEVITMSNGAKFPPSIDAALLSGEKDNLQLYLFVGNSYYVGKPTGRKQFQYSISADYPKSYKQVLKC 510          
The following BLAST results are available for this feature:
BLAST of mmp2 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MMP75.661e-3334.24matrix metallopeptidase 7 [Source:HGNC Symbol;Acc:... [more]
MMP201.778e-3237.07matrix metallopeptidase 20 [Source:HGNC Symbol;Acc... [more]
MMP254.175e-3034.15matrix metallopeptidase 25 [Source:HGNC Symbol;Acc... [more]
MMP36.825e-2927.08matrix metallopeptidase 3 [Source:HGNC Symbol;Acc:... [more]
MMP81.867e-2827.50matrix metallopeptidase 8 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of mmp2 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zmp-51.011e-2130.38Zinc MetalloProtease [Source:UniProtKB/TrEMBL;Acc... [more]
zmp-33.046e-2031.84Matrix metalloproteinase-C [Source:UniProtKB/Swis... [more]
zmp-17.881e-2025.26Matrix metalloproteinase-A [Source:UniProtKB/Swis... [more]
zmp-65.407e-1831.18MMP-like protein; Zinc MetalloProtease [Source:Un... [more]
zmp-26.107e-1530.61Matrix metalloproteinase-B [Source:UniProtKB/Swis... [more]
back to top
BLAST of mmp2 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mmp12.011e-3029.61gene:FBgn0035049 transcript:FBtr0306656[more]
Mmp12.011e-3029.61gene:FBgn0035049 transcript:FBtr0304010[more]
Mmp12.073e-3029.61gene:FBgn0035049 transcript:FBtr0304008[more]
Mmp12.480e-3029.61gene:FBgn0035049 transcript:FBtr0304009[more]
Mmp12.480e-3029.61gene:FBgn0035049 transcript:FBtr0304011[more]
back to top
BLAST of mmp2 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mmp192.956e-3038.57matrix metallopeptidase 19 [Source:ZFIN;Acc:ZDB-GE... [more]
mmp249.501e-3034.47matrix metallopeptidase 24 [Source:ZFIN;Acc:ZDB-GE... [more]
mmp241.074e-2934.47matrix metallopeptidase 24 [Source:ZFIN;Acc:ZDB-GE... [more]
mmp20a2.258e-2931.23matrix metallopeptidase 20a (enamelysin) [Source:Z... [more]
mmp20a3.541e-2930.58matrix metallopeptidase 20a (enamelysin) [Source:Z... [more]
back to top
BLAST of mmp2 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rexo21.370e-3432.74RNA exonuclease 2 [Source:Xenbase;Acc:XB-GENE-9945... [more]
MMP209.105e-3435.57matrix metallopeptidase 20 [Source:NCBI gene;Acc:1... [more]
MMP202.572e-3335.57matrix metallopeptidase 20 [Source:NCBI gene;Acc:1... [more]
MMP203.601e-3332.88matrix metallopeptidase 20 [Source:NCBI gene;Acc:1... [more]
MMP205.509e-3335.18matrix metallopeptidase 20 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of mmp2 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mmp192.909e-3430.15matrix metallopeptidase 19 [Source:MGI Symbol;Acc:... [more]
Mmp201.063e-3237.34matrix metallopeptidase 20 (enamelysin) [Source:MG... [more]
Mmp255.192e-3235.54matrix metallopeptidase 25 [Source:MGI Symbol;Acc:... [more]
Mmp72.116e-3033.87matrix metallopeptidase 7 [Source:MGI Symbol;Acc:M... [more]
Mmp197.176e-2932.27matrix metallopeptidase 19 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of mmp2 protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JHI0|MMP19_MOUSE2.035e-3330.15Matrix metalloproteinase-19 OS=Mus musculus OX=100... [more]
sp|P09237|MMP7_HUMAN2.719e-3234.24Matrilysin OS=Homo sapiens OX=9606 GN=MMP7 PE=1 SV... [more]
sp|O18767|MMP20_BOVIN4.315e-3237.39Matrix metalloproteinase-20 OS=Bos taurus OX=9913 ... [more]
sp|P57748|MMP20_MOUSE7.438e-3237.34Matrix metalloproteinase-20 OS=Mus musculus OX=100... [more]
sp|O60882|MMP20_HUMAN8.537e-3237.07Matrix metalloproteinase-20 OS=Homo sapiens OX=960... [more]
back to top
BLAST of mmp2 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K0JBI80.000e+099.60Mmp2 protein OS=Schmidtea mediterranea OX=79327 GN... [more]
