ATP-dependent RNA helicase, putative

Overview
NameATP-dependent RNA helicase, putative
Smed IDSMED30019670
Length (bp)1982
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-dependent RNA helicase, putative (SMED30019670) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-dependent RNA helicase, putative (SMED30019670) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-dependent RNA helicase, putative (SMED30019670) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-dependent RNA helicase, putative (SMED30019670) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019670

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30019670h1SMcG0017505 Contig30872uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30019670h1SMcG0017505 Contig30872newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30019670h1SMcG0017505 dd_Smed_v4_6982_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Human
Match: DHX33 (DEAH-box helicase 33 [Source:HGNC Symbol;Acc:HGNC:16718])

HSP 1 Score: 401.749 bits (1031), Expect = 2.506e-130
Identity = 226/570 (39.65%), Postives = 346/570 (60.70%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFF-GENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEI----RRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSV-NVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCR 1758
            SLPI+  + Q+L  ++  DN ++I  TGSGKTTQIP++LY   +++  +I ++QPRR+A IS+ATRVS+E   E+G+ VGY+VRF+  +++ T+IKF+TDG++LREA+ D LL+ Y+ +ILDE HERT++ D+LFGVV  AQK RK+    PLK ++MSATMD   F  +F G    Y  ++   HP+ +    Q  +DY+  +++  FQ+H    +A  S+D        IL+FLTG++EI    + C DI      K + D    + V PLY++LP   Q+L V +      R VI+STNIAETSITI G++ V+D G  K K  +P SGLE L ++ +S+ QA QR GRA R   GIC+RLYT+  FE    K T+ E+ R NLA+  L +  +   +VL F ++ KP  + ++ +I  L  L A++  D   +  +T +G+ +  FPL+P+FA  +L S KF   C  ++  +V++L+V + + H   S R+ V  V ++F S  GD +++L IYR F  L      + WC+++ +    M     V  QL++IC  + +P+ + R
Sbjct:   73 SLPIFQARGQLLAQLRNLDNAVLIGETGSGKTTQIPQYLYEGGISRQGIIAVTQPRRVAAISLATRVSDEKRTELGKLVGYTVRFDDVTSEDTRIKFLTDGMLLREAISDSLLRKYSCVILDEAHERTIHTDVLFGVVKAAQKRRKELGKLPLKVIVMSATMDVDLFSQYFNGAPVLY--LEGRQHPIQVFYTKQPQNDYLHAALVSVFQIHQ---EAPSSQD--------ILVFLTGQEEIEAMSKTCRDI-----AKHLPDGCPAMLVLPLYASLPYA-QQLRVFQGAPKGYRKVIISTNIAETSITITGIKYVVDTGMVKAKKYNPDSGLEVLAVQRVSKTQAWQRTGRAGREDSGICYRLYTEDEFEK-FDKMTVPEIQRCNLASVMLQLLAMKVPNVLTFDFMSKPSPDHIQAAIAQLDLLGALEHKD--DQLTLTPMGRKMAAFPLEPKFAKTILMSPKFH--CTEEILTIVSLLSV-DSVLHNPPSRREEVQGVRKKFISSEGDHMTLLNIYRTFKNLGG---NKDWCKENFVNSKNMTLVAEVRAQLRDICLKMSMPIASSR 614          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Human
Match: DHX35 (DEAH-box helicase 35 [Source:HGNC Symbol;Acc:HGNC:15861])

HSP 1 Score: 355.525 bits (911), Expect = 6.604e-113
Identity = 204/591 (34.52%), Postives = 334/591 (56.51%), Query Frame = 1
Query:   19 IKHKPFAKKIKNDEICSLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDD-VNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTK-RTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYN---------VIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHK-GLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITE-LGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKT 1752
            + + P+A      +   LP++  ++ IL  I+     +++  TG GK+TQIP++L       +G+++G++QPRR+A +++A RV+EE    +G  VGY +RF+  + +  T+IKF+TDG+++RE ++DPLL  Y++++LDE HERT+  D+  G++   QK R       L+ ++ SAT+D   F +FF +N   +          ++    P+ +  L     DY++++V    ++H    Q E   D        +L FLTG++E+     +LIE+++ L R   K  L V P+Y+ LPS  +++ V E      R VIV+TN+AETSITI G+  VIDCGF K +  +P + +E L + P+SQA A QRAGR  R   G C+RLYT+  F+  +P+ T+ E+ R+NLA   L +  LG  +VL+F ++  P    + +++ +L  L  +D+     + ++TE LG  +  FPL+P FA  LLES  F   C  ++ ++ AM+ +        N    ++ V R+F    GD ++ML IY AF K N  D K  WC++H + Y  + RA  V +QLK++     +P K+
Sbjct:   37 VVYNPYAALSIEQQRQKLPVFKLRNHILYLIENYQTVVIVGETGCGKSTQIPQYLAEAGWTAEGRVVGVTQPRRVAAVTVAGRVAEERGAVLGHEVGYCIRFDDCTDQLATRIKFLTDGMLVREMMVDPLLTKYSVIMLDEAHERTLYTDIAIGLLKKIQKKR-----GDLRLIVASATLDADKFRDFFNQNETSDPARDTCVILTVEGRTFPVDIFYLQSPVPDYIKSTVETVVKIH----QTEGDGD--------VLAFLTGQEEVETVVSMLIEQARALARTGMKRHLRVLPMYAGLPS-FEQMKVFERVSRSVRKVIVATNVAETSITISGIVYVIDCGFVKLRAYNPRTAIECLVVVPVSQASANQRAGRGGRSRSGKCYRLYTEEAFDK-LPQSTVPEMQRSNLAPVILQLKALGIDNVLRFHFMSPPPAQSMVQALELLYALGGLDK-----DCRLTEPLGMRIAEFPLNPMFAKMLLESGNF--GCSQEILSIAAMMQIQNIFVVPPNQKSHAIRVHRKFAVEEGDHLTMLNIYEAFIKHNK-DSK--WCQEHFLNYKGLVRAATVREQLKKLLVKFQVPRKS 598          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Human
Match: DHX35 (DEAH-box helicase 35 [Source:HGNC Symbol;Acc:HGNC:15861])

HSP 1 Score: 354.755 bits (909), Expect = 2.420e-112
Identity = 204/591 (34.52%), Postives = 334/591 (56.51%), Query Frame = 1
Query:   19 IKHKPFAKKIKNDEICSLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDD-VNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTK-RTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYN---------VIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHK-GLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITE-LGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKT 1752
            + + P+A      +   LP++  ++ IL  I+     +++  TG GK+TQIP++L       +G+++G++QPRR+A +++A RV+EE    +G  VGY +RF+  + +  T+IKF+TDG+++RE ++DPLL  Y++++LDE HERT+  D+  G++   QK R       L+ ++ SAT+D   F +FF +N   +          ++    P+ +  L     DY++++V    ++H    Q E   D        +L FLTG++E+     +LIE+++ L R   K  L V P+Y+ LPS  +++ V E      R VIV+TN+AETSITI G+  VIDCGF K +  +P + +E L + P+SQA A QRAGR  R   G C+RLYT+  F+  +P+ T+ E+ R+NLA   L +  LG  +VL+F ++  P    + +++ +L  L  +D+     + ++TE LG  +  FPL+P FA  LLES  F   C  ++ ++ AM+ +        N    ++ V R+F    GD ++ML IY AF K N  D K  WC++H + Y  + RA  V +QLK++     +P K+
Sbjct:   37 VVYNPYAALSIEQQRQKLPVFKLRNHILYLIENYQTVVIVGETGCGKSTQIPQYLAEAGWTAEGRVVGVTQPRRVAAVTVAGRVAEERGAVLGHEVGYCIRFDDCTDQLATRIKFLTDGMLVREMMVDPLLTKYSVIMLDEAHERTLYTDIAIGLLKKIQKKR-----GDLRLIVASATLDADKFRDFFNQNETSDPARDTCVILTVEGRTFPVDIFYLQSPVPDYIKSTVETVVKIH----QTEGDGD--------VLAFLTGQEEVETVVSMLIEQARALARTGMKRHLRVLPMYAGLPS-FEQMKVFERVSRSVRKVIVATNVAETSITISGIVYVIDCGFVKLRAYNPRTAIECLVVVPVSQASANQRAGRGGRSRSGKCYRLYTEEAFDK-LPQSTVPEMQRSNLAPVILQLKALGIDNVLRFHFMSPPPAQSMVQALELLYALGGLDK-----DCRLTEPLGMRIAEFPLNPMFAKMLLESGNF--GCSQEILSIAAMMQIQNIFVVPPNQKSHAIRVHRKFAVEEGDHLTMLNIYEAFIKHNK-DSK--WCQEHFLNYKGLVRAATVREQLKKLLVKFQVPRKS 598          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Human
Match: DHX8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:1659])

HSP 1 Score: 349.747 bits (896), Expect = 2.917e-106
Identity = 203/568 (35.74%), Postives = 328/568 (57.75%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREETI 1770
            SLPIY  K+Q+++ +      IVI  TGSGKTTQI ++L          IG +QPRR+A +S+A RVSEE  C +G+ VGY++RFE  ++  T IK+MTDG++LRE ++DP L  Y I++LDE HERT++ D+LFG++   + ++K+++M   K ++ SAT+D   F  +F E   +  I    +P+ +    +   DY+  S+I   Q+H+ +   +            IL+FLTG++EI   C+IL E  K L  D  + L + P+YSALPSE+Q   + +     +R V+++TNIAETS+TI G+  V+D GF KQK  +  +G++ L + PISQAQA+QRAGRA R GPG C+RLYT+  +   M    + E+ R NLA+  L++  +G +D+L F +++ P +  +  ++  L  L A+D+  L     +T LG+ +  FPL+P     L+ S      C  ++  +V+ML+V    +  ++    +     +F+   GD +++L +Y ++ K N       WC ++ I+   + RA  + KQ+  I     L + +C + T+
Sbjct:  564 SLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLL--KKTVQKRQDM---KLIVTSATLDAVKFSQYFYEAPIF-TIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGD------------ILVFLTGQEEIDTACEILYERMKSLGPDVPE-LIILPVYSALPSEMQ-TRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGL-----LTRLGRRMAEFPLEPMLCKMLIMSVHL--GCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSW-KNNKFSNP--WCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTV 1101          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Human
Match: DHX8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:1659])

HSP 1 Score: 349.747 bits (896), Expect = 6.100e-106
Identity = 203/568 (35.74%), Postives = 328/568 (57.75%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREETI 1770
            SLPIY  K+Q+++ +      IVI  TGSGKTTQI ++L          IG +QPRR+A +S+A RVSEE  C +G+ VGY++RFE  ++  T IK+MTDG++LRE ++DP L  Y I++LDE HERT++ D+LFG++   + ++K+++M   K ++ SAT+D   F  +F E   +  I    +P+ +    +   DY+  S+I   Q+H+ +   +            IL+FLTG++EI   C+IL E  K L  D  + L + P+YSALPSE+Q   + +     +R V+++TNIAETS+TI G+  V+D GF KQK  +  +G++ L + PISQAQA+QRAGRA R GPG C+RLYT+  +   M    + E+ R NLA+  L++  +G +D+L F +++ P +  +  ++  L  L A+D+  L     +T LG+ +  FPL+P     L+ S      C  ++  +V+ML+V    +  ++    +     +F+   GD +++L +Y ++ K N       WC ++ I+   + RA  + KQ+  I     L + +C + T+
Sbjct:  564 SLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLL--KKTVQKRQDM---KLIVTSATLDAVKFSQYFYEAPIF-TIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGD------------ILVFLTGQEEIDTACEILYERMKSLGPDVPE-LIILPVYSALPSEMQ-TRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGL-----LTRLGRRMAEFPLEPMLCKMLIMSVHL--GCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSW-KNNKFSNP--WCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTV 1101          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Celegans
Match: mog-4 (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 [Source:UniProtKB/Swiss-Prot;Acc:O45244])

HSP 1 Score: 350.132 bits (897), Expect = 4.442e-108
Identity = 201/565 (35.58%), Postives = 325/565 (57.52%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDV-NKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSRE-FYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTC 1755
            SLP+Y ++D  +  +K     I+   TGSGKTTQ+P++LY       GK IG +QPRR+A +S+A RV++E+ C++G  VGYS+RFE  ++++T +K+MTDG++LRE + +P L SY+++++DE HERT++ D+LFG+V +  + RK      LK +I SAT+D + F +FF +   +  I     P+ +        DYV  +++   Q+H+                  IL+FLTG++EI    + L+E SK L   K K L   P+Y+ LPS+LQ   + E      R V+++TNIAETS+TI G+  VID GFSKQ      SG+E L +  IS+A A QRAGRA R GPG CFRLYT   ++  + ++ + E+ R NL    L + +LG HD++ F +L+ P    +   +  L+ L A+   +  GE  +T+LG+ +  FP DP  +  ++ S K++  C  ++  + AML+    +F+   +     + +R+ F+SP GD ++++ +Y    K       Q WC ++ +++  M RA  V  QL  + + +++  K+ 
Sbjct:  363 SLPVYAFRDAFIEAVKEHQVLIIEGETGSGKTTQLPQYLYEAGFCEGGKRIGCTQPRRVAAMSVAARVADEVGCKLGTQVGYSIRFEDCTSEKTVLKYMTDGMLLREFLNEPDLASYSVMMIDEAHERTLHTDILFGLVKDIARFRKD-----LKLLISSATLDAEKFSSFFDDAPIFR-IPGRRFPVDIYYTQAPEADYVDAAIVTIMQIHL-----------TQPLPGDILVFLTGQEEIETVQEALMERSKAL-GSKIKELIPLPVYANLPSDLQ-AKIFEPTPKDARKVVLATNIAETSVTIDGINYVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFRLYTAWAYKHELEEQPIPEIQRTNLGNVVLMLKSLGIHDLVHFDFLDPPPQETL---VIALEQLYALGALNHRGE--LTKLGRRMAEFPCDPCMSKMIIASEKYE--CSEEIVTIAAMLSCNAAVFYRPKAQVIHADSARKGFWSPAGDHITLMNVY---NKWQESSFSQRWCVENYVQHRTMKRARDVRDQLVGLLERVEIETKSS 898          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Celegans
Match: mog-1 (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 [Source:UniProtKB/Swiss-Prot;Acc:P34498])

HSP 1 Score: 352.058 bits (902), Expect = 6.739e-108
Identity = 202/585 (34.53%), Postives = 326/585 (55.73%), Query Frame = 1
Query:   34 FAKKIKNDEICS--------------LPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPM 1746
            FA  +K++E  S              LP++  + +++  I+  +  I++  TGSGKTTQ+ ++L  D      +IG +QPRR+A +S+A RV++EM  ++G+ VGY++RFE  ++++T IK+MTDG++LRE + D  L  Y+ +I+DE HER++N D+LFG++      R     A LK ++ SATMD   F +FFG N     I     P+ +       +DYV  +V     +H+G +  +            ILIF+ G+++I   C+++ E+  +L  D+   L+V P+YS LPS+LQ      +   + R  IV+TNIAETS+T+ G+  VID GF K K  +P  G+++L I P+SQA A QR GRA R GPG C+RLYT+  F+  + K T+ E+ R NLA   L + +LG  D+LKF +++ P  + +  S+  L  L A+D T      Q+T +G+ ++ FPLDP  +  L+ S++    C  +V  +V+ML+V    F  +  + ++     +F  P  D ++ L +Y    +  +      WC  + +    + +   V  QLKEI + L LP+
Sbjct:  415 FASHMKDNEAVSDFAMEKSIKQQREYLPVFACRQKMMNVIRENNVVIIVGETGSGKTTQLAQYLLEDGFGDSGLIGCTQPRRVAAMSVARRVADEMGVDLGQDVGYAIRFEDCTSEKTIIKYMTDGILLRECLGDGSLDQYSAIIMDEAHERSLNTDVLFGLLREVIAKR-----ADLKLIVTSATMDADKFADFFGGNCPTFTIPGRTFPVELFHARTPVEDYVDAAVKQAVTIHLGGMDGD------------ILIFMPGQEDIECTCEMIKEKLGEL--DEAPPLAVLPIYSQLPSDLQAKIFQRAPGGM-RKAIVATNIAETSLTVDGILFVIDPGFCKMKVYNPRIGMDALSIFPVSQASANQRTGRAGRTGPGQCYRLYTERQFKDELLKSTVPEIQRTNLANVVLLLKSLGVDDLLKFHFMDAPPQDNMLNSMYQLWTLGALDNTG-----QLTPMGRKMVEFPLDPTLSKMLIMSAEM--GCSDEVLTIVSMLSVPAIFFRPKGREEEADAKKEKFQVPESDHLTFLNVY---IQWRTHKYSAKWCADNYLHVKALKKVREVRAQLKEIMQDLKLPL 969          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Celegans
Match: mog-1 (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 [Source:UniProtKB/Swiss-Prot;Acc:P34498])

HSP 1 Score: 352.058 bits (902), Expect = 6.739e-108
Identity = 202/585 (34.53%), Postives = 326/585 (55.73%), Query Frame = 1
Query:   34 FAKKIKNDEICS--------------LPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPM 1746
            FA  +K++E  S              LP++  + +++  I+  +  I++  TGSGKTTQ+ ++L  D      +IG +QPRR+A +S+A RV++EM  ++G+ VGY++RFE  ++++T IK+MTDG++LRE + D  L  Y+ +I+DE HER++N D+LFG++      R     A LK ++ SATMD   F +FFG N     I     P+ +       +DYV  +V     +H+G +  +            ILIF+ G+++I   C+++ E+  +L  D+   L+V P+YS LPS+LQ      +   + R  IV+TNIAETS+T+ G+  VID GF K K  +P  G+++L I P+SQA A QR GRA R GPG C+RLYT+  F+  + K T+ E+ R NLA   L + +LG  D+LKF +++ P  + +  S+  L  L A+D T      Q+T +G+ ++ FPLDP  +  L+ S++    C  +V  +V+ML+V    F  +  + ++     +F  P  D ++ L +Y    +  +      WC  + +    + +   V  QLKEI + L LP+
Sbjct:  415 FASHMKDNEAVSDFAMEKSIKQQREYLPVFACRQKMMNVIRENNVVIIVGETGSGKTTQLAQYLLEDGFGDSGLIGCTQPRRVAAMSVARRVADEMGVDLGQDVGYAIRFEDCTSEKTIIKYMTDGILLRECLGDGSLDQYSAIIMDEAHERSLNTDVLFGLLREVIAKR-----ADLKLIVTSATMDADKFADFFGGNCPTFTIPGRTFPVELFHARTPVEDYVDAAVKQAVTIHLGGMDGD------------ILIFMPGQEDIECTCEMIKEKLGEL--DEAPPLAVLPIYSQLPSDLQAKIFQRAPGGM-RKAIVATNIAETSLTVDGILFVIDPGFCKMKVYNPRIGMDALSIFPVSQASANQRTGRAGRTGPGQCYRLYTERQFKDELLKSTVPEIQRTNLANVVLLLKSLGVDDLLKFHFMDAPPQDNMLNSMYQLWTLGALDNTG-----QLTPMGRKMVEFPLDPTLSKMLIMSAEM--GCSDEVLTIVSMLSVPAIFFRPKGREEEADAKKEKFQVPESDHLTFLNVY---IQWRTHKYSAKWCADNYLHVKALKKVREVRAQLKEIMQDLKLPL 969          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Celegans
Match: mog-5 (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 [Source:UniProtKB/Swiss-Prot;Acc:Q09530])

HSP 1 Score: 351.288 bits (900), Expect = 4.002e-107
Identity = 199/564 (35.28%), Postives = 327/564 (57.98%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSR-EFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTC 1755
            SLPI+  K  ++  +      +V+  TGSGKTTQ+ ++     + +   IG +QPRR+A +S+A RV+EE  C++G  VGY++RFE  +++ T IK+MTDG++LRE ++DP L  Y++++LDE HERT++ D+LFG++  A + R +     LK +I SAT+D   F  +F E   +  I     P+ +    +   DY+  + I   Q+H+ +   +            +L+FLTG++EI   C++L E  K +  D  + L + P+Y ALPSE+Q   + +      R V+++TNIAETS+TI G+  V+D GF KQK  +P SG++SL + PISQA A+QR+GRA R GPG C+RLYT+  F   M    + E+ R NLA+  L +  +G ++++ F +++ P ++ +  ++N L  L+A+D     G+  +T+LG+ +  FPL+P  +  L+ S      C  +V  +VAML V + +F+     +D  +  + +F+ P GD +++L +Y ++   +     Q WC ++ I+   M RA  + KQL  I     L M +C
Sbjct:  539 SLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPE-----LKLIITSATLDSVKFSEYFLEAPIF-TIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGD------------VLVFLTGQEEIDTSCEVLYERMKSMGPDVPE-LIILPVYGALPSEMQ-TRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALD-----GDGLLTKLGRRMAEFPLEPSLSKLLIMSVDL--GCSEEVLTIVAMLNV-QNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHF---SQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSC 1071          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Celegans
Match: ddx-15 (Pre-mRNA-splicing factor ATP-dependent RNA helicase ddx-15 [Source:UniProtKB/Swiss-Prot;Acc:Q20875])

HSP 1 Score: 334.724 bits (857), Expect = 4.116e-105
Identity = 203/570 (35.61%), Postives = 311/570 (54.56%), Query Frame = 1
Query:   70 LPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYN--------DDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDN-----LTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDL 1740
            LP++ YK++ +  ++      ++  TGSGKTTQIP++               + +++  +QPRR+A +S+ATRV+EEM+  +G+ VGYS+RFE   ++RT +K+ TDG++LREA+  PLL  Y +LILDE HERT+  D+L G++    +     N A +K VIMSAT+D   F  +F E+     +     P+ +        DY+  ++    Q+HM           V      IL+FLTG++EI   C  +  E + L  D    LS  PLYS LP   Q+     +  N     ++R  ++STNIAETS+TI GV  VID GFSKQK  +P   +ESL + PIS+A A QRAGRA R  PG CFRLYT+  + S M  +T  E+ R+NL +  L +  LG  D++ F +++ P    + R++ +L  L AI++     + ++TELG  +  FPLDP+ A  L+ S++   +C  ++ ++ AML+V +          ++      F    GD +++L +Y +F K N  D +  WC  + I Y  M  A  V  QL  +    +L
Sbjct:   76 LPVWEYKEKFMELLRNNQCITLVGETGSGKTTQIPQWAVEFMKQQQQGQPPGQARLVACTQPRRVAAMSVATRVAEEMDVVLGQEVGYSIRFEDCISERTVLKYCTDGMLLREAMNSPLLDKYKVLILDEAHERTLATDILMGLIKEIVR-----NRADIKVVIMSATLDAGKFQRYF-EDCPLLSVPGRTFPVEIFFTPNAEKDYLEAAIRTVIQIHM-----------VEEVEGDILLFLTGQEEIEEACKRIDREIQALGADA-GALSCIPLYSTLPPAAQQRIFEPAPPNRPNGAISRKCVISTNIAETSLTIDGVVFVIDPGFSKQKVYNPRIRVESLLVCPISKASAMQRAGRAGRTKPGKCFRLYTETAYGSEMQDQTYPEILRSNLGSVVLQLKKLGTEDLVHFDFMDPPAPETLMRALELLNYLQAIND-----DGELTELGSLMAEFPLDPQLAKMLITSTEL--NCSNEILSITAMLSVPQCWVRPNEMRTEADEAKARFAHIDGDHLTLLNVYHSF-KQNQEDPQ--WCYDNFINYRTMKTADTVRTQLSRVMDKYNL 617          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Fly
Match: CG4901 (gene:FBgn0032194 transcript:FBtr0445415)

HSP 1 Score: 364.77 bits (935), Expect = 1.481e-116
Identity = 210/565 (37.17%), Postives = 334/565 (59.12%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKG---LSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKT 1752
            SLP++N + +IL++++  D  +++S TGSGKTTQIP+FL      K  MIGI+QPRR+A I++A RV++E+N  +G+TVGY+VRFE  +++ TKI+F+TDG++LRE++ D LL  Y+++ILDE HERTVN DLLFG+V +AQK R+++ +A LK V+ SATMD   F N+F  N K   ++   +P+ +    ++ +DY+   ++  F +H             +  N  +LIFLTG++EI    + L ++ ++L +    G   L V+ LY+ L    Q      +  N+ R VI++TNIAETSITIPG+R VIDCGF K+K  + V GL+ L+   IS+AQA QRAGRA R   G C+R YT    +S     T  E+ R N  +  L +  L   D   F +L+ P  + ++ +   L  L AI   D   +  IT LG+ ++++PLDP+++  LL +S F   C+ ++ ++V++L+           +  +     +F S  GD +++L ++  F K    ++ + WC  + +    +  A  V +QL+EI + L L + +
Sbjct:   67 SLPVFNCRHRILKELEANDTVLIMSETGSGKTTQIPQFLLLAGYAKNGMIGITQPRRVAAITVARRVAQELNGTIGDTVGYTVRFEDVTSRATKIRFLTDGVLLRESIKDRLLLKYSVIILDEAHERTVNADLLFGIVKDAQKERRKQKLANLKVVVTSATMDIDHFGNYF--NCKGMYLEGRTYPVRVMHTKEEHEDYIHTVLVTLFHIHR-----------TTPKNHDVLIFLTGQEEI----ESLAQQIRQLAKIDTTGTTDLRVFTLYAQLSQGKQLECFVPTPANV-RKVILATNIAETSITIPGIRCVIDCGFVKEKSFNTVDGLDVLKSVRISKAQAWQRAGRAGRDADGTCYRAYTKAEMDS-FADATQPEILRTNPTSMVLQLLALDI-DCNNFDFLDPPLEDGLRSAYKSLDALGAIKTGD---DSYITPLGRQMVQYPLDPKYSKLLLTASSF--GCMEEILSLVSVLSSDHVFVSNSEKNEMAALAHAKFQSKHGDHLTLLNVFNGFLK---SEKPKMWCHDNYLNLRSLTYARNVRRQLREISEHLHLALNS 603          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Fly
Match: CG4901 (gene:FBgn0032194 transcript:FBtr0079947)

HSP 1 Score: 364.77 bits (935), Expect = 1.481e-116
Identity = 210/565 (37.17%), Postives = 334/565 (59.12%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKG---LSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKT 1752
            SLP++N + +IL++++  D  +++S TGSGKTTQIP+FL      K  MIGI+QPRR+A I++A RV++E+N  +G+TVGY+VRFE  +++ TKI+F+TDG++LRE++ D LL  Y+++ILDE HERTVN DLLFG+V +AQK R+++ +A LK V+ SATMD   F N+F  N K   ++   +P+ +    ++ +DY+   ++  F +H             +  N  +LIFLTG++EI    + L ++ ++L +    G   L V+ LY+ L    Q      +  N+ R VI++TNIAETSITIPG+R VIDCGF K+K  + V GL+ L+   IS+AQA QRAGRA R   G C+R YT    +S     T  E+ R N  +  L +  L   D   F +L+ P  + ++ +   L  L AI   D   +  IT LG+ ++++PLDP+++  LL +S F   C+ ++ ++V++L+           +  +     +F S  GD +++L ++  F K    ++ + WC  + +    +  A  V +QL+EI + L L + +
Sbjct:   67 SLPVFNCRHRILKELEANDTVLIMSETGSGKTTQIPQFLLLAGYAKNGMIGITQPRRVAAITVARRVAQELNGTIGDTVGYTVRFEDVTSRATKIRFLTDGVLLRESIKDRLLLKYSVIILDEAHERTVNADLLFGIVKDAQKERRKQKLANLKVVVTSATMDIDHFGNYF--NCKGMYLEGRTYPVRVMHTKEEHEDYIHTVLVTLFHIHR-----------TTPKNHDVLIFLTGQEEI----ESLAQQIRQLAKIDTTGTTDLRVFTLYAQLSQGKQLECFVPTPANV-RKVILATNIAETSITIPGIRCVIDCGFVKEKSFNTVDGLDVLKSVRISKAQAWQRAGRAGRDADGTCYRAYTKAEMDS-FADATQPEILRTNPTSMVLQLLALDI-DCNNFDFLDPPLEDGLRSAYKSLDALGAIKTGD---DSYITPLGRQMVQYPLDPKYSKLLLTASSF--GCMEEILSLVSVLSSDHVFVSNSEKNEMAALAHAKFQSKHGDHLTLLNVFNGFLK---SEKPKMWCHDNYLNLRSLTYARNVRRQLREISEHLHLALNS 603          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Fly
Match: CG4901 (gene:FBgn0032194 transcript:FBtr0445414)

HSP 1 Score: 364.77 bits (935), Expect = 1.481e-116
Identity = 210/565 (37.17%), Postives = 334/565 (59.12%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKG---LSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKT 1752
            SLP++N + +IL++++  D  +++S TGSGKTTQIP+FL      K  MIGI+QPRR+A I++A RV++E+N  +G+TVGY+VRFE  +++ TKI+F+TDG++LRE++ D LL  Y+++ILDE HERTVN DLLFG+V +AQK R+++ +A LK V+ SATMD   F N+F  N K   ++   +P+ +    ++ +DY+   ++  F +H             +  N  +LIFLTG++EI    + L ++ ++L +    G   L V+ LY+ L    Q      +  N+ R VI++TNIAETSITIPG+R VIDCGF K+K  + V GL+ L+   IS+AQA QRAGRA R   G C+R YT    +S     T  E+ R N  +  L +  L   D   F +L+ P  + ++ +   L  L AI   D   +  IT LG+ ++++PLDP+++  LL +S F   C+ ++ ++V++L+           +  +     +F S  GD +++L ++  F K    ++ + WC  + +    +  A  V +QL+EI + L L + +
Sbjct:   67 SLPVFNCRHRILKELEANDTVLIMSETGSGKTTQIPQFLLLAGYAKNGMIGITQPRRVAAITVARRVAQELNGTIGDTVGYTVRFEDVTSRATKIRFLTDGVLLRESIKDRLLLKYSVIILDEAHERTVNADLLFGIVKDAQKERRKQKLANLKVVVTSATMDIDHFGNYF--NCKGMYLEGRTYPVRVMHTKEEHEDYIHTVLVTLFHIHR-----------TTPKNHDVLIFLTGQEEI----ESLAQQIRQLAKIDTTGTTDLRVFTLYAQLSQGKQLECFVPTPANV-RKVILATNIAETSITIPGIRCVIDCGFVKEKSFNTVDGLDVLKSVRISKAQAWQRAGRAGRDADGTCYRAYTKAEMDS-FADATQPEILRTNPTSMVLQLLALDI-DCNNFDFLDPPLEDGLRSAYKSLDALGAIKTGD---DSYITPLGRQMVQYPLDPKYSKLLLTASSF--GCMEEILSLVSVLSSDHVFVSNSEKNEMAALAHAKFQSKHGDHLTLLNVFNGFLK---SEKPKMWCHDNYLNLRSLTYARNVRRQLREISEHLHLALNS 603          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Fly
Match: Dhx15 (gene:FBgn0033160 transcript:FBtr0336909)

HSP 1 Score: 358.607 bits (919), Expect = 8.070e-114
Identity = 211/582 (36.25%), Postives = 333/582 (57.22%), Query Frame = 1
Query:   19 IKHKPFAKKIKN--DEICSLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKG-KMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQR-----LAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDL 1740
            + + P++++ +N   +  +LP++ Y+   +R +      +++  TGSGKTTQIP++  +  V+KG K +  +QPRR+A +S+A RVSEEM+ ++GE VGYS+RFE  ST +T +K+MTDG++LREA+ DP+L  Y +++LDE HERT+  D+L GV+    + R       LK V+MSAT+D   F  +F +N     +    HP+ +    +   DY+  ++    Q+HM +   EI  D        IL+FLTG++EI   C  +  E   L  +  + L   PLYS LP  LQ+          +   + R V+VSTNIAETS+TI GV  VID GF+KQK  +P   +ESL + PIS+A A+QR+GRA R  PG CFRLYT+  F++ M   T  E+ R+NL T  L +  LG  D++ F +++ P    + R++ +L  LAA+D+     +  +T+LG  +  FPLDP+ A  L+ S   Q++C  ++ ++ AML+V +       + + +      F    GD +++L +Y AF + +   E  +WC ++ I +  +  A  V +QL  I    +L
Sbjct:   53 LTNTPYSQRYQNLYKKRIALPVFEYQADFMRLLSLHQCIVLVGETGSGKTTQIPQWCVDFAVSKGRKGVSCTQPRRVAAMSVAQRVSEEMDVKLGEEVGYSIRFEDCSTAKTLLKYMTDGMLLREAMSDPMLDQYQVILLDEAHERTLATDILMGVLKEVIRQRSD-----LKLVVMSATLDAGKFQQYF-DNAPLMKVPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCE---EIEGD--------ILMFLTGQEEIEEACKRIKREIDNLGSEIGE-LKCIPLYSTLPPNLQQRIFEPAPPPNANGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRSGRAGRTRPGKCFRLYTEKAFKNEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALDD-----DGNLTDLGAVMSEFPLDPQLAKMLIASC--QHNCSNEILSITAMLSVPQCFVRPNEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQSS---EDPNWCYENFINFRSLKSADNVRQQLARIMDRFNL 606          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Fly
Match: Dhx15 (gene:FBgn0033160 transcript:FBtr0088966)

HSP 1 Score: 358.607 bits (919), Expect = 8.070e-114
Identity = 211/582 (36.25%), Postives = 333/582 (57.22%), Query Frame = 1
Query:   19 IKHKPFAKKIKN--DEICSLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKG-KMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQR-----LAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDL 1740
            + + P++++ +N   +  +LP++ Y+   +R +      +++  TGSGKTTQIP++  +  V+KG K +  +QPRR+A +S+A RVSEEM+ ++GE VGYS+RFE  ST +T +K+MTDG++LREA+ DP+L  Y +++LDE HERT+  D+L GV+    + R       LK V+MSAT+D   F  +F +N     +    HP+ +    +   DY+  ++    Q+HM +   EI  D        IL+FLTG++EI   C  +  E   L  +  + L   PLYS LP  LQ+          +   + R V+VSTNIAETS+TI GV  VID GF+KQK  +P   +ESL + PIS+A A+QR+GRA R  PG CFRLYT+  F++ M   T  E+ R+NL T  L +  LG  D++ F +++ P    + R++ +L  LAA+D+     +  +T+LG  +  FPLDP+ A  L+ S   Q++C  ++ ++ AML+V +       + + +      F    GD +++L +Y AF + +   E  +WC ++ I +  +  A  V +QL  I    +L
Sbjct:   53 LTNTPYSQRYQNLYKKRIALPVFEYQADFMRLLSLHQCIVLVGETGSGKTTQIPQWCVDFAVSKGRKGVSCTQPRRVAAMSVAQRVSEEMDVKLGEEVGYSIRFEDCSTAKTLLKYMTDGMLLREAMSDPMLDQYQVILLDEAHERTLATDILMGVLKEVIRQRSD-----LKLVVMSATLDAGKFQQYF-DNAPLMKVPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCE---EIEGD--------ILMFLTGQEEIEEACKRIKREIDNLGSEIGE-LKCIPLYSTLPPNLQQRIFEPAPPPNANGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRSGRAGRTRPGKCFRLYTEKAFKNEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALDD-----DGNLTDLGAVMSEFPLDPQLAKMLIASC--QHNCSNEILSITAMLSVPQCFVRPNEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQSS---EDPNWCYENFINFRSLKSADNVRQQLARIMDRFNL 606          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Zebrafish
Match: dhx33 (DEAH (Asp-Glu-Ala-His) box polypeptide 33 [Source:NCBI gene;Acc:796505])

HSP 1 Score: 406.371 bits (1043), Expect = 1.461e-132
Identity = 229/565 (40.53%), Postives = 343/565 (60.71%), Query Frame = 1
Query:   70 LPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEI----RRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKT 1752
            LPIY  + Q++  ++   + + I  TGSGKTTQIP++LY   + +  +I I+QPRR+A IS+A RV+EE   ++G+ VGY+VRFE  ++  TK+KFMTDG++LREA+ DPLL  Y ++ILDE HERTV+ D+LFGVV  AQ+ R ++N  PLK V+MSATMD   F  +F ++     ++   HP+ +    Q   DY++ +++  FQ+H    +A  S D        IL+FLTG++EI    R C DI      K + D    ++V PLY++LP   Q++ V       +R VI+STNIAETSITI G++ VID G  K K  +P SGLE L ++ +S+AQA QRAGRA R   G C+RLYT+  FE+ +   T+ E+ R NLA+  L +  LG  DVL F ++ KP    ++ ++  L  L A+D  D      +T LGK +  FPL+PRF+  LL S  F  SC  ++  ++++L+V   L++      + ++V ++F S  GD +++L IYRAF K   V   + WCR++ +    M     V  QL++IC  ++L +++
Sbjct:   47 LPIYQSRTQVISQLRQLHSAVFIGETGSGKTTQIPQYLYEAGIGRQGIIAITQPRRVAAISLAGRVAEEKKVQLGKLVGYTVRFEDVTSPETKLKFMTDGMLLREAIGDPLLLRYTVVILDEAHERTVHTDVLFGVVKAAQRRRLEQNKIPLKVVVMSATMDVDLFSQYFNKSPVL-YLEGRQHPIQIYYTKQPQSDYLQAALVSIFQIHQ---EAPSSHD--------ILVFLTGQEEIEALARTCRDI-----SKHLPDTSGSMTVVPLYASLPPA-QQMRVFLPAPKGSRKVILSTNIAETSITISGIKYVIDTGMVKAKRFNPDSGLEVLAVQRVSKAQAWQRAGRAGREDAGSCYRLYTEDEFEN-LANMTVPEIQRCNLASVVLQLLALGVPDVLNFDFVSKPSPESMRTAVEQLCILGAVDRKD--DHVSLTPLGKKMACFPLEPRFSKTLLISPDF--SCTEEILTIISLLSVDSVLYNPPARRDEVISVRKKFISSEGDHITLLNIYRAFKK---VSGNKDWCRENFVNSRNMGLVGEVRAQLRDICIKMNLKLES 585          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Zebrafish
Match: dhx40 (DEAH (Asp-Glu-Ala-His) box polypeptide 40 [Source:ZFIN;Acc:ZDB-GENE-080507-1])

HSP 1 Score: 347.051 bits (889), Expect = 3.774e-109
Identity = 208/586 (35.49%), Postives = 331/586 (56.48%), Query Frame = 1
Query:    4 KRSLQIKHKPFAKKIKNDEICSLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPL--TMKSLV----QQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKL-----VRDKH-KGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQ-NSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEI 1722
            KRS + +H    K         LPIY YKD++++ ++     IV   TGSGKTTQ+P++LY   +++   IG++QPRR+A I++A RVS EM   +GE VGY VRF+  STK T IK+MTDG +LRE + DP L  Y+I+ILDE HER++N D+L G++        + N  PLK V+MSAT++ +   +F+G N     I    +P+  T  +L+    ++S  YV+  V +   +H  +   +            IL+FLTG+ EI + CD+L E+++ L     V D+   GL +  LY ++P++ QR  + +      R  +V+TNIA TS+TI G+R ++D GF KQ   +   GL+ L++ PIS+++A+QRAGRA R   G CFR+Y+   +++ MP+ T+ E+ R +L +  LT+  LG HDV++FP+L+ P+   +   +  LK L   D  D  GE  +T+LG+ ++ FPL P    ALL+++       ++ V A++++  +F +    E      V   +E  +  G     L +   F K  + +    WC+++ I +  +  A  V  QL+EI
Sbjct:    5 KRSSETEHHESKK---------LPIYQYKDKLVQAVEENTFLIVTGETGSGKTTQLPQYLYKAGLSRNGRIGVTQPRRVAAITVAQRVSSEMQVRLGEEVGYQVRFDDCSTKDTMIKYMTDGCLLREILADPSLTQYSIVILDEAHERSLNTDVLLGLLKKTLLKGSRGNKTPLKVVVMSATLETEKLSSFYG-NCPVFTIPGRTYPVKETFCNLIGPKDKESSVYVKEVVKMTLDVHTNEAAGD------------ILVFLTGQSEIEKACDLLFEKAEILDYRYDVHDRSVDGLLILSLYGSMPTDQQR-QIFQPAPKGVRKCVVATNIAATSLTIDGIRYIVDSGFVKQLNHNSRVGLDILEVVPISKSEAQQRAGRAGRTAAGKCFRIYSKDFWDTCMPEYTIPEIQRTSLTSVILTLKCLGVHDVIRFPYLDCPEERFI---LTALKQLYQYDAIDRRGE--VTKLGRLMVEFPLPPNLTRALLKAAALGCEDIMLPVAAMLSVENIFIRPGKPEKQKEAEVR-HKEIAACSGGSNDFLMLLCVFEKCRASENPSAWCKENWIHWRAVKSAFSVETQLREI 561          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Zebrafish
Match: AL833789.3 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:NCBI gene;Acc:606595])