K0JBS31.039e-17449.90Mmp1 protein OS=Schmidtea mediterranea OX=79327 GN... [more]
H9GM694.209e-3731.03Matrix metallopeptidase 19 OS=Anolis carolinensis ... [more]
A0A336MF575.958e-3731.85CSON000784 protein OS=Culicoides sonorensis OX=179... [more]
A0A336MHW66.349e-3731.85CSON000784 protein OS=Culicoides sonorensis OX=179... [more]
back to top
BLAST of mmp2 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000030273.12.387e-3626.97matrix metalloproteinase-19 [Source:NCBI gene;Acc:... [more]
ENSAMXT00000007864.22.679e-3628.17matrix metalloproteinase-19 [Source:NCBI gene;Acc:... [more]
mmp192.149e-3337.77matrix metalloproteinase-19 [Source:NCBI gene;Acc:... [more]
mmp192.149e-3337.77matrix metalloproteinase-19 [Source:NCBI gene;Acc:... [more]
mmp247.469e-3130.75matrix metallopeptidase 24 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of mmp2 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MMP142.726e-2834.73matrix metallopeptidase 14 [Source:HGNC Symbol;Acc... [more]
mmp194.687e-2634.85matrix metallopeptidase 19 [Source:ZFIN;Acc:ZDB-GE... [more]
mmp195.318e-2640.37matrix metallopeptidase 19 [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000001966.12.782e-2532.48pep scaffold:Pmarinus_7.0:GL476330:946825:981591:-... [more]
ENSPMAT00000005331.11.271e-2228.09pep scaffold:Pmarinus_7.0:GL476741:9169:28768:-1 g... [more]
back to top
BLAST of mmp2 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of mmp2 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO466631.430e-3637.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411676.109e-3426.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487567.872e-3436.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO299311.219e-3335.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436525.190e-3335.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of mmp2 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000039885.13.227e-3135.90matrix metalloproteinase-19-like [Source:NCBI gene... [more]
ENSORLT00000018958.23.470e-3135.90matrix metalloproteinase-19-like [Source:NCBI gene... [more]
coll1.450e-3027.71collagenase [Source:NCBI gene;Acc:100049293][more]
ENSORLT00000025461.21.941e-3029.35collagenase 3-like [Source:NCBI gene;Acc:101159886... [more]
mmp191.382e-2937.33matrix metallopeptidase 19 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of mmp2 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014326.10.000e+0100.00SMESG000014326.1[more]
SMESG000014326.10.000e+099.59SMESG000014326.1[more]
SMESG000040772.16.449e-17749.50SMESG000040772.1[more]
SMESG000040780.11.931e-17448.70SMESG000040780.1[more]
SMESG000040780.12.238e-17448.70SMESG000040780.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30019680
GenBankCCC86589.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019680 ID=SMED30019680|Name=mmp2 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1562bp
TAGCTTAATATTTCTTGTTTTACTATCAGCTTCATATTTTCAAGTAGAAG
CTTTTGAATCGAGTGACGAAAAATCTGTAGAAAAATTTCTTAGTAATTTC
TATGATTACAACGAAAAATCCGACAAATTGAGTGATGCTGTAAAAAACAT
TCAGAAAATGGCCGGCTTACCAACAGACGGAAAAATTACGAAGGAATTAT
TGGCTCACGTTGAAAAAAGTCGATGCGGAGGAAAAGACAGCAAGAAAAAA
AGCAAAAGATATAATGCAGCACAAAGTAAATGGGATAAAGGGCAAACCTA
TAGATTTTATATACACGATGAACGACACCCAACAACAATGTCATTAGGGG
AAATTCAACGAGCTCTAATAATTGCTTTGAATTATTGGTCAACAGCAGCA
GATATATACTTCGGAAAAGTTAGCAGTAAACAAGGATCTATGTTTTCTTT
GAGTTTTGCTGATGCTGAACATAAAATGTACGATGTTCACAACAATTTTG
CAGAGTCTAGAGATCCATATCCATTGGATAATGTACCTGGAAATGTTTTG
GCACACGCTTTTTTCCCAAAAAGTGGAAATTTACATTTCGATTCAGCTGA
AGAATGGACTGAAGGTAAAGATGATGGAATTAATCTTCGCGTAGTTGCTG
CCCATGAAATGGGACACGCTATTGGCTTGTATCATAGTAATGATCCAAAA
GCATTAATGGCTCCATGGTATGGTGGATATATTTCTGAAAGTGATTTCCG