HSP 1 Score: 352.443 bits (903), Expect = 1.570e-107
Identity = 204/568 (35.92%), Postives = 328/568 (57.75%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREETI 1770
            SLPIY  K+Q+++ +      IVI  TGSGKTTQI ++L          IG +QPRR+A +S+A RVSEE  C +G+ VGY++RFE  ++  T IK+MTDG++LRE ++DP L  Y I++LDE HERT++ D+LFG++   + ++K+ +M   K ++ SAT+D   F  +F E   +  I    +P+ +    +   DY+  S+I   Q+H+ +   +            IL+FLTG++EI   C+IL E  K L  D  + L + P+YSALPSE+Q   + +     +R V+++TNIAETS+TI G+  V+D GF KQK  +  +G++ L + PISQAQA+QRAGRA R GPG C+RLYT+  +   M    + E+ R NLA+  L++  +G +D+L F +++ P +  +  ++  L  L A+D+  L     +T LG+ +  FPL+P     L+ S      C  ++  +V+ML+V    +  ++    +     +F+ P GD +++L +Y ++ K N       WC ++ I+   + RA  + KQ+  I     L + +C + T+
Sbjct:  501 SLPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLL--KKTVQKRTDM---KLIVTSATLDAVKFSQYFYEAPIF-TIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGD------------ILVFLTGQEEIDTACEILYERMKSLGPDVPE-LIILPVYSALPSEMQ-TRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGL-----LTRLGRRMAEFPLEPMLCKMLIMSVHL--GCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSW-KNNKFSNP--WCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATV 1038          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Zebrafish
Match: dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-050809-39])

HSP 1 Score: 353.214 bits (905), Expect = 2.110e-107
Identity = 210/584 (35.96%), Postives = 334/584 (57.19%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHM----GKIQAEI--------SKDF----VSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREETI 1770
            SLPIY  K+Q+++ +      IVI  TGSGKTTQI ++L          IG +QPRR+A +S+A RVSEE  C +G+ VGY++RFE  ++  T IK+MTDG++LRE ++DP L  Y I++LDE HERT++ D+LFG++   + ++K+ +M   K ++ SAT+D   F  +F E   +  I    +P+ +    +   DY+  S+I   Q+H+    GK+   I         K F    + N    IL+FLTG++EI   C+IL E  K L  D  + L + P+YSALPSE+Q   + +     +R V+++TNIAETS+TI G+  V+D GF KQK  +  +G++ L + PISQAQA+QRAGRA R GPG C+RLYT+  +   M    + E+ R NLA+  L++  +G +D+L F +++ P +  +  ++  L  L A+D+  L     +T LG+ +  FPL+P     L+ S      C  ++  +V+ML+V    +  ++    +     +F+ P GD +++L +Y ++ K N       WC ++ I+   + RA  + KQ+  I     L + +C + T+
Sbjct:  554 SLPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLL--KKTVQKRTDM---KLIVTSATLDAVKFSQYFYEAPIF-TIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGKLSNTILQNKIIKFEKQFQLIKIINCAGDILVFLTGQEEIDTACEILYERMKSLGPDVPE-LIILPVYSALPSEMQ-TRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGL-----LTRLGRRMAEFPLEPMLCKMLIMSVHL--GCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSW-KNNKFSNP--WCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATV 1119          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Zebrafish
Match: dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-050809-39])

HSP 1 Score: 352.443 bits (903), Expect = 3.280e-107
Identity = 204/568 (35.92%), Postives = 328/568 (57.75%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREETI 1770
            SLPIY  K+Q+++ +      IVI  TGSGKTTQI ++L          IG +QPRR+A +S+A RVSEE  C +G+ VGY++RFE  ++  T IK+MTDG++LRE ++DP L  Y I++LDE HERT++ D+LFG++   + ++K+ +M   K ++ SAT+D   F  +F E   +  I    +P+ +    +   DY+  S+I   Q+H+ +   +            IL+FLTG++EI   C+IL E  K L  D  + L + P+YSALPSE+Q   + +     +R V+++TNIAETS+TI G+  V+D GF KQK  +  +G++ L + PISQAQA+QRAGRA R GPG C+RLYT+  +   M    + E+ R NLA+  L++  +G +D+L F +++ P +  +  ++  L  L A+D+  L     +T LG+ +  FPL+P     L+ S      C  ++  +V+ML+V    +  ++    +     +F+ P GD +++L +Y ++ K N       WC ++ I+   + RA  + KQ+  I     L + +C + T+
Sbjct:  554 SLPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLL--KKTVQKRTDM---KLIVTSATLDAVKFSQYFYEAPIF-TIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGD------------ILVFLTGQEEIDTACEILYERMKSLGPDVPE-LIILPVYSALPSEMQ-TRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGL-----LTRLGRRMAEFPLEPMLCKMLIMSVHL--GCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSW-KNNKFSNP--WCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATV 1091          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Xenopus
Match: DHX33 (DEAH-box helicase 33 [Source:NCBI gene;Acc:447985])

HSP 1 Score: 412.149 bits (1058), Expect = 7.545e-135
Identity = 235/569 (41.30%), Postives = 352/569 (61.86%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFF-GENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSR-EFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREET 1767
            SLPIY  + QI+  ++  D+ ++I  TGSGKTTQIP++LY   + +  +I ++QPRR+A IS+ATRVSEE   E+ + VGY+VRFE  +++ TKIKF+TDG++LREA+ DPLL+ Y+++ILDE HERT++ D+LFGVV +AQK RK++   PLK +IMSATMD   F  +F G    Y  ++   HP+ +    +   DY++ +++  FQ+H    +   S D        IL+FLTG++EI        + SK L  D  K + V PLY++LP   Q+L V ++     R VI+STNIAETSITIPG++ V+D G  K K  +P SGLE L ++ +S+AQA QR GRA R   GIC+RLY +  FE    + T+ E+ R NLA+  L +  L   +V  F ++ KP  + ++ +I+ L  L A++      +  +T LGK +  FPL+P+F+  +L S KF   C  ++  +V++L+V + + H   S RD V  +R +F S  GD +++L IYRAF  L    + + WCR++ I    M   + V  QL++IC  L +PM++ R +T
Sbjct:   40 SLPIYLARSQIIAQLRKLDSVVIIGETGSGKTTQIPQYLYEASIGRQSIIAVTQPRRVAAISLATRVSEERRTELSKLVGYTVRFEDVTSEETKIKFLTDGMLLREAIGDPLLRKYSVVILDEAHERTIHTDVLFGVVKSAQKKRKEQEKQPLKIIIMSATMDVDLFSEYFNGAPVLY--LEGRQHPIQIFYTKESQSDYLQAALVTVFQVHQ---EVPASHD--------ILVFLTGQEEIEAMTKTCRDISKHLPDDCPK-MVVMPLYASLPHS-QQLRVFQNAPKGQRKVILSTNIAETSITIPGIKYVVDTGMVKAKKYNPESGLEVLAVQKVSKAQAWQRTGRAGREDSGICYRLYKEEEFEKFE-EMTVPEIQRCNLASVMLQLLVLRVPNVHTFDFMSKPSPDSIQAAIDQLHLLGAVERK--GDQIVLTPLGKKMAAFPLEPKFSKTILLSPKFH--CTEEILTIVSLLSV-DSVLHNPASKRDEVQAARKKFISSEGDHITLLNIYRAFKNLG---KNKDWCRENFINGRNMTMVLEVRSQLRDICIKLSMPMESSRTDT 584          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Xenopus
Match: DHX33 (DEAH-box helicase 33 [Source:NCBI gene;Acc:447985])

HSP 1 Score: 411.764 bits (1057), Expect = 1.197e-134
Identity = 235/569 (41.30%), Postives = 352/569 (61.86%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFF-GENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSR-EFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREET 1767
            SLPIY  + QI+  ++  D+ ++I  TGSGKTTQIP++LY   + +  +I ++QPRR+A IS+ATRVSEE   E+ + VGY+VRFE  +++ TKIKF+TDG++LREA+ DPLL+ Y+++ILDE HERT++ D+LFGVV +AQK RK++   PLK +IMSATMD   F  +F G    Y  ++   HP+ +    +   DY++ +++  FQ+H    +   S D        IL+FLTG++EI        + SK L  D  K + V PLY++LP   Q+L V ++     R VI+STNIAETSITIPG++ V+D G  K K  +P SGLE L ++ +S+AQA QR GRA R   GIC+RLY +  FE    + T+ E+ R NLA+  L +  L   +V  F ++ KP  + ++ +I+ L  L A++      +  +T LGK +  FPL+P+F+  +L S KF   C  ++  +V++L+V + + H   S RD V  +R +F S  GD +++L IYRAF  L    + + WCR++ I    M   + V  QL++IC  L +PM++ R +T
Sbjct:   40 SLPIYLARSQIIAQLRKLDSVVIIGETGSGKTTQIPQYLYEASIGRQSIIAVTQPRRVAAISLATRVSEERRTELSKLVGYTVRFEDVTSEETKIKFLTDGMLLREAIGDPLLRKYSVVILDEAHERTIHTDVLFGVVKSAQKKRKEQEKQPLKIIIMSATMDVDLFSEYFNGAPVLY--LEGRQHPIQIFYTKESQSDYLQAALVTVFQVHQ---EVPASHD--------ILVFLTGQEEIEAMTKTCRDISKHLPDDCPK-MVVMPLYASLPHS-QQLRVFQNAPKGQRKVILSTNIAETSITIPGIKYVVDTGMVKAKKYNPESGLEVLAVQKVSKAQAWQRTGRAGREDSGICYRLYKEEEFEKFE-EMTVPEIQRCNLASVMLQLLVLRVPNVHTFDFMSKPSPDSIQAAIDQLHLLGAVERK--GDQIVLTPLGKKMAAFPLEPKFSKTILLSPKFH--CTEEILTIVSLLSV-DSVLHNPASKRDEVQAARKKFISSEGDHITLLNIYRAFKNLG---KNKDWCRENFINGRNMTMVLEVRSQLRDICIKLSMPMESSRTDT 584          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Xenopus
Match: DHX33 (DEAH-box helicase 33 [Source:NCBI gene;Acc:447985])

HSP 1 Score: 407.142 bits (1045), Expect = 9.554e-133
Identity = 235/570 (41.23%), Postives = 351/570 (61.58%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFF-GENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQ-VKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSR-EFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREET 1767
            SLPIY  + QI+  ++  D+ ++I  TGSGKTTQIP++LY   + +  +I ++QPRR+A IS+ATRVSEE   E+ + VGY+VRFE  +++ TKIKF+TDG++LREA+ DPLL+ Y+++ILDE HERT++ D+LFGVV +AQK RK++   PLK +IMSATMD   F  +F G    Y  ++   HP+ +    +   DY++ +++  FQ+H    +   S D        IL+FLTG++EI        + SK L  D  K + V PLY++LP   Q+L V ++     R VI+STNIAETSITIPG++ V+D G  K K  +P SGLE L ++ +S+AQA QR GRA R   GIC+RLY +  FE    + T+ E+ R NLA+  L +  L   +V  F ++ KP   + +  +I+ L  L A++      +  +T LGK +  FPL+P+F+  +L S KF   C  ++  +V++L+V + + H   S RD V  +R +F S  GD +++L IYRAF  L    + + WCR++ I    M   + V  QL++IC  L +PM++ R +T
Sbjct:   44 SLPIYLARSQIIAQLRKLDSVVIIGETGSGKTTQIPQYLYEASIGRQSIIAVTQPRRVAAISLATRVSEERRTELSKLVGYTVRFEDVTSEETKIKFLTDGMLLREAIGDPLLRKYSVVILDEAHERTIHTDVLFGVVKSAQKKRKEQEKQPLKIIIMSATMDVDLFSEYFNGAPVLY--LEGRQHPIQIFYTKESQSDYLQAALVTVFQVHQ---EVPASHD--------ILVFLTGQEEIEAMTKTCRDISKHLPDDCPK-MVVMPLYASLPHS-QQLRVFQNAPKGQRKVILSTNIAETSITIPGIKYVVDTGMVKAKKYNPESGLEVLAVQKVSKAQAWQRTGRAGREDSGICYRLYKEEEFEKFE-EMTVPEIQRCNLASVMLQLLVLRVPNVHTFDFMSKPSPGEIIHTAIDQLHLLGAVERK--GDQIVLTPLGKKMAAFPLEPKFSKTILLSPKFH--CTEEILTIVSLLSV-DSVLHNPASKRDEVQAARKKFISSEGDHITLLNIYRAFKNLG---KNKDWCRENFINGRNMTMVLEVRSQLRDICIKLSMPMESSRTDT 589          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Xenopus
Match: DHX33 (DEAH-box helicase 33 [Source:NCBI gene;Acc:447985])

HSP 1 Score: 405.601 bits (1041), Expect = 3.408e-132
Identity = 237/576 (41.15%), Postives = 348/576 (60.42%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFF-GENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQ-------ITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSR-EFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREET 1767
            SLPIY  + QI+  ++  D+ ++I  TGSGKTTQIP++LY   + +  +I ++QPRR+A IS+ATRVSEE   E+ + VGY+VRFE  +++ TKIKF+TDG++LREA+ DPLL+ Y+++ILDE HERT++ D+LFGVV +AQK RK++   PLK +IMSATMD   F  +F G    Y  ++   HP+ +    +   DY++ +++  FQ+H    +   S D        IL+FLTG++EI        + SK L  D  K + V PLY++LP   Q+L V ++     R VI+STNIAETSITIPG++ V+D G  K K  +P SGLE L ++ +S+AQA QR GRA R   GIC+RLY +  FE    + T+ E+ R NLA+  L +  L   +V  F ++ KP               AAID+  L G  +       +T LGK +  FPL+P+F+  +L S KF   C  ++  +V++L+V + + H   S RD V  +R +F S  GD +++L IYRAF  L    + + WCR++ I    M   + V  QL++IC  L +PM++ R +T
Sbjct:   44 SLPIYLARSQIIAQLRKLDSVVIIGETGSGKTTQIPQYLYEASIGRQSIIAVTQPRRVAAISLATRVSEERRTELSKLVGYTVRFEDVTSEETKIKFLTDGMLLREAIGDPLLRKYSVVILDEAHERTIHTDVLFGVVKSAQKKRKEQEKQPLKIIIMSATMDVDLFSEYFNGAPVLY--LEGRQHPIQIFYTKESQSDYLQAALVTVFQVHQ---EVPASHD--------ILVFLTGQEEIEAMTKTCRDISKHLPDDCPK-MVVMPLYASLPHS-QQLRVFQNAPKGQRKVILSTNIAETSITIPGIKYVVDTGMVKAKKYNPESGLEVLAVQKVSKAQAWQRTGRAGREDSGICYRLYKEEEFEKFE-EMTVPEIQRCNLASVMLQLLVLRVPNVHTFDFMSKPSP-------------AAIDQLHLLGAVERKGDQIVLTPLGKKMAAFPLEPKFSKTILLSPKFH--CTEEILTIVSLLSV-DSVLHNPASKRDEVQAARKKFISSEGDHITLLNIYRAFKNLG---KNKDWCRENFINGRNMTMVLEVRSQLRDICIKLSMPMESSRTDT 584          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Xenopus
Match: nudt21 (nudix hydrolase 21 [Source:Xenbase;Acc:XB-GENE-921415])

HSP 1 Score: 365.54 bits (937), Expect = 4.843e-116
Identity = 209/582 (35.91%), Postives = 335/582 (57.56%), Query Frame = 1
Query:   70 LPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRK-QKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLV------QQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKL-----VRDKH-KGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRD-SVNVSREFYSPFG----DLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSL----DLPMK 1749
            LPI+ +K ++++        IV+  TGSGKTTQ+P++LY     K  MIG++QPRR+ATIS+A RV+EEMNC +G TVGY VRF+  +++RT IK+MTDG +LR  + DP L  Y+ ++LDE HER+++ D+LFG++    +LR  ++   PLK ++MSAT++ +   +FFG N     I     P+  + L       + S  YV  +V +  Q H+ + + +            IL+FLTG+ EI R C++L ++++ +     V D+  +GL + PLY ++P++ Q+         + R  ++STNIA TS+TI G+R VID GF KQ   +P +GL+ L+I PIS+++A QRAGRA R  PG CFR+Y++  ++  MP   + ++ R +LA+  LT+  L  HDV++FP+L++P+   +  ++  L   +AID T       +T+LG  ++ FPL P  A A+++++ F   C   +  V AML+V      +  S +     +  E  S       D  ++L I   F +  +  +   WC ++ I +  +  A+ V KQLKEI   L    D P++
Sbjct:   21 LPIHRWKGELVKAATDNPFLIVMGDTGSGKTTQLPQYLYKAGFGKNGMIGVTQPRRVATISVAQRVAEEMNCSLGSTVGYQVRFDDCTSERTVIKYMTDGCLLRNTLADPDLTKYSTIVLDEAHERSLSTDILFGLLKKQFQLRSFKRRKYPLKVIVMSATLESQKLSSFFG-NCPVVTIPGKVFPIKERFLNLIGPRDKDSTAYVTETVKITLQTHLNEPEGD------------ILVFLTGQAEIERACNLLFKKAEGIDYRHDVYDRSVEGLLILPLYGSMPTDQQKRIFVPPPSGI-RKCVLSTNIAATSVTIEGIRYVIDSGFVKQLNYNPRAGLDILEIVPISKSEAVQRAGRAGRTAPGKCFRIYSEEFWDKCMPDHMIPDIKRTSLASVILTLKCLDIHDVIRFPYLDQPEERHILEALKKLYQCSAIDRTGC-----VTKLGHFIIEFPLSPNLACAVIKATSF--GCEDLLLPVAAMLSVEHVFIQSGQSQKQKEAGLGHEELSQLAGGCNDFATLLYI---FEQCKASPKPASWCHENGIHWRALKSALNVEKQLKEITNRLKQNKDFPVE 578          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Mouse
Match: Dhx33 (DEAH (Asp-Glu-Ala-His) box polypeptide 33 [Source:MGI Symbol;Acc:MGI:2445102])

HSP 1 Score: 400.593 bits (1028), Expect = 4.388e-130
Identity = 225/569 (39.54%), Postives = 345/569 (60.63%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEI----RRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSV-NVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCR 1758
            SLPI+  + Q+L  ++  DN ++I  TGSGKTTQIP++LY   +++  +I ++QPRR+A IS+ATRVS+E   E+G+ VGY+VRFE  +++ T+IKF+TDG++LREA+ D LL+ Y+ +ILDE HERT++ D+LFGVV  AQK RK+    PLK ++MSATMD   F  +F        ++   HP+ +    Q   DY+  +++  FQ+H    +A  S+D        IL+FLTG++EI    + C DI      + + D    + V PLY++LP   Q+L V +      R VI+STNIAETSITI G++ V+D G  K K  +P SGLE L ++ +S+ QA QR GRA R   GIC+RLYT+  FE    K T+ E+ R NLA+  L +  +   +VL F ++ KP  + ++ +I  L  L A++  D   +  +T +G+ +  FPL+PRFA  +L SSKF   C  ++  +V++L+V + + +   + RD V +V ++F S  GD +++L IYR F  +      + WC+++ +    M     V  QL+EIC  + +P+ + R
Sbjct:   64 SLPIFRARGQLLAQLRNLDNAVLIGETGSGKTTQIPQYLYEGGISRQGIIAVTQPRRVAAISLATRVSDEKRTELGKLVGYTVRFEDVTSEDTRIKFLTDGMLLREAISDSLLRKYSCVILDEAHERTIHTDVLFGVVKTAQKRRKELGKLPLKVIVMSATMDVDLFSQYFN-RAPVLYLEGRQHPIQIFYTKQPQQDYLHAALVSVFQIHQ---EAPASQD--------ILVFLTGQEEIEAMSKTCRDI-----ARHLPDGCPSMLVLPLYASLPYS-QQLRVFQGAPKGYRKVIISTNIAETSITITGIKYVVDTGMVKAKKYNPDSGLEVLAVQRVSKTQAWQRTGRAGREDSGICYRLYTEDEFEK-FEKMTVPEIQRCNLASVILQLLAMKVPNVLTFDFMSKPSPDHIEAAIAQLDLLGALEHKD--DQLTLTPIGRKMAAFPLEPRFAKTILLSSKFH--CTEEILTIVSLLSV-DSVLYNPPARRDEVQSVRKKFISSEGDHITLLNIYRTFKNIGG---NKDWCKENFVNSKNMLLVAEVRAQLREICLKMSMPIMSSR 605          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Mouse
Match: Dhx35 (DEAH (Asp-Glu-Ala-His) box polypeptide 35 [Source:MGI Symbol;Acc:MGI:1918965])

HSP 1 Score: 352.829 bits (904), Expect = 5.230e-112
Identity = 201/588 (34.18%), Postives = 329/588 (55.95%), Query Frame = 1
Query:   19 IKHKPFAKKIKNDEICSLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDD-VNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTK-RTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYN---------VIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDK-HKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITE-LGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLP 1743
            I + P+A      +   LP++  ++ IL  ++     +++  TG GK+TQIP++L       +G+++G++QPRR+A +++A RV++E    +G  VGY +RF+  +    T+IKF+TDG+++RE ++DPLL  Y++++LDE HERT+  D+  G++   QK R       L+ ++ SAT+D + F +FF +N   +          ++    P+ +  L     DY++ +V    ++H    Q E   D        IL FLTG++E+     +LIE+++ L R    K L V P+Y+ LPS  +++ V E   +  R VIV+TN+AETSITI G+  VIDCGF K +  +P + +E L + P+SQA A QRAGR  R   G C+RLYT+  F+  +P+ T+ E+ R+NLA   L +  LG  +VL+F ++  P    + +++ +L  L  +D+     + ++TE LG  +  FPL+P FA  LLES  F   C  +V ++ AM+ +        N    +  V R+F    GD ++ML +Y AF K N   +   WC++H + Y  + RA  V  QLK++     +P
Sbjct:   37 IIYNPYAALSIEQQRQKLPVFKLRNHILYLVENYQTVVIVGETGCGKSTQIPQYLAEAGWTAEGRVVGVTQPRRVAAVTVAGRVADERGAVLGHEVGYCIRFDDCTDPLATRIKFLTDGMLVREMMVDPLLTKYSVIMLDEAHERTLYTDIAIGLLKKIQKKR-----GDLRLIVASATLDAEKFRDFFNQNETSDPARDTSVTLTVEGRTFPVDIFYLQSPVPDYIKATVDTVVKIH----QTEGDGD--------ILAFLTGQEEVETVVSMLIEQARALARTGMKKHLRVLPMYAGLPS-FEQMKVFERVSHSVRKVIVATNVAETSITISGIVYVIDCGFMKLRAYNPRTAIECLVVVPVSQASANQRAGRGGRNRSGKCYRLYTEEAFDQ-LPQSTVPEMQRSNLAPVILQLKALGIDNVLRFHFMSPPPAQSMVQALELLYALGGLDK-----DCRLTEPLGMRIAEFPLNPMFAKMLLESGNF--GCSQEVLSIAAMMQIQNVFVFPSNQKSQATRVHRKFAVEEGDHLTMLNVYEAFIKHN---KSSQWCQEHFLNYKGLVRAATVRDQLKKLLVKFQVP 595          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Mouse
Match: Dhx35 (DEAH (Asp-Glu-Ala-His) box polypeptide 35 [Source:MGI Symbol;Acc:MGI:1918965])

HSP 1 Score: 352.058 bits (902), Expect = 1.792e-111
Identity = 201/588 (34.18%), Postives = 329/588 (55.95%), Query Frame = 1
Query:   19 IKHKPFAKKIKNDEICSLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDD-VNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTK-RTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYN---------VIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDK-HKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITE-LGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLP 1743
            I + P+A      +   LP++  ++ IL  ++     +++  TG GK+TQIP++L       +G+++G++QPRR+A +++A RV++E    +G  VGY +RF+  +    T+IKF+TDG+++RE ++DPLL  Y++++LDE HERT+  D+  G++   QK R       L+ ++ SAT+D + F +FF +N   +          ++    P+ +  L     DY++ +V    ++H    Q E   D        IL FLTG++E+     +LIE+++ L R    K L V P+Y+ LPS  +++ V E   +  R VIV+TN+AETSITI G+  VIDCGF K +  +P + +E L + P+SQA A QRAGR  R   G C+RLYT+  F+  +P+ T+ E+ R+NLA   L +  LG  +VL+F ++  P    + +++ +L  L  +D+     + ++TE LG  +  FPL+P FA  LLES  F   C  +V ++ AM+ +        N    +  V R+F    GD ++ML +Y AF K N   +   WC++H + Y  + RA  V  QLK++     +P
Sbjct:   37 IIYNPYAALSIEQQRQKLPVFKLRNHILYLVENYQTVVIVGETGCGKSTQIPQYLAEAGWTAEGRVVGVTQPRRVAAVTVAGRVADERGAVLGHEVGYCIRFDDCTDPLATRIKFLTDGMLVREMMVDPLLTKYSVIMLDEAHERTLYTDIAIGLLKKIQKKR-----GDLRLIVASATLDAEKFRDFFNQNETSDPARDTSVTLTVEGRTFPVDIFYLQSPVPDYIKATVDTVVKIH----QTEGDGD--------ILAFLTGQEEVETVVSMLIEQARALARTGMKKHLRVLPMYAGLPS-FEQMKVFERVSHSVRKVIVATNVAETSITISGIVYVIDCGFMKLRAYNPRTAIECLVVVPVSQASANQRAGRGGRNRSGKCYRLYTEEAFDQ-LPQSTVPEMQRSNLAPVILQLKALGIDNVLRFHFMSPPPAQSMVQALELLYALGGLDK-----DCRLTEPLGMRIAEFPLNPMFAKMLLESGNF--GCSQEVLSIAAMMQIQNVFVFPSNQKSQATRVHRKFAVEEGDHLTMLNVYEAFIKHN---KSSQWCQEHFLNYKGLVRAATVRDQLKKLLVKFQVP 595          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Mouse
Match: Dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:MGI Symbol;Acc:MGI:1306823])

HSP 1 Score: 350.132 bits (897), Expect = 1.432e-106
Identity = 203/568 (35.74%), Postives = 328/568 (57.75%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREETI 1770
            SLPIY  K+Q+++ +      IVI  TGSGKTTQI ++L          IG +QPRR+A +S+A RVSEE  C +G+ VGY++RFE  ++  T IK+MTDG++LRE ++DP L  Y I++LDE HERT++ D+LFG++   + ++K+++M   K ++ SAT+D   F  +F E   +  I    +P+ +    +   DY+  S+I   Q+H+ +   +            IL+FLTG++EI   C+IL E  K L  D  + L + P+YSALPSE+Q   + +     +R V+++TNIAETS+TI G+  V+D GF KQK  +  +G++ L + PISQAQA+QRAGRA R GPG C+RLYT+  +   M    + E+ R NLA+  L++  +G +D+L F +++ P +  +  ++  L  L A+D+  L     +T LG+ +  FPL+P     L+ S      C  ++  +V+ML+V    +  ++    +     +F+   GD +++L +Y ++ K N       WC ++ I+   + RA  + KQ+  I     L + +C + T+
Sbjct:  535 SLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLL--KKTVQKRQDM---KLIVTSATLDAVKFSQYFYEAPIF-TIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGD------------ILVFLTGQEEIDTACEILYERMKSLGPDVPE-LIILPVYSALPSEMQ-TRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGL-----LTRLGRRMAEFPLEPMLCKMLIMSVHL--GCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSW-KNNKFSNP--WCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTV 1072          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Mouse
Match: Dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:MGI Symbol;Acc:MGI:1306823])

HSP 1 Score: 349.362 bits (895), Expect = 6.453e-106
Identity = 203/568 (35.74%), Postives = 328/568 (57.75%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREETI 1770
            SLPIY  K+Q+++ +      IVI  TGSGKTTQI ++L          IG +QPRR+A +S+A RVSEE  C +G+ VGY++RFE  ++  T IK+MTDG++LRE ++DP L  Y I++LDE HERT++ D+LFG++   + ++K+++M   K ++ SAT+D   F  +F E   +  I    +P+ +    +   DY+  S+I   Q+H+ +   +            IL+FLTG++EI   C+IL E  K L  D  + L + P+YSALPSE+Q   + +     +R V+++TNIAETS+TI G+  V+D GF KQK  +  +G++ L + PISQAQA+QRAGRA R GPG C+RLYT+  +   M    + E+ R NLA+  L++  +G +D+L F +++ P +  +  ++  L  L A+D+  L     +T LG+ +  FPL+P     L+ S      C  ++  +V+ML+V    +  ++    +     +F+   GD +++L +Y ++ K N       WC ++ I+   + RA  + KQ+  I     L + +C + T+
Sbjct:  588 SLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLL--KKTVQKRQDM---KLIVTSATLDAVKFSQYFYEAPIF-TIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGD------------ILVFLTGQEEIDTACEILYERMKSLGPDVPE-LIILPVYSALPSEMQ-TRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGL-----LTRLGRRMAEFPLEPMLCKMLIMSVHL--GCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSW-KNNKFSNP--WCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTV 1125          
BLAST of ATP-dependent RNA helicase, putative vs. UniProt/SwissProt
Match: sp|Q9H6R0|DHX33_HUMAN (ATP-dependent RNA helicase DHX33 OS=Homo sapiens OX=9606 GN=DHX33 PE=1 SV=2)

HSP 1 Score: 401.749 bits (1031), Expect = 1.203e-129
Identity = 226/570 (39.65%), Postives = 346/570 (60.70%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFF-GENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEI----RRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSV-NVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCR 1758
            SLPI+  + Q+L  ++  DN ++I  TGSGKTTQIP++LY   +++  +I ++QPRR+A IS+ATRVS+E   E+G+ VGY+VRF+  +++ T+IKF+TDG++LREA+ D LL+ Y+ +ILDE HERT++ D+LFGVV  AQK RK+    PLK ++MSATMD   F  +F G    Y  ++   HP+ +    Q  +DY+  +++  FQ+H    +A  S+D        IL+FLTG++EI    + C DI      K + D    + V PLY++LP   Q+L V +      R VI+STNIAETSITI G++ V+D G  K K  +P SGLE L ++ +S+ QA QR GRA R   GIC+RLYT+  FE    K T+ E+ R NLA+  L +  +   +VL F ++ KP  + ++ +I  L  L A++  D   +  +T +G+ +  FPL+P+FA  +L S KF   C  ++  +V++L+V + + H   S R+ V  V ++F S  GD +++L IYR F  L      + WC+++ +    M     V  QL++IC  + +P+ + R
Sbjct:   73 SLPIFQARGQLLAQLRNLDNAVLIGETGSGKTTQIPQYLYEGGISRQGIIAVTQPRRVAAISLATRVSDEKRTELGKLVGYTVRFDDVTSEDTRIKFLTDGMLLREAISDSLLRKYSCVILDEAHERTIHTDVLFGVVKAAQKRRKELGKLPLKVIVMSATMDVDLFSQYFNGAPVLY--LEGRQHPIQVFYTKQPQNDYLHAALVSVFQIHQ---EAPSSQD--------ILVFLTGQEEIEAMSKTCRDI-----AKHLPDGCPAMLVLPLYASLPYA-QQLRVFQGAPKGYRKVIISTNIAETSITITGIKYVVDTGMVKAKKYNPDSGLEVLAVQRVSKTQAWQRTGRAGREDSGICYRLYTEDEFEK-FDKMTVPEIQRCNLASVMLQLLAMKVPNVLTFDFMSKPSPDHIQAAIAQLDLLGALEHKD--DQLTLTPMGRKMAAFPLEPKFAKTILMSPKFH--CTEEILTIVSLLSV-DSVLHNPPSRREEVQGVRKKFISSEGDHMTLLNIYRTFKNLGG---NKDWCKENFVNSKNMTLVAEVRAQLRDICLKMSMPIASSR 614          
BLAST of ATP-dependent RNA helicase, putative vs. UniProt/SwissProt
Match: sp|Q80VY9|DHX33_MOUSE (ATP-dependent RNA helicase DHX33 OS=Mus musculus OX=10090 GN=Dhx33 PE=1 SV=1)

HSP 1 Score: 400.593 bits (1028), Expect = 3.070e-129
Identity = 225/569 (39.54%), Postives = 345/569 (60.63%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEI----RRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSV-NVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCR 1758
            SLPI+  + Q+L  ++  DN ++I  TGSGKTTQIP++LY   +++  +I ++QPRR+A IS+ATRVS+E   E+G+ VGY+VRFE  +++ T+IKF+TDG++LREA+ D LL+ Y+ +ILDE HERT++ D+LFGVV  AQK RK+    PLK ++MSATMD   F  +F        ++   HP+ +    Q   DY+  +++  FQ+H    +A  S+D        IL+FLTG++EI    + C DI      + + D    + V PLY++LP   Q+L V +      R VI+STNIAETSITI G++ V+D G  K K  +P SGLE L ++ +S+ QA QR GRA R   GIC+RLYT+  FE    K T+ E+ R NLA+  L +  +   +VL F ++ KP  + ++ +I  L  L A++  D   +  +T +G+ +  FPL+PRFA  +L SSKF   C  ++  +V++L+V + + +   + RD V +V ++F S  GD +++L IYR F  +      + WC+++ +    M     V  QL+EIC  + +P+ + R
Sbjct:   64 SLPIFRARGQLLAQLRNLDNAVLIGETGSGKTTQIPQYLYEGGISRQGIIAVTQPRRVAAISLATRVSDEKRTELGKLVGYTVRFEDVTSEDTRIKFLTDGMLLREAISDSLLRKYSCVILDEAHERTIHTDVLFGVVKTAQKRRKELGKLPLKVIVMSATMDVDLFSQYFN-RAPVLYLEGRQHPIQIFYTKQPQQDYLHAALVSVFQIHQ---EAPASQD--------ILVFLTGQEEIEAMSKTCRDI-----ARHLPDGCPSMLVLPLYASLPYS-QQLRVFQGAPKGYRKVIISTNIAETSITITGIKYVVDTGMVKAKKYNPDSGLEVLAVQRVSKTQAWQRTGRAGREDSGICYRLYTEDEFEK-FEKMTVPEIQRCNLASVILQLLAMKVPNVLTFDFMSKPSPDHIEAAIAQLDLLGALEHKD--DQLTLTPIGRKMAAFPLEPRFAKTILLSSKFH--CTEEILTIVSLLSV-DSVLYNPPARRDEVQSVRKKFISSEGDHITLLNIYRTFKNIGG---NKDWCKENFVNSKNMLLVAEVRAQLREICLKMSMPIMSSR 605          
BLAST of ATP-dependent RNA helicase, putative vs. UniProt/SwissProt
Match: sp|Q54NJ4|DHX15_DICDI (Putative pre-mRNA-splicing factor ATP-dependent RNA helicase dhx15 OS=Dictyostelium discoideum OX=44689 GN=dhx15 PE=3 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 5.949e-117
Identity = 214/561 (38.15%), Postives = 329/561 (58.65%), Query Frame = 1
Query:   70 LPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDD-VNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPF-GDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPM 1746
            LP++  K+  ++ IK     I++  TGSGKTTQIP+F+ +   +  GKM+G++QPRR+A IS+A RVSEEM+ E+GE VGYS+RFE  S+ RT +K++TDG++LRE++ DP L  Y+++ILDE HERT++ D+LFG++ +  K RK      LK ++MSAT++   F  +F EN     +    HP+ +    + + DY+ ++V     +H             +     IL+FLTGE+EI   C  +  E+++      K L   PLYS+LP   Q       K+   R  IVSTNIAETS+TI G+  V+D GFSKQK  +P S +ESL + PIS+A A QRAGRA R  PG CFRLYT+  F+ +M ++T  E+ R+NLA+  L +  LG  D++ F +++ P  + + R++ +L  L A+D+     E Q+TE+G  +  FPLDP+ +  L+ S+  + SC  ++  + AML+     F     +R   + +++ +  F GD ++ML +Y +F K     E   WC  + + +  + +A  V  QL  I     LP+
Sbjct:   77 LPVWKQKEDFIKVIKENQVVILVGETGSGKTTQIPQFVVDAGLIRPGKMVGVTQPRRVAAISVAKRVSEEMDFELGEEVGYSIRFEELSSARTFMKYLTDGMLLRESMSDPTLNKYDVIILDEAHERTLSTDILFGLIKDILKRRKD-----LKLIVMSATLEAGKFQKYF-ENAPLIKVPGRLHPVEIFYTEEAAKDYLESAVRTVIDIH------------TNEGTGDILVFLTGEEEIEDTCAKIQRETRERGLPPMKTL---PLYSSLPIYQQSKIFDTCKE---RKCIVSTNIAETSLTIDGIVFVVDPGFSKQKTYNPRSRVESLLVAPISKASANQRAGRAGRTRPGKCFRLYTEKAFKELMIQQTHPEILRSNLASVVLQLLKLGVVDLVHFDFMDPPVPDTLIRALEVLHYLGALDD-----EGQLTEIGSIMSEFPLDPQLSKMLIVSA--ERSCSNEILTIAAMLSA-PNCFMRPKDNRIEADSAKKSFDHFDGDHLTMLNVYHSFKKNG---EDPTWCYDNFLNHRAIKQADSVRSQLARILTRFKLPL 602          
BLAST of ATP-dependent RNA helicase, putative vs. UniProt/SwissProt
Match: sp|Q9H5Z1|DHX35_HUMAN (Probable ATP-dependent RNA helicase DHX35 OS=Homo sapiens OX=9606 GN=DHX35 PE=1 SV=2)

HSP 1 Score: 354.755 bits (909), Expect = 1.162e-111
Identity = 204/591 (34.52%), Postives = 334/591 (56.51%), Query Frame = 1
Query:   19 IKHKPFAKKIKNDEICSLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDD-VNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTK-RTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYN---------VIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHK-GLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITE-LGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKT 1752
            + + P+A      +   LP++  ++ IL  I+     +++  TG GK+TQIP++L       +G+++G++QPRR+A +++A RV+EE    +G  VGY +RF+  + +  T+IKF+TDG+++RE ++DPLL  Y++++LDE HERT+  D+  G++   QK R       L+ ++ SAT+D   F +FF +N   +          ++    P+ +  L     DY++++V    ++H    Q E   D        +L FLTG++E+     +LIE+++ L R   K  L V P+Y+ LPS  +++ V E      R VIV+TN+AETSITI G+  VIDCGF K +  +P + +E L + P+SQA A QRAGR  R   G C+RLYT+  F+  +P+ T+ E+ R+NLA   L +  LG  +VL+F ++  P    + +++ +L  L  +D+     + ++TE LG  +  FPL+P FA  LLES  F   C  ++ ++ AM+ +        N    ++ V R+F    GD ++ML IY AF K N  D K  WC++H + Y  + RA  V +QLK++     +P K+
Sbjct:   37 VVYNPYAALSIEQQRQKLPVFKLRNHILYLIENYQTVVIVGETGCGKSTQIPQYLAEAGWTAEGRVVGVTQPRRVAAVTVAGRVAEERGAVLGHEVGYCIRFDDCTDQLATRIKFLTDGMLVREMMVDPLLTKYSVIMLDEAHERTLYTDIAIGLLKKIQKKR-----GDLRLIVASATLDADKFRDFFNQNETSDPARDTCVILTVEGRTFPVDIFYLQSPVPDYIKSTVETVVKIH----QTEGDGD--------VLAFLTGQEEVETVVSMLIEQARALARTGMKRHLRVLPMYAGLPS-FEQMKVFERVSRSVRKVIVATNVAETSITISGIVYVIDCGFVKLRAYNPRTAIECLVVVPVSQASANQRAGRGGRSRSGKCYRLYTEEAFDK-LPQSTVPEMQRSNLAPVILQLKALGIDNVLRFHFMSPPPAQSMVQALELLYALGGLDK-----DCRLTEPLGMRIAEFPLNPMFAKMLLESGNF--GCSQEILSIAAMMQIQNIFVVPPNQKSHAIRVHRKFAVEEGDHLTMLNIYEAFIKHNK-DSK--WCQEHFLNYKGLVRAATVREQLKKLLVKFQVPRKS 598          
BLAST of ATP-dependent RNA helicase, putative vs. UniProt/SwissProt
Match: sp|Q54F05|DHX8_DICDI (ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum OX=44689 GN=dhx8 PE=3 SV=1)