TCTTCCTGACGACGATTCTCAAGGAGCAATTTCTCTTTATGGAAATACGA
AAAATGGAAAACGATTCGTTCGAAGTGACAGAGCAAAACGAGAACAGTCA
AGCAATCAAAAAGAACTGTGCAACACTACTAATATTAATTCAGCTTTCCA
ATTTGCTGATGGCCATGTCTATGTTGTGACGGGTAATAACAAAGTGTTTA
GAATTCTTCTCAAAAATCATTCACTCATTGTGGACCCGGCTTTTAAAACA
ATACAATTATCAAACCAAATCTTCGATTCAGACGCTTTACTATATGATTA
CTCTGGTAGACGATTTGTTGTCTTTAAAGGAAATAAAATATTTTCGGCCA
ATGGATTAGAACTAGAAAATATGGCTTTATCCGAATTGAATATAACTCGA
TTTGGAGCTTTCCAAGGCCGAGTTAATGCGGCTTTTGTCAGAGATAAAGC
TGGAAAATCTAACACCTTGAAATTCTGGGCACTTCAAGACGGAGAATTGA
TTGCGGGAAGAGTTAAAGGAAACCAAGTAAAATTCTCTCGTCGAACAACC
AAATTGTCAGAAATCTTGAAAATGCCAACTGGCACAAAAACTCTATCAAA
CATTGATGGGGCATTTGTATTAGGGAAAAAGGATAACAAGCGACTGATCT
TATTTGTTGGAAACAGTGTTTATGTTGGAAATCCCAACGGAAGAAAACTT
GTCAAATACAGTATTCCTGCACAATATCCGAAAACATTTAAACAAATTAT
TCATTGCTAGACAAATCTAAATTTATCTTTTAAATAAATATTTGTTTAAA
TTTAAAAAAAAA
back to top

protein sequence of SMED30019680-orf-1

>SMED30019680-orf-1 ID=SMED30019680-orf-1|Name=SMED30019680-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=503bp
SLIFLVLLSASYFQVEAFESSDEKSVEKFLSNFYDYNEKSDKLSDAVKNI
QKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKWDKGQTY
RFYIHDERHPTTMSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSL
SFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAE
EWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFR
LPDDDSQGAISLYGNTKNGKRFVRSDRAKREQSSNQKELCNTTNINSAFQ
FADGHVYVVTGNNKVFRILLKNHSLIVDPAFKTIQLSNQIFDSDALLYDY
SGRRFVVFKGNKIFSANGLELENMALSELNITRFGAFQGRVNAAFVRDKA
GKSNTLKFWALQDGELIAGRVKGNQVKFSRRTTKLSEILKMPTGTKTLSN
IDGAFVLGKKDNKRLILFVGNSVYVGNPNGRKLVKYSIPAQYPKTFKQII
HC*
back to top
Aliases
The feature 'mmp2 protein' has the following synonyms
Synonym
mmp2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000141dorsal region of the whole animal
PLANA:0000143ventral region of the whole animal
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0000488basophilic gland cell
Vocabulary: INTERPRO
TermDefinition
IPR033739M10A_MMP
IPR036365PGBD-like_sf
IPR036375Hemopexin-like_dom_sf
IPR021190Pept_M10A
IPR006026Peptidase_Metallo
IPR000585Hemopexin-like_dom
IPR024079MetalloPept_cat_dom_sf
IPR001818Pept_M10_metallopeptidase
IPR002477Peptidoglycan-bd-like
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0004222metalloendopeptidase activity
GO:0008270zinc ion binding
GO:0008237metallopeptidase activity
GO:0008233peptidase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0031012extracellular matrix
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR021190Peptidase M10APRINTSPR00138MATRIXINcoord: 122..137
score: 26.22
coord: 215..240
score: 65.53
coord: 251..264
score: 54.36
coord: 70..83
score: 32.58
IPR021190Peptidase M10APIRSFPIRSF001191MMP_stromelysincoord: 9..411
e-value: 9.7E-68
score: 226.6
coord: 422..501
e-value: 0.11
score: 8.6
IPR006026Peptidase, metallopeptidaseSMARTSM00235col_5coord: 90..265
e-value: 7.8E-23
score: 91.9
IPR001818Peptidase M10, metallopeptidasePFAMPF00413Peptidase_M10coord: 93..264
e-value: 4.8E-33
score: 114.2
IPR024079Metallopeptidase, catalytic domain superfamilyGENE3DG3DSA:3.40.390.10coord: 13..270
e-value: 4.8E-56
score: 191.9
NoneNo IPR availablePANTHERPTHR10201:SF237MATRIX METALLOPROTEINASE-RELATEDcoord: 27..474
NoneNo IPR availablePANTHERPTHR10201MATRIX METALLOPROTEINASEcoord: 27..474
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.78
NoneNo IPR availableSUPERFAMILYSSF55486Metalloproteases ("zincins"), catalytic domaincoord: 86..267
IPR033739Peptidase M10A, catalytic domainCDDcd04278ZnMc_MMPcoord: 93..264
e-value: 8.29875E-46
score: 155.44
IPR036365PGBD-like superfamilySUPERFAMILYSSF47090PGBD-likecoord: 18..79
IPR036375Hemopexin-like domain superfamilySUPERFAMILYSSF50923Hemopexin-like domaincoord: 286..483