HSP 1 Score: 365.54 bits (937), Expect = 1.421e-111
Identity = 206/551 (37.39%), Postives = 322/551 (58.44%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAF--TKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQL 1713
            SLPI+  ++  L+ +      +VI  TGSGKTTQ+ ++L          IG +QPRR+A +S++ RV+EE  C++G+ VGY++RFE  ++  T IKFMTDG++LRE +LDP L +Y+++ILDE HERT++ D+LFG++  A + R +     LK +I SAT++ + F  +F  N +  +I     P+ ++       DY+  S+I   Q+H+            S     IL+FLTG++EI   C IL E  K L  +    L + P+YSALPSE+Q   + E     +R V+++TNIAETS+TI G+  VID GFSKQK  +P +G++SL + PISQA A QR+GRA R GPG C+RLYT+  F++ M   ++ E+ R NL    LT+  +G +D+L F +++ P V  +  ++  L  L A+DE  L     +T LG+ +  FPLDP+ +  L+ S      C  ++  VVAML+V    +  +     +     +F+ P GD +++L +Y ++  +K ++      WC ++ ++   + RA  V KQL
Sbjct:  507 SLPIFPLREAFLQAVSEHQLLVVIGETGSGKTTQMAQYLAEAGYGTRGKIGCTQPRRVAAMSVSKRVAEEFGCQLGQEVGYAIRFEDCTSPETIIKFMTDGILLRECLLDPNLSAYSVIILDEAHERTISTDVLFGLLKQALQRRPE-----LKVLITSATLEAEKFSKYF-MNAQLFIIPGRTFPVDIRYTKDPEADYLDASLITVMQIHL------------SEPPGDILLFLTGQEEIDAACQILYERMKSLGSNV-PDLIILPVYSALPSEMQ-TKIFEPAPPGSRKVVIATNIAETSLTIDGIYYVIDPGFSKQKCFNPKNGMDSLVVAPISQAAARQRSGRAGRTGPGKCYRLYTESAFKNEMLASSIPEIQRTNLGNTVLTMKAMGINDLLNFDFMDPPPVQTLVSAMEQLYSLGALDEEGL-----LTRLGRKMAEFPLDPQLSKMLIASVDL--GCSDEILTVVAMLSVQNVFYRPKEKQALADQKKAKFFQPEGDHLTLLNVYESWKNSKFSN-----PWCFENFVQARSLRRAQDVRKQL 1025          
BLAST of ATP-dependent RNA helicase, putative vs. TrEMBL
Match: A0A2B4T111 (Putative ATP-dependent RNA helicase DHX33 OS=Stylophora pistillata OX=50429 GN=Dhx33 PE=4 SV=1)

HSP 1 Score: 431.795 bits (1109), Expect = 6.581e-139
Identity = 238/591 (40.27%), Postives = 369/591 (62.44%), Query Frame = 1
Query:   25 HKPFAKKIKNDEICSLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRD--KHKGLS-----VYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRD-SVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREETID 1773
            H P  K+  N     LPIY  ++ I+ ++++ +N +++  TGSGKTTQIP++L+   + K   I  +QPRR+A ISIA RV++EM+ ++GE VGY+VRFE  +T +T +K+MTDG++LREA+ DP+L  Y+++ILDE HERTV+ D+LFGVV  AQ++RK+K+  PLK V+MSAT++ + F  +F  N K   I+   HP+ +   V+Q  DYV  +++   QLH      E+           IL+FLTG+DE        IE   KLV D  +H G       V P+++ALPS+ Q + V  S     R VI++TNIAETSITIPGV+ V+D GF K K  HP +GL+ LQ++P+S+AQA QR GRA R   G+C+RLYT+  F+  + + T+ E+ R NL +  L +  LG  DVL F +L+ P  + ++ ++  L  L A+ + +    +++  LG+ +  FPL+PR A  +L S + +  C  ++  +VA+L+V + L +T  + RD ++ V ++F S  GD +++L IYRA+    +V   + WC +H I    + R + + KQL+EIC  LD+P+ +C ++T++
Sbjct:   53 HSPARKQRFN-----LPIYTGRNAIIAEVRSKENVVIVGETGSGKTTQIPQYLHEARLTKLGAIACTQPRRVAAISIAQRVTKEMHVQLGEEVGYTVRFEDVTTAKTCVKYMTDGMLLREAIGDPILHRYSVVILDEAHERTVHTDVLFGVVKAAQEMRKEKHQKPLKIVVMSATLEAEHFSRYF-NNAKVLYIEGRQHPVQVMYAVEQQKDYVHAALVSVMQLHQ-----EMPP------GGDILVFLTGQDE--------IESLAKLVTDCAQHCGAGCPEVLVCPMFAALPSQHQ-MKVFISAPIGKRKVILATNIAETSITIPGVKYVVDTGFVKGKAFHPKTGLDILQVQPLSKAQARQRTGRAGRETSGVCYRLYTEEQFDE-LKEMTMPEIQRCNLTSVVLQLMALGISDVLHFDFLDCPSQDAIENALEQLATLGAVMKGNSG--FELMPLGRKMANFPLEPRLAKVILSSQELK--CSEEMITIVALLSV-DSLTYTPQNKRDHALAVHKKFLSSEGDQMTLLNIYRAY---KAVSGHKEWCHEHFINSQTVKRVMDIRKQLREICLRLDIPLVSCGKDTVN 608          
BLAST of ATP-dependent RNA helicase, putative vs. TrEMBL
Match: A0A1S3J0N4 (putative ATP-dependent RNA helicase DHX33 OS=Lingula unguis OX=7574 GN=LOC106169066 PE=4 SV=1)

HSP 1 Score: 429.098 bits (1102), Expect = 4.526e-138
Identity = 231/567 (40.74%), Postives = 355/567 (62.61%), Query Frame = 1
Query:   70 LPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSRE-FYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREET 1767
            LPI+  K ++L++++     I+I  TG GKTTQIP+FLY   +++   I I+QPRR+A ISIA RVS+EM  E+G+TVGY VRFE  S + TKI+FMTDG++LRE+ LDPLLK Y+ +ILDE HERTV+ D+LFGVV  AQK R+ K +  LK ++MSATMD   F  +F +      ++   +P+ +K  VQ   DY+ ++++   Q+H    +A + +D        IL+FLTG++EI      L +  K + + ++  + V P+Y+ALP+  Q++ + +      R VIV+TNIAETS+TIP ++ V+D G  K K  +P SGL+ L++  +S++QA QR GRA R  PG C+RLYT+  FE      T+ E+ R NL++  L +  LG  D++ F +++KP    +  +++ L  L A+++ +   + Q+T LG+ L  FPLDPR +  LL + +F   CL ++  VV++L+V E +FHT  + RD+ + +R+ F S  GD +++L +YRA+     V   + WC+++ I    M  A  + KQL+EIC  L LP K+C + T
Sbjct:   48 LPIFPAKGKLLQNVQQVSTAIIIGETGCGKTTQIPQFLYKAGMHRNHTIAITQPRRVAAISIAERVSKEMGTELGQTVGYCVRFEDVSCQATKIRFMTDGMLLRESTLDPLLKRYSFVILDEAHERTVHTDVLFGVVKGAQKRRRAKGLPQLKILVMSATMDVDQFSQYF-DCAPVFYLEGRQYPIQVKYSVQSQSDYLFSALVAVMQIHQ---EAPLGQD--------ILVFLTGQEEIESAVHTLRDIVKDVTK-QYAPMIVCPMYAALPTG-QQMRIFQPTPGGVRKVIVATNIAETSVTIPNIKFVVDTGMVKAKIFNPNSGLDMLKVCWVSKSQAWQRTGRAGREAPGTCYRLYTEEEFEQ-FSTNTIPEIQRCNLSSVILQLLALGISDIVHFDFMDKPRPEAILAALDQLVLLGAVEKQE---KVQLTLLGRQLAAFPLDPRLSRVLLGAKEF--DCLEEMLTVVSLLSV-ESVFHTPYNKRDTAHAARQKFISSEGDHLTLLNVYRAY---KGVKGDKQWCQENFINARNMQTASQIRKQLREICVHLQLPFKSCGQNT 590          
BLAST of ATP-dependent RNA helicase, putative vs. TrEMBL
Match: A0A3M6V024 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00007711 PE=4 SV=1)

HSP 1 Score: 428.713 bits (1101), Expect = 1.125e-137
Identity = 233/584 (39.90%), Postives = 366/584 (62.67%), Query Frame = 1
Query:   25 HKPFAKKIKNDEICSLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRD-SVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREETID 1773
            H P  K+  N     LPIY  +  I+ ++++ +N I+I  TGSGKTTQIP++L+   + K   +  +QPRR+A ISIA RV++EM+ ++GE VGY+VRFE  ++ +T +K+MTDG++LREA+ DP+L  Y+++ILDE HERTV+ D+LFGVV  AQ++RK+K+  PLK V+MSAT++ + F  +F  + K   I+   HP+ +   V+Q  DYV  +++   QLH      E+           IL+FLTG+DEI      L+ +  +        + V P+++ALPS+ Q + V  S     R VI++TNIAETSITIPGV+ V+D GF K K  HP +GL+ LQ++P+S+AQA QR GRA R   G+C+RLYT+  F+  + + T+ E+ R NLA+  L +  LG  DVL F +L+ P  + ++ ++  L  L A+ + +    +++  LG+ +  FPL+PR A  +L S +   +C  ++  +VA+L+V + L +T  S RD ++ V ++F S  GD +++L IYRA+    +V   + WC +H I    + R + + KQL+EIC  LD+P+ +C ++T++
Sbjct:   52 HNPARKQSFN-----LPIYTGRSVIIAEVRSRENVIIIGETGSGKTTQIPQYLHEARLTKLGAVACTQPRRVAAISIAQRVAKEMHVQLGEEVGYTVRFEDVTSAKTCVKYMTDGMLLREAIGDPILHRYSVVILDEAHERTVHTDVLFGVVKAAQEMRKEKHQKPLKIVVMSATLEAEHFSRYFN-SAKVLYIEGRQHPVQIMYAVEQQKDYVHAALVSVMQLHQ-----EMPP------GGDILVFLTGQDEIESLAK-LVTDCAQHCEAGCPEVLVCPMFAALPSQHQ-MKVFISAPIGKRKVILATNIAETSITIPGVKYVVDTGFVKGKAFHPKTGLDILQVQPVSKAQARQRTGRAGRETSGVCYRLYTEEQFDE-LKEMTMPEIQRCNLASVVLQLMALGILDVLHFDFLDSPSQDAIENALEQLVVLGAVRKGNSG--FELMPLGRKMANFPLEPRLAKVILSSHEL--NCSEEIITIVALLSV-DSLTYTPQSKRDHALAVRKKFLSSEGDQMTLLNIYRAY---KAVSGHKEWCHEHFINSQTVKRVMDIRKQLREICIRLDIPLISCGKDTVN 607          
BLAST of ATP-dependent RNA helicase, putative vs. TrEMBL
Match: A7SUS3 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g174574 PE=4 SV=1)

HSP 1 Score: 426.787 bits (1096), Expect = 5.584e-137
Identity = 228/568 (40.14%), Postives = 354/568 (62.32%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRD-SVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREET 1767
            SLPI++ +  ++ +I+   N I++  TGSGKTTQIP++LY   V +  +I  +QPRR+A ISIA RVS EM  ++GE VGY+VRFE  ++ +T+IK+MTDG++LRE++ D LLK Y+++ILDE HERT++ D+LFG+V  AQ  RK K M PLK V+MSAT++   F  +FG + +   I+   HP+ +   V+   DY+  ++I   QLH  K                IL+FLTG+DEI     ++ + S     D  + L V P+++ALPS  Q++ V        R VI+STNIAETS+TIPGV+ VID G+ K K  HP +GL+ L+++P+S+AQA QR GRA R   G+C+RLYT+  FE  + + T+ E+ R NL++  L +  LG  D+  F +++KP  + +  ++  L  L A+ E +  G+Y++T LG+ + +FPL+PR A  +L S      C  ++  VVA+L+V + + +T  S RD ++ V ++F S  GD +++L IYRA+ +       + WC +H I    M   + + KQL+EIC  L++ +++C +++
Sbjct:   57 SLPIFSARKSLITEIRNRQNVIIVGETGSGKTTQIPQYLYEAKVARNSVIACTQPRRVAAISIAQRVSREMGVQLGEEVGYTVRFEDVTSTKTRIKYMTDGMLLRESIGDSLLKRYSVIILDEAHERTIHTDVLFGIVKGAQISRKDKGMLPLKIVVMSATLEAHQFSEYFG-SAEVLYIEGRQHPVELMYAVEPQVDYMHAALITIMQLHQEK-----------PLGGDILVFLTGQDEIESLSKLVSDCSLHCPPDCPQ-LLVCPMFAALPSS-QQMQVFRPAIPGARKVILSTNIAETSVTIPGVKYVIDTGYVKAKGFHPKTGLDMLRVQPVSKAQARQRLGRAGRECSGVCYRLYTEEQFEQ-LAEATVPEIQRCNLSSVILQLMALGIADIASFDFMDKPSADAIDGALKQLVILEALQEIN--GDYKLTSLGQKMAQFPLEPRLAKVILASETL--GCSEEILTVVALLSV-DSITYTPQSKRDHALKVRKKFLSSEGDQITLLNIYRAYKQCGM---NKSWCAEHFINTRVMKLVMDIRKQLREICIRLEIKLQSCGKDS 601          
BLAST of ATP-dependent RNA helicase, putative vs. TrEMBL
Match: A0A2G8KKM0 (Putative ATP-dependent RNA helicase DHX33 isoform X2 OS=Stichopus japonicus OX=307972 GN=BSL78_14574 PE=4 SV=1)

HSP 1 Score: 424.476 bits (1090), Expect = 8.880e-136
Identity = 233/584 (39.90%), Postives = 357/584 (61.13%), Query Frame = 1
Query:   28 KPFAKKIKND---EICSLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGE-YQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREET 1767
            K F  +  ND   E C+LPIY+ + +++ +I+   N IVI  TGSGKTTQIP++L    V KGK+I  +QPRR+A  +IA RV+ EM  ++G+TVGY+VRF+  ++ +TK+KFMTDG++LREA+L+PLL  Y I+ILDE HERTV+ D+LFG+V  AQ+ R+  N  PLK V+MSATMD   F N+F +      +    HP+ +    +   DY+  +++  FQ+H         +++ +N +  IL+FLTG++EI      + + +K L  +   GL V  LY+ALP  +QR  V ++     R VI++TNIAETSITIPG++ VID G  K K   P SG++ L+++ +SQAQA QR GRA R   G C+RLYT+  F   +P  T+ E+ RANLA   L +  L   DVL F +++ P    ++++I+ L  L A++E     +  ++T LG+ ++ FPLDPR +  +L +  F   CL ++ ++V++L+V   ++   N    +    ++F S  GD + +L IYR+F    +V   + WC ++ I    M +A+ V KQL+E+C    LP ++C  +T
Sbjct:   23 KDFNSERSNDLYQERCNLPIYSARAKLITEIRKAQNSIVIGETGSGKTTQIPQYLMEAGVTKGKVIACTQPRRVAATTIAARVAAEMGVQLGDTVGYTVRFDDTTSSQTKLKFMTDGMLLREAILNPLLSRYGIIILDEAHERTVHTDVLFGIVKAAQRQRQVDNKNPLKVVVMSATMDVDHFSNYFSK-APVLYVQGRQHPIQLMYASKAQSDYIYAALVTIFQIH---------QEYPANED--ILVFLTGQEEIEGVSRAVTDVAKDLPSES-PGLIVCRLYAALPQAIQR-KVFQTTPVGQRKVILATNIAETSITIPGIKHVIDTGRVKAKSYVPGSGVDMLKVQWLSQAQAWQRTGRAGREDSGTCWRLYTEDTFGK-LPANTVPEIQRANLANVVLQLLALNVKDVLNFDFMDPPTKESLEKAIDQLHLLGAVEENKEGAQLLKLTSLGREMVAFPLDPRLSKVILAAKDF--GCLEEILSIVSLLSVDSVIYAHPNKREQASQHWKKFTSSDGDHIMLLTIYRSF---KAVKGNKKWCFENFIHSRNMKQAIEVRKQLRELCVKAKLPFQSCGHDT 586          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Cavefish
Match: dhx33 (DEAH (Asp-Glu-Ala-His) box polypeptide 33 [Source:NCBI gene;Acc:796505])

HSP 1 Score: 417.927 bits (1073), Expect = 6.129e-136
Identity = 232/572 (40.56%), Postives = 352/572 (61.54%), Query Frame = 1
Query:   70 LPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEI----RRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREETID 1773
            LPIY  + Q+L  ++   N ++I  TGSGKTTQIP++LY   + +  +IG++QPRR+A IS+A RV++E NC +G+ VGY+VRFE  ++  TKIKFMTDG++LREA+ DPLL  Y ++ILDE HERT++ D+LFGVV +AQ+ RK+ N  PLK ++MSATMD   F  +F ++     ++   HP+ +    Q   DY++ +++  FQ+H    +A  S D        IL+F+TG++EI    R C DI      K + D    ++V PLY++LP   Q+L V +      R VI+STNIAETSITI G++ VID G  K K  +P SGLE L ++ +S+AQA QRAGRA R   G C+RLYT+  F++++   T+ E+ R NLA   L +  LG  DVL F ++ KP    ++ ++  L  L A++  D   +  +T LGK +  FPL+PR+A  +L S +F  SC  +V  ++++L+V   L++      + + V ++F S  GD +++L IYRAF K++   E   WCR++ +    M     V  QL++IC  L L +++ + E ++
Sbjct:  144 LPIYQARSQLLSQLRQLHNAVLIGETGSGKTTQIPQYLYEAGIGRQGLIGVTQPRRVAAISLAGRVAQEKNCSLGKLVGYTVRFEDVTSSETKIKFMTDGMLLREAIGDPLLLRYTVVILDEAHERTIHTDVLFGVVKSAQRKRKEHNKIPLKVLVMSATMDVDLFSQYFNKSPVL-YLEGRQHPIQIYYTKQPQSDYLQAALVSIFQIHQ---EAPSSHD--------ILVFMTGQEEIEALARTCRDI-----AKHLPDTCGPMTVIPLYASLPPT-QQLRVFQPAPKGCRKVILSTNIAETSITISGIKYVIDTGMVKAKRYNPDSGLEVLAVQRVSKAQAWQRAGRAGREDSGSCYRLYTEEEFDNLI-SMTVPEIQRCNLAGVVLQLLALGVPDVLNFDFMSKPSPESMRMAVEQLDLLGAVERKD--DQVILTPLGKKMAYFPLEPRYAKTILISPEF--SCTEEVLTILSLLSVDSVLYNPPARRDEVLAVRKKFISSEGDHMTLLNIYRAFKKVSGNKE---WCRENFVNSRNMGLVAEVRSQLRDICIKLGLKLESSQSELVN 689          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Cavefish
Match: dhx40 (DEAH (Asp-Glu-Ala-His) box polypeptide 40 [Source:ZFIN;Acc:ZDB-GENE-080507-1])

HSP 1 Score: 343.969 bits (881), Expect = 2.807e-109
Identity = 207/566 (36.57%), Postives = 313/566 (55.30%), Query Frame = 1
Query:   70 LPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLV--------QQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIE--ESKKLVRDKH----KGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQ-NSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEI 1722
            LPIY Y+ ++++ +K     +V   TGSGKTTQ+P    +    K   IG++QPRR+A I++A RVS+EM   +G  VGY VRF+  ++K T I+++TDG MLRE + DP L  Y+I+ILDEVHER++N D+L G++             PLK V+MSAT++     +FFG+   +  I    +P  +K L         ++S  YV+  V V   +H      E S D        IL+FLTG++EI + CD+L E  ES     D H    +GL V PLY ++P++ Q+     S   + R  +V+TNIA TS+TI G++ ++D GF KQ   +   GL+ L++ PIS+++A+QRAGRA R   G CFR+Y    +E  MP+ T+ E+ R +L +  LT+  LG HDV++FP+L+ P+   +   +  LK L   D  D  G   +T LG+ ++ FPL P    ALL+S+       ++ V A++++  +F +  H E      V V R+     G     L + R F K  + +    WC+ H I +  +  A  V  QL+EI
Sbjct:   15 LPIYPYRKKLIQAVKENQFLVVTGETGSGKTTQLPPVPVSSRDGK---IGVTQPRRVAAITVAQRVSQEMGVRLGLEVGYQVRFDDCTSKDTLIRYVTDGCMLREILADPSLTQYSIVILDEVHERSLNTDILLGLLKKTPSRGSHGRTVPLKVVVMSATLEADKLSSFFGQCPVFT-IPGRTYP--VKELFCGYIGPKDKESSAYVKEVVKVALDVHTN----EASGD--------ILVFLTGQNEIEKACDVLFEKAESIDYRYDMHDRSVEGLLVLPLYGSMPTDQQKQIFQPSPAGV-RKCVVATNIAATSLTINGIKYIVDSGFVKQLNHNSRVGLDILEVVPISKSEAQQRAGRAGRTSAGKCFRIYNKEFWERCMPEYTVPEIQRTSLTSVILTLKCLGVHDVIRFPYLDHPEERFI---LTALKQLYQYDAIDRKG--NVTRLGRLMVEFPLPPGLTRALLKSAALGCEELMLPVAAMLSVENIFIRPGHAEKQKEAEV-VHRDLADSAGSFNDFLILLRIFEKCKASENPSAWCKDHWIHWRALKSAFSVETQLREI 555          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Cavefish
Match: zgc:158828 (DEAH-box helicase 35 [Source:HGNC Symbol;Acc:HGNC:15861])

HSP 1 Score: 339.732 bits (870), Expect = 2.747e-107
Identity = 197/551 (35.75%), Postives = 310/551 (56.26%), Query Frame = 1
Query:  130 IVISTTGSGKTTQIPKFLYNDD-VNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKR-TKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYN---------VIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVR-DKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITE-LGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLP 1743
            +++  TG GK+TQIP++L       +GK+IG++QPRR+A  S+A RV+EE    +G  VGY++RF+  S    T+IKF+TDG+++RE + DPLLK Y++L+LDE HERT+  D+  G++   Q+ R+      L+ ++ SAT+D K F +FF  N   +          ++    P+ +   V    DYV+ +V    ++H     AE   D        +L FLTG++E+ +   +L ++++ L R    K L V P+Y+ LP   +++ V E      R V+V+TNIAETSITI G+  VIDC F K +  +P + +ESL + PIS+A A QRAGRA R  PG CFRLYT+  FE  +P+ T+ E+ R+NLA   L +  LG  +VL+F +L  P    + +++ +L  L  +D+       ++TE +G  +  FPL P FA  LLES  F   C  ++  + AM+ +        +  + +    R+F    GD ++ML +Y AF K     +   WC++H + Y  + RA+ V +QL+ +     +P
Sbjct:   59 VIVGETGCGKSTQIPQYLLEAGWAAEGKVIGVTQPRRVAATSVANRVAEERGALLGHEVGYTIRFDDCSDPHATRIKFLTDGMLVREMMADPLLKKYSVLMLDEAHERTLYTDIAIGLLKKIQRKRRD-----LRLIVASATLDAKKFQDFFNLNESGDPSKDTCGILTVEGRTFPVDVFYTVSPVPDYVKATVETVLKIH----DAEEDGD--------VLAFLTGQEEVEKVVSMLQDQARTLSRYGIKKHLRVLPMYAGLPYA-EQMKVFERLPPTVRKVVVATNIAETSITINGIVFVIDCAFVKLRAYNPRTAIESLVVTPISKASAAQRAGRAGRNRPGKCFRLYTEEDFEK-LPESTVPEMQRSNLAPVILQLKALGIDNVLRFSFLSPPPAQSMVQALELLYALGGLDQYG-----RLTEPMGIRMAEFPLSPMFAKMLLESGNF--GCSKEIVTIAAMMQIQNIFVFPSDQKKAAAREHRKFAVAEGDHLTMLNVYEAFVKHQ---KSSQWCQEHFLNYKGLVRAMSVREQLRRLLNKFKVP 580          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Cavefish
Match: dhx8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:103035799])

HSP 1 Score: 351.288 bits (900), Expect = 5.126e-107
Identity = 204/568 (35.92%), Postives = 328/568 (57.75%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREETI 1770
            SLPIY  K+Q+++ +      IVI  TGSGKTTQI ++L          IG +QPRR+A +S+A RVSEE  C +G+ VGY++RFE  ++  T IK+MTDG++LRE ++DP L  Y I++LDE HERT++ D+LFG++   + ++K+ +M   K ++ SAT+D   F  +F E   +  I    +P+ +    +   DY+  S+I   Q+H+ +   +            IL+FLTG++EI   C+IL E  K L  D  + L + P+YSALPSE+Q   + +     +R V+++TNIAETS+TI G+  V+D GF KQK  +  +G++ L + PISQAQA+QRAGRA R GPG C+RLYT+  +   M    + E+ R NLA+  L++  +G +D+L F +++ P +  +  ++  L  L A+D+  L     +T LG+ +  FPL+P     L+ S      C  ++  +V+ML+V    +  ++    +     +F+ P GD +++L +Y ++ K N       WC ++ I+   + RA  + KQ+  I     L + +C + T+
Sbjct:  545 SLPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLL--KKTVQKRTDM---KLIVTSATLDAVKFSQYFYEAPIF-TIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGD------------ILVFLTGQEEIDTACEILYERMKSLGPDVPE-LIILPVYSALPSEMQ-TRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGL-----LTRLGRRMAEFPLEPMLCKMLIMSVHL--GCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSW-KNNKFSNP--WCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVFSCGKATV 1082          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Cavefish
Match: dhx8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:103035799])

HSP 1 Score: 350.903 bits (899), Expect = 1.435e-106
Identity = 204/568 (35.92%), Postives = 328/568 (57.75%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREETI 1770
            SLPIY  K+Q+++ +      IVI  TGSGKTTQI ++L          IG +QPRR+A +S+A RVSEE  C +G+ VGY++RFE  ++  T IK+MTDG++LRE ++DP L  Y I++LDE HERT++ D+LFG++   + ++K+ +M   K ++ SAT+D   F  +F E   +  I    +P+ +    +   DY+  S+I   Q+H+ +   +            IL+FLTG++EI   C+IL E  K L  D  + L + P+YSALPSE+Q   + +     +R V+++TNIAETS+TI G+  V+D GF KQK  +  +G++ L + PISQAQA+QRAGRA R GPG C+RLYT+  +   M    + E+ R NLA+  L++  +G +D+L F +++ P +  +  ++  L  L A+D+  L     +T LG+ +  FPL+P     L+ S      C  ++  +V+ML+V    +  ++    +     +F+ P GD +++L +Y ++ K N       WC ++ I+   + RA  + KQ+  I     L + +C + T+
Sbjct:  584 SLPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLL--KKTVQKRTDM---KLIVTSATLDAVKFSQYFYEAPIF-TIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGD------------ILVFLTGQEEIDTACEILYERMKSLGPDVPE-LIILPVYSALPSEMQ-TRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGL-----LTRLGRRMAEFPLEPMLCKMLIMSVHL--GCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSW-KNNKFSNP--WCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVFSCGKATV 1121          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Sea Lamprey
Match: dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-050809-39])

HSP 1 Score: 341.273 bits (874), Expect = 1.422e-107
Identity = 200/568 (35.21%), Postives = 322/568 (56.69%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREETI 1770
            SLPIY  K+Q+++ +      IVI  TGSGKTTQI ++L          IG +QPRR+A +S+A RVSEE  C +G+ VGY++RFE  ++  TKIK+MTDG++LRE ++D  L  Y++++LDE HERT++ D+LFG++    K R       +K ++ SAT+D   F  +F E   +  I    +P+ +    +   DY+  S+I   Q+H+ +   +            IL+FLTG++EI   C+IL E  K L  +  + L + P+YSALPSE+Q   + +     +R V+++TNIAETS+TI G+  V+D GF KQK  +  +G++ L + PISQAQA+QRAGRA R GPG  +RLYT+  +   M    + E+ R NLA+  L++  +G +D+L F +++ P +  +  ++  L  L A+D+  L     +T LG+ +  FPL+P     L+ S      C  ++  +V+ML+V    +  ++    +     +F    GD +++L +Y ++ K N       WC ++ ++   + RA  V KQ+  I     L + +C + T+
Sbjct:  101 SLPIYKLKEQLVQAVNDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETKIKYMTDGMLLRECLIDSELMQYSVVMLDEAHERTIHTDVLFGLLKKTIKRRLD-----MKLIVTSATLDAVKFSQYFYEAPIFT-IPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGD------------ILLFLTGQEEIDTACEILYERMKSLGPEVPE-LIILPVYSALPSEMQ-TRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKTYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYQLGALDDEGL-----LTRLGRRMAEFPLEPMLCKMLIMSVHL--GCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYNSW-KNNKFSNA--WCYENFVQARTLRRAQDVRKQMLGIMDRHKLDVVSCAKATV 638          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Sea Lamprey
Match: dhx33 (DEAH (Asp-Glu-Ala-His) box polypeptide 33 [Source:NCBI gene;Acc:796505])

HSP 1 Score: 278.485 bits (711), Expect = 2.682e-87
Identity = 156/412 (37.86%), Postives = 228/412 (55.34%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVI-STTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFF-GENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEI----RRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKP 1284
             LPIY  + ++ R ++     IVI   T  G TTQ+  +    D   G  +   QP     + + +R          + VGY+VRFE   +  T+++F+TDG++LREA+ DPLL + + ++LDE HER+++ D LFGVV  AQ+ R ++ + PLK ++MSATMD   F+++F G    Y  ++   HP+ +    +   D++  ++I  FQ H  +                IL FLTG++EI    R C D+  +    + R     + V PLY+ALP   Q+     +    TR VI++TNIAETSITIPGVR VIDCG  K K   P +G+E L ++ +SQAQA QRAGR+ R GPG C RLYT+ HF+S+    T     R NL +  L +  LG  DV  F +++KP
Sbjct:   40 GLPIYAVRAELTRRLQELHTAIVIFGITAQGSTTQVKSWTGEQDCPPGGEVAYMQPSHTTAVCVPSRRDFYRQNRGRDVVGYTVRFEDVRSASTRVRFVTDGMLLREALGDPLLLATSAVVLDEAHERSLHTDTLFGVVKGAQRQRWEQKLRPLKVIVMSATMDVDRFVSYFNGAPVLY--VEGRQHPIQIFYTREPHSDFLHATLITIFQTHQEQ-----------EAEHHILAFLTGQEEIEAMGRACRDLSRQLPPSVPR-----MCVVPLYAALPHAQQQRVFARAPPKGTRKVILATNIAETSITIPGVRTVIDCGLVKAKMFSPGTGMEVLALQKVSQAQAWQRAGRSGREGPGCCLRLYTEMHFQSLAENTTPELQSRCNLTSVLLHLLALGISDVASFDFMDKP 433          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Sea Lamprey
Match: zgc:158828 (DEAH-box helicase 35 [Source:HGNC Symbol;Acc:HGNC:15861])

HSP 1 Score: 246.514 bits (628), Expect = 1.468e-72
Identity = 170/575 (29.57%), Postives = 288/575 (50.09%), Query Frame = 1
Query:   70 LPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDD-VNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRS-TKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKC-------VIMSATMDPKPFINFFGENTKYN--VIDSVAHPLTMKS--LVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLV-RDK---HKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLP 1743
            LPI+ +++ +L  ++     +++  TG GK+TQIP++L       +G ++ I+QPRR+A  ++A RV+EE    +G  VGY +RF+  S  + T+IKF+TDG+++RE + DPLLK Y+ L+L             FG               P  C       V ++++  P  F   F         ++  V      +S  L+    DYV+ +V    ++H      +I            L FLTG++E+      ++EE +    R K   H+ +   P+Y+ LP  + ++ V E      R V+V+TN+AETS+T+PG+  V+DCGF K +   P   +++L + P S+A A+QRAGRA R  PG C+RLY +  F + +P+ T  E+ R+++A   L +  LG  +VL+F +L  P    + +++ +L  L        +     + LG  +  FP+ P +A  LLES  F   C  ++  + AM+ +        N    +    R+F    GD ++ML ++ AF K N   +   WC++H + Y  + RA  +  QL+++ +   +P
Sbjct:   52 LPIFMHRNHVLYLVEKYRTVVIVGETGCGKSTQIPQYLAEAGWTAEGHVVAITQPRRVAATTVAARVAEERGALLGHEVGYCIRFDDCSDPQATRIKFLTDGMLVREMMADPLLKKYSPLLLR------------FG---------DTTAPYPTACSSFNRSLVEVTSSTIPSSFSRAFECQCCLADYILWRVGQCTNARSYILMYPVPDYVKTTVETIMKIHNDAADGDI------------LAFLTGQEEVENVVSAVVEEVRAAAARSKGSLHRHVRALPMYAGLPY-VDQMKVFERVGRNCRKVVVATNVAETSVTVPGIAFVVDCGFVKLRTYDPRRAVDALLVTPASRASAQQRAGRAGRSRPGKCYRLYPESEF-AKLPEATEPEMRRSDMAPVILQLKALGIDNVLRFSFLSPPPAESMVQAVELLYALGGAWRDASSS----SPLGVRMAEFPMGPMYAKMLLESGTF--GCSKEIITIAAMMQIQNVFLSPPNQKIKAARQQRKFAVEEGDHMTMLNVFEAFVKHN---KSSAWCQQHFLNYKGLVRAGALQDQLRKLLRRFHIP 582          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Sea Lamprey
Match: dhx34 (DEAH (Asp-Glu-Ala-His) box polypeptide 34 [Source:ZFIN;Acc:ZDB-GENE-061207-30])

HSP 1 Score: 249.98 bits (637), Expect = 1.331e-71
Identity = 171/572 (29.90%), Postives = 297/572 (51.92%), Query Frame = 1
Query:   43 KIKNDEICSLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNV------IDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVD----VTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDE--KQHWCRKHCIKYAEMNRAVLVNKQLKEI 1722
            K++ D+  +LPI+ Y+DQ++  ++     +V   TG GK+TQ+P++L +  +++   +  +QPRRIA +S+A RVS E   E G  +GY +RFE   T  TK+ F+T+GL+LR+   +  +  Y++LILDEVHER ++ DLL GV+     LR    +     V+MSAT++ + F  + G+     V      I  +  P+  +    +S+       +        +I   I   + ++    +L+FL+G  +I R     + E+ +    + K   V  L+S L +E Q+  V +      R  IVSTNIAETS+TI GVR ++D G  K+    P + ++ LQ   IS+A AEQR GRA R GPG+CFRLY +  ++++ P   + E+ R  L +  L + ++G  D   F +LE P  + ++ S+  L++  A+DE +     ++T +G+ L   PLD      +L        C++     V  + A ++V        +++ D     R   S  GD +++L ++  + ++ S  +   + WC++H ++   +     + +Q KE+
Sbjct:   97 KLRRDQR-NLPIHEYRDQLVELVRAHQVVVVAGDTGCGKSTQVPQYLLSAGMSR---VACTQPRRIACMSLAKRVSYESLGEHGSQIGYQIRFETSKTAATKVLFLTEGLLLRQMQTEGFMSRYDVLILDEVHERHLHCDLLLGVLRELLPLRDDLRL-----VLMSATINIQLFSRYLGDAPVLQVPGRLYPIQVIYRPVPEEEKTGKSERIDPRPYL--------RIMQSIDHKYPADERGDLLVFLSGMADIAR-----VAEAAQSYAVETKRWIVLQLHSTLSAE-QQDKVFDLAPEGVRKCIVSTNIAETSVTIDGVRFIVDSGKVKEMSYDPKAKMQRLQEFWISRASAEQRKGRAGRTGPGVCFRLYAESEYDALEPY-AVPEVQRVPLDSVVLQMKSMGLGDPRLFGFLEPPPASSLETSMQFLQEQGALDEQE-----ELTPIGRVLATLPLD------VLTGKMLLVGCVLGAVEPVLTIAAAMSVQSPFHRNAHTNPDCSRARRSLESDHGDPLTLLNVFNEWVQVKSGGQVPSRKWCKRHGLEEQRLYEIANLQRQFKEL 633          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Sea Lamprey
Match: dqx1 (DEAQ box RNA-dependent ATPase 1 [Source:ZFIN;Acc:ZDB-GENE-150224-1])

HSP 1 Score: 190.66 bits (483), Expect = 1.803e-53
Identity = 141/493 (28.60%), Postives = 241/493 (48.88%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPK----FLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRL-----AVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGP-GICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLF 1515
            +LP++  ++     I +    +V    G GK+TQIP+    F  + +   G ++  +QP  +A  S+A RV++EM+  VG  VGYSV FE   T  T ++F TD ++LRE   DP L  Y  ++LDEV ER+++ D+L G++ +  + R       L+ V+++     +    ++G+     V+      L    +  +  D VR +V +  ++H      +            +L+FL  + +     +    E+++L     + L + PL    P     L     A   +K    R V++S+ IAE++ +  GVR VID G   +   +P    +S  +RPIS++QAEQ +  A R GP G CFRLY +  F+  MP+     +  +NL    L +  L   D+ +  ++++P      +++  L  LAA+D      +  ++E+G  +   PLDP+ A ALL S +F   C+ ++  + AMLTV    F
Sbjct:   60 ALPVWGAREMFRERIASYPVILVSGEPGVGKSTQIPQWCAEFALSRECEHGTVV-CAQPHAMAATSLAVRVADEMDLNVGHEVGYSVPFEDCCTTDTILRFTTDEMLLRELTSDPQLDRYGAIVLDEVQERSLSTDVLMGLLRDVGRQRPG-----LRVVLVATPCAAEALHRYYGDVPWREVVGQQGQ-LVYTGVETEQRDVVRAAVKLVLEIHRAAQPGD------------VLVFLPSDKDASTAYEQARREARQLSPALGE-LRLVPLLPGHPGGAGALYDAGGAAATAKGRGGRRVVLSSGIAESAFSFEGVRFVIDSGLETKNVYNPRIRADSQVVRPISRSQAEQTSCCAVRAGPAGKCFRLYPESVFKE-MPELPPPRVLESNLTRLVLLLKRLDIADMGQCDFVDRPAPANRTKALEDLDYLAALDN-----DGNLSEVGIIMSEIPLDPQLAKALLASCEF--DCVTEMLTLAAMLTVVPLCF 524          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Yeast
Match: PRP43 (RNA helicase in the DEAH-box family; functions in both RNA polymerase I and polymerase II transcript metabolism; catalyzes removal of U2, U5, and U6 snRNPs from the postsplicing lariat-intron ribonucleoprotein complex; required for efficient biogenesis of both small- and large-subunit rRNAs; acts with Sqs1p to promote 20S to 18S rRNA processing catalyzed by endonuclease Nob1p [Source:SGD;Acc:S000003088])

HSP 1 Score: 355.91 bits (912), Expect = 3.199e-113
Identity = 204/574 (35.54%), Postives = 326/574 (56.79%), Query Frame = 1
Query:   70 LPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVN--KGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKG-LSVYPLYSALPSELQRLAVTESKDNLT----RNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQH-WCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREET 1767
            LP++  +D+ L+  +     + +  TGSGKTTQIP+F+  D++   +   +  +QPRR+A +S+A RV+EEM+ ++GE VGYS+RFE +++ +T +K+MTDG++LREA+ D  L  Y+ +ILDE HERT+  D+L G++    K R       LK +IMSAT+D + F  +F  +     +    +P+ +    +   DY+ +++    Q+H             +     IL+FLTGEDEI      +  E  +LVR++  G LSVYPLY +LP   Q+     + ++      R V++STNIAETS+TI G+  V+D GFSKQK  +P   +ESL + PIS+A A+QRAGRA R  PG CFRLYT+  F+  + +++  E+ R+NL++  L +  LG  D++ F +++ P    + R++  L  LA +D+     E  +T LG+   +FPLDP  A  L+ S +FQ  C  ++  +VAML+V           + + +    F  P GD +++L +Y AF    + +   H WCR H + Y  ++ A  +  QL+ +    +L + T   E+
Sbjct:   93 LPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPRRVAAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRRPD-----LKIIIMSATLDAEKFQRYFN-DAPLLAVPGRTYPVELYYTPEFQRDYLDSAIRTVLQIH------------ATEEAGDILLFLTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDD-----EGNLTPLGRLASQFPLDPMLAVMLIGSFEFQ--CSQEILTIVAMLSVPNVFIRPTKDKKRADDAKNIFAHPDGDHITLLNVYHAFKSDEAYEYGIHKWCRDHYLNYRSLSAADNIRSQLERLMNRYNLELNTTDYES 641          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Yeast
Match: PRP22 (DEAH-box RNA-dependent ATPase/ATP-dependent RNA helicase; associates with lariat intermediates before the second catalytic step of splicing; mediates ATP-dependent mRNA release from the spliceosome and unwinds RNA duplexes; required for proofreading the exon ligation reaction [Source:SGD;Acc:S000000815])

HSP 1 Score: 355.14 bits (910), Expect = 1.353e-109
Identity = 195/568 (34.33%), Postives = 330/568 (58.10%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSD--DYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREE 1764
            +LP+Y  + ++++ ++     +++  TGSGKTTQI ++L  +  +   MIG +QPRR+A +S+A RV+EE+ C+VG  VGY++RFE  +   T+IK+MTDG++ REA+LDP +  Y++++LDE HERTV  D+LF ++  A   R +     LK ++ SAT++   F  +F       +I+       ++ L  Q+   DY+  ++     +H+ +   +            IL+FLTG++EI  CC+IL +  K L  D    L + P+YSALPSE+Q   + E     +R V+ +TNIAETSITI G+  V+D GF+K    +  +G+E L + PISQAQA QR GRA R GPG C+RLYT+  F + M + T+ E+ R NL+   L +  +G +D+LKF +++ P  N +  ++  L  L ++D+     E ++T LGK +  FP+DP  + +LL  S   N C  ++  +++ML+V    +  ++   ++ +   +F+ P+GD +++L +Y   T+    +  + +C+ + + +  + RA  V  Q+  I K + L + +C  +
Sbjct:  482 TLPVYAMRSELIQAVRDNQFLVIVGETGSGKTTQITQYLDEEGFSNYGMIGCTQPRRVAAVSVAKRVAEEVGCKVGHDVGYTIRFEDVTGPDTRIKYMTDGMLQREALLDPEMSKYSVIMLDEAHERTVATDVLFALLKKAAIKRPE-----LKVIVTSATLNSAKFSEYF---LNCPIINIPGKTFPVEVLYSQTPQMDYIEAALDCVIDIHINEGPGD------------ILVFLTGQEEIDSCCEILYDRVKTL-GDSIGELLILPVYSALPSEIQS-KIFEPTPKGSRKVVFATNIAETSITIDGIYYVVDPGFAKINIYNARAGIEQLIVSPISQAQANQRKGRAGRTGPGKCYRLYTESAFYNEMLENTVPEIQRQNLSHTILMLKAMGINDLLKFDFMDPPPKNLMLNALTELYHLQSLDD-----EGKLTNLGKEMSLFPMDPTLSRSLL--SSVDNQCSDEIVTIISMLSVQNVFYRPKDRQLEADSKKAKFHHPYGDHLTLLNVY---TRWQQANYSEQYCKTNFLHFRHLKRARDVKSQISMIFKKIGLKLISCHSD 1017          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Yeast
Match: PRP16 (DEAH-box RNA helicase involved in second catalytic step of splicing and in exon ligation; exhibits ATP-dependent RNA unwinding activity; mediates the release of Yju2p and Cwc25p in the second step; in the absence of ATP, stabilizes the binding of Cwc25p to the spliceosome in the first catalytic step; missense mutation in human ortholog DHX38 associated with early-onset retinitis pigmentosa [Source:SGD;Acc:S000001794])

HSP 1 Score: 323.168 bits (827), Expect = 2.543e-98
Identity = 203/571 (35.55%), Postives = 321/571 (56.22%), Query Frame = 1
Query:   70 LPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDV--NKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFE-YRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEE-----SKKLVR---DKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVL-KFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPM 1746
            LP++  + Q+L  I+     ++I  TGSGKTTQ+ ++LY +    ++GK I ++QPRR+A IS+A RV+ EM   +G+ VGYS+RFE    ++ TK+KF+TDG++LRE +LD  L  Y+ +I+DE HER++N D+L G        R+      LK +I SATM+ K F  FFG   ++  I     P+          DYV  +V    ++H+              ++  ILIF+TG+++I    D L E+     SKK      ++   + + P+YSALP++LQ   + +      R +I++TNIAETS+TI G+R VIDCG+SK K  +P  GL+SL I PIS+A A+QR+GRA R  PG  +RLYT+  F+  M  +T+ E+ R NL+   L + +L   D L KFP+++KP +     S+  L  + AID +      Q+T LG  + +FPL P  +  LL +   +N C  ++  +V+ML+V +  +  +   +++     +F+    D +++L ++  +   N      HWC KH ++Y  + RA  +  QL  I KS  +P+
Sbjct:  350 LPVFRCRSQLLSLIRENQVVVIIGETGSGKTTQLAQYLYEEGYANDRGKSIVVTQPRRVAAISVAKRVAMEMQVPLGKEVGYSIRFEDVTDSECTKLKFVTDGILLRETLLDDTLDKYSCVIIDEAHERSLNTDILLGFFKILLARRRD-----LKLIITSATMNAKKFSAFFGNAPQF-TIPGRTFPVQTIYTSNPVQDYVEAAVSQAVKIHLAN----------DCSSGDILIFMTGQEDIETTFDTLQEKFLQVYSKKFGTANFEEINDIEILPIYSALPADLQ-FKIFQDLHGTKRKIIIATNIAETSLTIKGIRYVIDCGYSKLKVYNPKIGLDSLVITPISKANADQRSGRAGRTAPGTAYRLYTEDTFKEDMYLQTIPEIQRTNLSNTLLLLKSLDVTDELSKFPFIDKPPLQTFLSSLYELWFIGAIDTSG-----QLTPLGLQMAKFPLQPSLSKILLIA--VRNGCSDEMLTIVSMLSVPQVFYRPKERQKEADIARNKFFIAKSDHLTLLNVFEQWRANNF---SSHWCNKHFVQYKSLVRARDIRDQLLTILKSQKIPV 893          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Yeast
Match: PRP2 (RNA-dependent DExD/H-box ATPase; required for activation of spliceosome before first transesterification step in RNA splicing; implicated in rearranging and proofreading snRNA structure in catalytic activation of spliceosome; ortholog of human protein DHX16 [Source:SGD;Acc:S000005294])

HSP 1 Score: 318.546 bits (815), Expect = 5.946e-98
Identity = 200/557 (35.91%), Postives = 312/557 (56.01%), Query Frame = 1
Query:   70 LPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDD-VNKGKM-IGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRST-KRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTD----HHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQ--NSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQL 1713
            LP++ YKD++L++IK     I++  TGSGKTTQ+P++L  D   ++GK+ I I+QPRR+A  S+A RV++EMN  +G+ VGY +RFE ++T  +T +K+MTDG++LRE + D  L  Y+ +++DE HERT+  D+L G++ +    R       LK +I SATM+ K F  FF     +NV     +P+ +   +Q   +Y+  ++   FQ+H              +    IL+FLTG++EI R    L E   KL   + K + + P+Y+ LP E Q+L + +      R V+++TNIAETS+TI G+R VID GF K+    P +G+  L   P S+A  +QRAGRA R+GPG CFR++T     H  E +MPK    E+ R NL+   L + +LG  D++KFP ++KP +  +++S+  L  L A++      +  IT LGK +  FP +P FA  L  ++  +     L +   +V+ML     LF  +  D  + +V  E  S   D +  L I   F +  +    + WC+ H I++  M R   +  QL
Sbjct:  223 LPVHQYKDELLQEIKKNQVLIIMGETGSGKTTQLPQYLVEDGFTDQGKLQIAITQPRRVAATSVAARVADEMNVVLGKEVGYQIRFEDKTTPNKTVLKYMTDGMLLREFLTDSKLSKYSCIMIDEAHERTLATDILIGLLKDILPQR-----PTLKLLISSATMNAKKFSEFFDNCPIFNV-PGRRYPVDIHYTLQPEANYIHAAITTIFQIHT-----------TQSLPGDILVFLTGQEEIERTKTKLEEIMSKL-GSRTKQMIITPIYANLPQE-QQLKIFQPTPENCRKVVLATNIAETSLTIDGIRYVIDPGFVKENSYVPSTGMTQLLTVPCSRASVDQRAGRAGRVGPGKCFRIFTKWSYLHELE-LMPK---PEITRTNLSNTVLLLLSLGVTDLIKFPLMDKPSIPTLRKSLENLYILGALN-----SKGTITRLGKMMCEFPCEPEFAKVLYTAATHEQCQGVLEECLTIVSMLHETPSLFIGQKRDA-AASVLSEVES---DHILYLEI---FNQWRNSKFSRSWCQDHKIQFKTMLRVRNIRNQL 744          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Yeast
Match: DHR2 (Predominantly nucleolar DEAH-box ATP-dependent RNA helicase; required for 18S rRNA synthesis [Source:SGD;Acc:S000001561])

HSP 1 Score: 306.605 bits (784), Expect = 1.024e-94
Identity = 192/569 (33.74%), Postives = 302/569 (53.08%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYND--DVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKG--LSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSR----EFYSPFGDLVSM-----LRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSL 1734
            +LP+Y +K +I+  I++    ++I  TGSGK+TQIP+F+     D  K   I ++QPRR+A I++ATRV++E  C++GE VGYSVRF+  +T RT++K++TDG++LRE +++  L+ Y+++++DE HERTV  DL+ G +    K   Q     L+ ++MSAT+  + F  FF  N     ++     +    L   +DD V   +  C Q++ G+   +            IL FL G++EI +   I+ E+  K V D+     +  YPLY+ALP+  Q L     K    R V+ STNIAETS+TI GV+ V+D G  K K      GL +L   PISQA A QR+GRA R   G  FRLY +  +   +PK++  E+ R+++ +  L +   G  D+L + W E P    +   +  L +L A+D        +IT+ G+ +   PL P  +  L+++S+    CL  V  +V+ L+V   L +    +RD VN  R         +GDL+ +     +  Y      ++  E+  WC+  CI        + V  QL+  CK L
Sbjct:   80 TLPVYQHKREIMSYIESNPVTVLIGETGSGKSTQIPQFVLEKLYDTKKHGSIAVTQPRRVAAINLATRVAQEHGCKLGEQVGYSVRFDNTTTTRTRLKYLTDGMLLRELMMNSDLREYSVIVIDEAHERTVLTDLILGFL----KSLIQGPRPDLRIIVMSATLQAEKFSEFF-NNAPILFVEGRKFDVKQYYLKAPTDDIVDAVIRCCIQINQGEELGD------------ILCFLPGQEEIDKAVTIM-EKIAKYVSDEAPVPLIVPYPLYAALPAVQQSLVFAPIK-GFKRKVVFSTNIAETSVTISGVKFVVDSGLRKVKVWRHQLGLATLLTVPISQASAMQRSGRAGRESEGKSFRLYCESDYVK-LPKQSEPEIARSDVTSPVLMLKRYGVDDLLNWTWFENPGKEAIVMGLQELYELGALDTRG-----KITKRGQQMALLPLQPHLSSVLIKASEV--GCLSQVIDIVSCLSVENLLLNPSPEERDEVNERRLSLCNAGKRYGDLIMLKELFDIYFYELGKSQDASSERNDWCKGLCISIRGFKNVIRVRDQLRVYCKRL 621          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Nematostella
Match: EDO32531 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUS3])

HSP 1 Score: 426.787 bits (1096), Expect = 7.723e-141
Identity = 228/568 (40.14%), Postives = 354/568 (62.32%), Query Frame = 1
Query:   67 SLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRD-SVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREET 1767
            SLPI++ +  ++ +I+   N I++  TGSGKTTQIP++LY   V +  +I  +QPRR+A ISIA RVS EM  ++GE VGY+VRFE  ++ +T+IK+MTDG++LRE++ D LLK Y+++ILDE HERT++ D+LFG+V  AQ  RK K M PLK V+MSAT++   F  +FG + +   I+   HP+ +   V+   DY+  ++I   QLH  K                IL+FLTG+DEI     ++ + S     D  + L V P+++ALPS  Q++ V        R VI+STNIAETS+TIPGV+ VID G+ K K  HP +GL+ L+++P+S+AQA QR GRA R   G+C+RLYT+  FE  + + T+ E+ R NL++  L +  LG  D+  F +++KP  + +  ++  L  L A+ E +  G+Y++T LG+ + +FPL+PR A  +L S      C  ++  VVA+L+V + + +T  S RD ++ V ++F S  GD +++L IYRA+ +       + WC +H I    M   + + KQL+EIC  L++ +++C +++
Sbjct:   57 SLPIFSARKSLITEIRNRQNVIIVGETGSGKTTQIPQYLYEAKVARNSVIACTQPRRVAAISIAQRVSREMGVQLGEEVGYTVRFEDVTSTKTRIKYMTDGMLLRESIGDSLLKRYSVIILDEAHERTIHTDVLFGIVKGAQISRKDKGMLPLKIVVMSATLEAHQFSEYFG-SAEVLYIEGRQHPVELMYAVEPQVDYMHAALITIMQLHQEK-----------PLGGDILVFLTGQDEIESLSKLVSDCSLHCPPDCPQ-LLVCPMFAALPSS-QQMQVFRPAIPGARKVILSTNIAETSVTIPGVKYVIDTGYVKAKGFHPKTGLDMLRVQPVSKAQARQRLGRAGRECSGVCYRLYTEEQFEQ-LAEATVPEIQRCNLSSVILQLMALGIADIASFDFMDKPSADAIDGALKQLVILEALQEIN--GDYKLTSLGQKMAQFPLEPRLAKVILASETL--GCSEEILTVVALLSV-DSITYTPQSKRDHALKVRKKFLSSEGDQITLLNIYRAYKQCGM---NKSWCAEHFINTRVMKLVMDIRKQLREICIRLEIKLQSCGKDS 601          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Nematostella
Match: EDO45861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRP1])

HSP 1 Score: 312.383 bits (799), Expect = 6.096e-98
Identity = 193/573 (33.68%), Postives = 322/573 (56.20%), Query Frame = 1
Query:   70 LPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRF-EYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYN---------VIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPF-GDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTC 1755
            LPI+ ++  IL  ++  +  I++  TG GK+TQ+   L +     GK IGI+QPRR+A I++A RV+EE +   G+ VGY VRF +    K T IKFMTDG++LRE + DPLL SY+++++DE HERT++ D+L G++   +K R       L+ ++ SAT+D + F +FF  N   +          ++  ++P+ ++  +    +Y++++V     +H+ +   +I            L+FLTG++E+      LIE ++ + +     L V P+YS LP E Q L       N TR VIV+TN+AE SITI G+  V+DCGF K +   P +G+ESL +  ISQA AEQRAGRA R+  G  +RLYT+     + P  T+ E+ R  +    + + ++G  +VL+F +  +P    + R + +L  L A+D+    G+  +  LG  +  FPL+P  A  LL S +F+  C  ++  + AML + + +F T +S + +   +R  +S + GD ++ L ++RAF K     +   WC  + + Y  +  +V + +QLK++ +   +P+ +C
Sbjct:   39 LPIFKHRTNILYLLEKYETVIIVGETGCGKSTQVKYLLESGWTADGKKIGITQPRRVAAITVAIRVAEERDTFAGQEVGYCVRFNDCFDPKLTSIKFMTDGILLREVMGDPLLSSYSVIMIDEAHERTLHTDVLLGLLKKIKKKRPD-----LRIIVSSATLDAEMFKDFFNTNITNDKSKDTAAVLSVEGRSYPVNIEYAISPVANYLQSAVETAMGIHLEEGPGDI------------LVFLTGQEEVESAVSKLIERARGMPKGSSY-LKVLPMYSGLPYEEQMLVFKRPPPN-TRKVIVATNVAEASITIDGIVYVVDCGFVKLRAYSPATGIESLVVTEISQASAEQRAGRAGRVRAGKAYRLYTEDALHELKPV-TVPEMQRYFIG---ILLKSMGIDNVLRFDFPARPPAQSMVRGLELLYALDALDDN---GKL-VDPLGVQMAEFPLEPMIAKMLLISGEFK--CSEEILTIAAMLQI-KNVFVTPSSQKAASEHARRKFSVYEGDHLTQLNVHRAFLKHK---KSSRWCHDNFVNYKGLMHSVKIREQLKKLLQHFKIPIVSC 578          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Nematostella
Match: EDO32629 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUG0])

HSP 1 Score: 269.24 bits (687), Expect = 4.663e-83
Identity = 166/469 (35.39%), Postives = 257/469 (54.80%), Query Frame = 1
Query:  352 KFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALP-SELQRLAVTESKDN----LTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSR-EFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDL 1740
            ++MTDG++LREA+ DPLL  Y +++LDE HERT+  D+L G++    K R       LK +IMSAT+D   F ++F ++     I    HP+ +    +   DY+  ++    Q+HM           V      IL+FLTG++EI   C  + +E   L  +  + L   PLYS LP ++ QR+      D     + R  +V+TNIAETS+TI GV  VID GFSKQK  +P   +ESL +  IS+A A+QRAGRA R  PG CFRLYT+  F+  MP  T  E+ R+NL T  L +  LG  D++ F +++ P    + R++ +L  L A+D+        +TELG  +  FPLDP+ A  ++ S +F  +C  ++ ++ +ML+V  ++F   N  + + + S+ +F    GD +++L +Y A+ + +   E   WC  + I++  M  A  V  QL  I    +L
Sbjct:    1 RYMTDGMLLREAMTDPLLDRYAVILLDEAHERTLATDILMGLLKEVAKQRDD-----LKIIIMSATLDAGKFQDYF-DHCPLMTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHM-----------VEEVKGDILLFLTGQEEIEEACKRIKKEVDNLGSEIGE-LKCIPLYSTLPPTQQQRIFEAAPPDRPNGAIGRKCVVATNIAETSLTIDGVVFVIDPGFSKQKVYNPRIRVESLLVSAISRASAQQRAGRAGRTRPGKCFRLYTEKAFQEEMPPNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLGALDDNG-----DLTELGSMMAEFPLDPQLAKMVIASCEF--NCSNEILSITSMLSV-PQVFLRPNEAKKAADESKMKFAHIDGDHLTLLNVYHAYKQNH---EDTQWCYDNFIQHRSMKSADNVRGQLARIMDRFNL 440          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Nematostella
Match: EDO35622 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKZ8])

HSP 1 Score: 263.848 bits (673), Expect = 1.959e-77
Identity = 137/353 (38.81%), Postives = 221/353 (62.61%), Query Frame = 1
Query:   70 LPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPG 1128
            LPI+  + ++L  ++     I++  TGSGKTTQ+ ++++ D      MIG +QPRR+A +S+A RVSEEM+C +GE VGY++RFE  ++ +T IK+MTDG++LRE++ +  L  Y+++I+DE HER++N D+LFG++ +    R+      LK ++ SATMD + F +FFG    Y  I     P+ +       +DYV ++V    Q+H+            + +   IL+F+ G+++I   C+++ E   ++  ++   L+V P+YS LPS+LQ     ++ D + R  +V+TNIAETS+T+ G+  VID G+ K K  +P  G+++LQ+ PISQA A QR+GRA R GPG
Sbjct:  527 LPIFAVRQELLSIVRDNQVVIIVGETGSGKTTQLTQYMHEDGYTNYGMIGCTQPRRVAAMSVAKRVSEEMDCSLGEEVGYAIRFEDVTSDKTMIKYMTDGILLRESLRESDLDHYSVIIMDEAHERSLNTDVLFGLLRDVVSRRRD-----LKLIVTSATMDAQKFADFFGNVPTYK-IPGRTFPVEIFFTRTVMEDYVDSAVKQALQIHL------------TPSKGDILVFMPGQEDIEVTCELISERLAEV--EEAPPLAVLPIYSQLPSDLQAKIFQKAPDGV-RKCVVATNIAETSLTVDGIMFVIDAGYCKLKVYNPKIGMDALQVYPISQANANQRSGRAGRTGPG 858          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Nematostella
Match: EDO37004 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGZ9])

HSP 1 Score: 241.506 bits (615), Expect = 3.022e-68
Identity = 170/539 (31.54%), Postives = 275/539 (51.02%), Query Frame = 1
Query:   70 LPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLR-KQKNMAPLKCVIMSATMDPKPFIN---FFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRR-C--------------------CDILIEE--SKKLVRDKHK------------------------------GLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDE-TDLAGEYQ--ITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFE 1506
            LPI   +  I+  I   +  I+   TGSGKTTQ+P+FLY     K  +IGI++PRR+A +S++ RV++EM+    + V Y +R++  ++  T IKFMTDG+ML+E   D LL  Y+++++DE HER+V  D+L G++     LR KQ N   LK VIMSAT+  + F +    F +      +DS   P+T+    +  DDY++ +     ++H             +  +  IL+F+TG++EI   C                    CDI + E  +K +  D+                                 + V PLYS L S+ Q     +S     R  +V+TN+AETS+TIP ++ V+D G  K+++   V+G+ S +I   S+A A QRAGRA R+ PG C+RLY+   F +   + + +++ R  +    L + ++    V+ FP+   P  + ++ +  +L DL A++E   + G     I+ LG  + +FP+ PR+A  L      Q SC+  + A++A LTV E
Sbjct:  260 LPILAEEQAIMEAISENNVVILCGETGSGKTTQVPQFLYEAGYTKRGLIGITEPRRVAAVSMSQRVAKEMSMPTSK-VSYQIRYQGNTSDETVIKFMTDGVMLKEVEKDFLLSKYSVVVIDEAHERSVYTDILIGLLSRIVPLRAKQGNK--LKLVIMSATLRVEDFTSNTKLFPDPPITIKVDSRQFPVTVHFSKRTPDDYIQEAFRKVCKIHR------------TLPSGGILLFVTGQNEIHGLCRKLRKTFPFKKTSTGVTDGGCDIDLAEFPTKPVAEDREAEDEDLGEHDANAADYDDDDSAFTPSVDSSLPMYVLPLYSLLSSKEQAKVFQQSPGG-ARLCVVATNVAETSLTIPNIKYVVDTGMVKRRYYDKVTGVSSFRITWTSKASANQRAGRAGRVEPGHCYRLYSSAVFTNEFVEYSEADIVRCPVDDLVLQMKSMNIDKVVNFPFPTPPSSSALETAEKLLLDLGALEERKTVKGNISAVISPLGSAMAKFPVLPRYAKMLCLG--HQESCMEFIIAIIAALTVKE 780          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Medaka
Match: dhx33 (DEAH-box helicase 33 [Source:NCBI gene;Acc:101170865])

HSP 1 Score: 418.698 bits (1075), Expect = 2.016e-137
Identity = 229/570 (40.18%), Postives = 351/570 (61.58%), Query Frame = 1
Query:   70 LPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEI----RRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREET 1767
            LPIY  K  +L  ++   N I+I  TGSGKTTQIP++LY   + +  M+ I+QPRR+A IS+A RV+EE   ++G+ VGY+VRFE  ++  TK+KFMTDG++LREA+ DPLL  Y +++LDE HERTV+ D+LFGVV  AQ+ R++ N  PLK ++MSATMD   F  +F ++     ++   HP+ +     Q  DY++ +++  FQ+H    +A  + D        IL+F+TG++EI    R C DI      K V D    + V PLY++LP  +Q+L V +      R VI+STNIAETS+TI G++ VID G  K K  +P SGLE L ++ +S+AQA QRAGRA R   G C+RLYT+  F++ +P  T+ E+ R NLA   L +  LG  DV+ F ++ KP    V+ +++ L+ L A+++ +  G+  +T LGK +  FPL+PR+A  +L S ++  SC  ++ ++V +L+V   L++      D +   ++F +  GD +++L IYRAF K++   E   WCR++ +    M     V  QL++IC  L+L +++C  +T
Sbjct:   48 LPIYQAKPHLLNQLRQLQNAIIIGETGSGKTTQIPQYLYEAGIGRLGMVAITQPRRVAAISLAGRVAEEKRTQIGKLVGYTVRFEDVTSSETKLKFMTDGMLLREAIGDPLLLKYTVVVLDEAHERTVHTDVLFGVVKTAQRRRRELNKIPLKVIVMSATMDVDLFSEYFNKSPVL-YLEGRQHPIQIFYTKHQQSDYLQAALVSIFQIHQ---EAPPAHD--------ILVFMTGQEEIEALARTCRDI-----SKHVPDGCGSMVVLPLYASLPP-VQQLRVFQPAPKSCRKVILSTNIAETSVTISGIKYVIDTGMVKAKRFNPDSGLEVLAVQRVSKAQAWQRAGRAGREESGFCYRLYTEQEFDNFLPM-TVPEIQRCNLAGVMLQLMALGIPDVMNFDFMSKPSPEAVRSAVDHLELLGAVEKRE--GQVLLTPLGKKMASFPLEPRYAKTILLSPEY--SCSEEILSIVCLLSVDTVLYNPPARRDDVLAARKKFMTSEGDHMTLLNIYRAFKKVSGNKE---WCRENFVNSRNMGLVKDVQAQLRDICLKLNLKLESCGSDT 591          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Medaka
Match: zgc:158828 (DEAH-box helicase 35 [Source:NCBI gene;Acc:101161239])

HSP 1 Score: 348.591 bits (893), Expect = 2.512e-110
Identity = 202/571 (35.38%), Postives = 318/571 (55.69%), Query Frame = 1
Query:   70 LPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDD-VNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKR-TKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYN---------VIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVR-DKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITE-LGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLP 1743
            LP++ +++ IL  +++    IV+  TG GKTTQIP++L       +GK++G++QPRR+A IS+A RV+EE    +G  VGY++RF+  S    T+IKF+TDG+++RE + DPLL  Y++L+LDE HERT+  D+  G++   QK R+      L+ ++ SAT+D K F  FF  N   +          ++    P+ +   V    DYV+ +V    ++H    + E   D        +L FLTG++E+ +   +L ++++ L R    K L + P+YS LP   +++ V E      R V+V+TNIAETSITI G+  VIDC F K +  +P + +ESL + PIS+A A QRAGRA R  PG CFRLYT+  ++  +P  T+ E+ R NLA   L +  LG  +VL+F +L  P    + +++ +L  L  +D        ++T+ +G  +  FPL P FA  LLES  F   C  ++  + AM+ +        N  + +    R+F    GD ++ML +Y AF K     +   WC++H + Y  + RAV V +QL+ +     +P
Sbjct:   52 LPVFKHRNNILYLVESFQTVIVVGETGCGKTTQIPQYLVEAGWATEGKVVGVTQPRRVAAISVANRVAEERGALLGHEVGYTIRFDDCSDPHATRIKFLTDGMLVREMMADPLLTKYSVLMLDEAHERTLYTDIAIGLLKKIQKKRRD-----LRVIVASATLDAKKFHEFFNLNESGDPNKDTCGILTVEGRCFPVDIFYTVSPVPDYVKATVETVMKIH----ETEDDGD--------VLAFLTGQEEVEKVVSLLQDQARSLSRYGMKKHLRILPMYSGLPYA-EQMRVFERVPPTVRKVVVATNIAETSITINGIVFVIDCAFVKLRAYNPRTAIESLVVTPISKASASQRAGRAGRNRPGKCFRLYTEEDYDK-LPASTVPEMQRTNLAPVILQLKALGIDNVLRFSFLSPPPAQTMVQALELLYALGGLDHYG-----RLTDPMGVRMAEFPLSPMFAKMLLESGNF--GCSKEIVTIAAMMQIQNIFVVPPNQKKVAAREHRKFAVAEGDHLTMLNVYEAFMKHQ---KSSQWCQEHFLNYKGLLRAVTVREQLRRLMNKFKVP 593          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Medaka
Match: dhx15 (pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 [Source:NCBI gene;Acc:101166992])

HSP 1 Score: 339.732 bits (870), Expect = 1.077e-106
Identity = 199/570 (34.91%), Postives = 318/570 (55.79%), Query Frame = 1
Query:   70 LPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKF---LYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDN-----LTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAI-DETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKT 1752
            LP++ Y+++    +    +++++  TGSGKTTQIP++   +        + +  +QPRR+A +S+A RV++EM+  +G+ VGYS+RFE  S+ +T +K+MTDG++LREA+ DPLL+ Y ++ILDE HERT+  D+L GV+    + R       LK ++MSAT+D   F  +F +N     I    HP+ +    +   DY+  ++    QLHM                  +L+FLTG++EI   C  +  E + L  +    + + PLYS LP + Q+     S  N     + R V+VSTNIAETS+TI GV  VID GF+KQK  +P   +ESL +  +S+A A+QRAGRA R  PG CFRLYT+  +++ M   T  E+ R+NL T  L +  LG  D++ F +++ P    + R++ +L  LAA+ D+ DL      TELG  +  FPLDP+ A  ++ S ++  +C  ++  + AML+V +       + + +      F    GD +++L +Y AF + +   E   WC  + + Y  +  A  V +QL  I +  +LP ++
Sbjct:   49 LPVWEYRERFTEILMRNQSFVLVGETGSGKTTQIPQWCVDMVRSLQGPKRAVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTVLKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEIVRQRTD-----LKVIVMSATLDAGKFQVYF-DNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQLHM-----------CEEEEGDVLLFLTGQEEIDEACKRIKREVEDLGPEV-GDMKIIPLYSTLPPQQQQRIFEPSPPNKPNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAVSKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNFLAALNDDGDL------TELGAMMAEFPLDPQLAKMVIASCEY--NCSNEILTITAMLSVPQCFVRPTEAKKVADESKLRFAHIDGDHLTLLNVYHAFKQNH---ESTQWCYDNFVNYRSLMSADNVRQQLSRIMERFNLPRRS 589          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Medaka
Match: dhx15 (pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 [Source:NCBI gene;Acc:101166992])

HSP 1 Score: 339.347 bits (869), Expect = 2.284e-106
Identity = 199/570 (34.91%), Postives = 318/570 (55.79%), Query Frame = 1
Query:   70 LPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKF---LYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDN-----LTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAI-DETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKT 1752
            LP++ Y+++    +    +++++  TGSGKTTQIP++   +        + +  +QPRR+A +S+A RV++EM+  +G+ VGYS+RFE  S+ +T +K+MTDG++LREA+ DPLL+ Y ++ILDE HERT+  D+L GV+    + R       LK ++MSAT+D   F  +F +N     I    HP+ +    +   DY+  ++    QLHM                  +L+FLTG++EI   C  +  E + L  +    + + PLYS LP + Q+     S  N     + R V+VSTNIAETS+TI GV  VID GF+KQK  +P   +ESL +  +S+A A+QRAGRA R  PG CFRLYT+  +++ M   T  E+ R+NL T  L +  LG  D++ F +++ P    + R++ +L  LAA+ D+ DL      TELG  +  FPLDP+ A  ++ S ++  +C  ++  + AML+V +       + + +      F    GD +++L +Y AF + +   E   WC  + + Y  +  A  V +QL  I +  +LP ++
Sbjct:   76 LPVWEYRERFTEILMRNQSFVLVGETGSGKTTQIPQWCVDMVRSLQGPKRAVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTVLKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEIVRQRTD-----LKVIVMSATLDAGKFQVYF-DNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQLHM-----------CEEEEGDVLLFLTGQEEIDEACKRIKREVEDLGPEV-GDMKIIPLYSTLPPQQQQRIFEPSPPNKPNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAVSKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNFLAALNDDGDL------TELGAMMAEFPLDPQLAKMVIASCEY--NCSNEILTITAMLSVPQCFVRPTEAKKVADESKLRFAHIDGDHLTLLNVYHAFKQNH---ESTQWCYDNFVNYRSLMSADNVRQQLSRIMERFNLPRRS 616          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Medaka
Match: DHX15 (DEAH-box helicase 15 [Source:NCBI gene;Acc:105357480])

HSP 1 Score: 339.347 bits (869), Expect = 4.048e-106
Identity = 202/572 (35.31%), Postives = 317/572 (55.42%), Query Frame = 1
Query:   70 LPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKG-----KMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVT-----ESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAI-DETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKT 1752
            LP++ YK+     I    +++++  TGSGKTTQIP++    D+ +G     + +  +QPRR+A +S+A RV++EM+  +G+ VGYS+RFE  S+ +T +K+MTDG++LREA+ DPLL+ Y ++ILDE HERT+  D+L GV+    + R       LK ++MSAT+D   F  +F +N     I    HP+ +    +   DY+  ++    Q+HM                   L+FLTG++EI   C  +  E   L  +    + + PLYS LP + Q+         +    + R V+VSTNIAETS+TI GV  VID GF+KQK  +P   +ESL +  IS+A A+QRAGRA R  PG CFRLYT+  +++ M   T  E+ R+NL +  L +  LG  D++ F +++ P    + R++ +L  LAA+ D+ DL      TELG  +  FPLDP+ A  ++ S +F  +C  ++ ++ AML+V +       + + +      F    GD ++ML +Y AF + +   E   WC  + + Y  +  A  V +QL  I    +LP ++
Sbjct:   98 LPVWEYKESFTNIITRQQSFVLVGETGSGKTTQIPQWCV--DMVRGLPGPKRAVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSD-----LKVIVMSATLDAGKFQVYF-DNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHM-----------CEEEEGDCLLFLTGQEEIDEACKRIKREVDDLGPEV-GDIKIIPLYSTLPPQQQQRIFEPPPPRKPNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDL------TELGSMMAEFPLDPQLAKMVIASCEF--NCSNEILSITAMLSVPQCFVRPTEAKKAADESKMRFAHIDGDHLTMLNVYHAFKQNH---ESNQWCYDNFVNYRSLMSADNVRQQLSRIMDRFNLPRRS 638          
BLAST of ATP-dependent RNA helicase, putative vs. Planmine SMEST
Match: SMESG000057503.1 (SMESG000057503.1)

HSP 1 Score: 1217.6 bits (3149), Expect = 0.000e+0
Identity = 584/590 (98.98%), Postives = 588/590 (99.66%), Query Frame = 1
Query:    1 MKRSLQIKHKPFAKKIKNDEICSLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREETI 1770
            MKRSLQIKHKPFAKKIKNDEICSLPIYNYKDQILRDIK CDNYI+ISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAV+DPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKN APLKCVIMSATMDPKPF+NFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREET+
Sbjct:    1 MKRSLQIKHKPFAKKIKNDEICSLPIYNYKDQILRDIKACDNYIIISTTGSGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVIDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNTAPLKCVIMSATMDPKPFLNFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREETV 590          

HSP 2 Score: 120.168 bits (300), Expect = 4.472e-28
Identity = 74/83 (89.16%), Postives = 76/83 (91.57%), Query Frame = 2
Query: 1739 CR*KPVEKKL--SIEEKRKQKXXXXXXXXXXXXXNLAVGNARMCLHPSSVLCLNKVAPEIVLYMECVETKKIHMRYASMISPE 1981
            C  KP   ++  SIEEKRKQKFSHSFSSYSMVYSNLAVGNARMCLHPSSVLCLNKVAPEIVLYMECVETKKIHMRYASMISPE
Sbjct:  595 CFVKPFRTQIARSIEEKRKQKFSHSFSSYSMVYSNLAVGNARMCLHPSSVLCLNKVAPEIVLYMECVETKKIHMRYASMISPE 677          
BLAST of ATP-dependent RNA helicase, putative vs. Planmine SMEST
Match: SMESG000065130.1 (SMESG000065130.1)

HSP 1 Score: 349.747 bits (896), Expect = 1.574e-110
Identity = 207/565 (36.64%), Postives = 313/565 (55.40%), Query Frame = 1
Query:   70 LPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKF---LYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRL-----AVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDL 1740
            LP++ YKD     +      +++  TGSGKTTQIP++      ++ +  K +G +QPRR+A +S+A RV+EEM+  +G+ VGYS+RFE  ++ +T +K++TDG++LREA+ D LL+ Y +++LDE HERT+  D+L G++    K+R       LK VIMSAT+D   F  +FG N     +    HP+ +    +   DY+  ++    Q+HM              T   IL+FLTG++EI   C  +  E + L  D  + L   PLYS LP  LQ+         +    + R V+VSTNIAETS+TI GV  VID GF+KQK  +P   +ESL + PIS+A A+QRAGRA R  PG CFRLYT+  + + M + T  E+ R+NL T  L +  LG  D++ F +++ P    + R++ +L  LAA+D+     +  +T+LG  +  FPLDP+ A  ++ S  F  +C  ++ ++ AML+V +       +   +      F    GD ++ML +Y AF K N   E   WC  H + Y  +  A  V  QL  I    +L
Sbjct:   71 LPVWEYKDYFFDVLTKNQAVVLVGETGSGKTTQIPQWCLEWVRENFSTRKEVGCTQPRRVAAMSVAQRVAEEMDVTLGQEVGYSIRFEDCTSNKTLMKYLTDGMLLREAMSDALLEKYGVILLDEAHERTLATDILMGLLKEVIKVRTD-----LKIVIMSATLDAGKFQEYFG-NAPLMKVPGRTHPVEIFYTPEPEKDYLEAAIRTVIQIHM-----------CEETEGDILVFLTGQEEIDEACKRIQREVENLGPDVGE-LKCIPLYSTLPPNLQQRIFEPPPPKKPNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVFNPRIRVESLLVTPISKASAQQRAGRAGRTRPGKCFRLYTEKGYNNEMHENTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALDD-----DGNLTDLGGMMAEFPLDPQLAKMVIASCDF--NCSNEILSITAMLSVPQCFVRPTEARTAADEAKMGFAHIDGDHLTMLNVYHAF-KQNR--EDSQWCYDHFVNYRSLKAADNVRIQLSRIMDRFNL 607          
BLAST of ATP-dependent RNA helicase, putative vs. Planmine SMEST
Match: SMESG000030778.1 (SMESG000030778.1)

HSP 1 Score: 348.977 bits (894), Expect = 2.506e-109
Identity = 201/569 (35.33%), Postives = 327/569 (57.47%), Query Frame = 1
Query:   70 LPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVN-KGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHT-ENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREETI 1770
            LPIY  K+++++ I      ++   TGSGKTTQIP++LY      + K+IG +QPRR+A +S+A+RV++EMN ++G+ VGYSVRFE + +++T+IK+MTDG++LRE + DP +  Y++LI+DE HERT+  D+LFG++    ++RK      LK +I SAT D + F  FF     +  I    +P+       Q  D+V  +V+   Q+H            ++ ++  IL+FLTG+++I    D L E  K L   K + L V P+YSALPSE Q      +     R V+++TNIAETS+TI G+R VIDCG+ K K   P S ++SL++ PI++A A QR+GRA R+ PG CFRLY  + F+     + + E+ R NL    L + +LG  D+L F +++ P    +  +I  L  L+AID      +  ++ +G+ ++  P DP  +  +L+S K+   C  ++  + AML++   +F++ +N    +    R F    GD +++L++Y  +    + D    WC+ + I+   M  A  +  QL  +   L+L + +  E+T+
Sbjct:  178 LPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPRRVAAMSVASRVAQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKD-----LKIIISSATCDVEKFCQFF--EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIH------------ITQSDGDILVFLTGQEDIEEAMDSLQERIKAL-GTKIRELIVLPIYSALPSEKQAKIFLPTPPG-ARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAID-----SKGGLSLIGRKMVEIPCDPMISNMILKSEKY--GCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYA---NNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTV 715          
BLAST of ATP-dependent RNA helicase, putative vs. Planmine SMEST
Match: SMESG000030778.1 (SMESG000030778.1)

HSP 1 Score: 349.362 bits (895), Expect = 6.155e-109
Identity = 201/569 (35.33%), Postives = 327/569 (57.47%), Query Frame = 1
Query:   70 LPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKFLYNDDVN-KGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHT-ENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREETI 1770
            LPIY  K+++++ I      ++   TGSGKTTQIP++LY      + K+IG +QPRR+A +S+A+RV++EMN ++G+ VGYSVRFE + +++T+IK+MTDG++LRE + DP +  Y++LI+DE HERT+  D+LFG++    ++RK      LK +I SAT D + F  FF     +  I    +P+       Q  D+V  +V+   Q+H            ++ ++  IL+FLTG+++I    D L E  K L   K + L V P+YSALPSE Q      +     R V+++TNIAETS+TI G+R VIDCG+ K K   P S ++SL++ PI++A A QR+GRA R+ PG CFRLY  + F+     + + E+ R NL    L + +LG  D+L F +++ P    +  +I  L  L+AID      +  ++ +G+ ++  P DP  +  +L+S K+   C  ++  + AML++   +F++ +N    +    R F    GD +++L++Y  +    + D    WC+ + I+   M  A  +  QL  +   L+L + +  E+T+
Sbjct:  234 LPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPRRVAAMSVASRVAQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKD-----LKIIISSATCDVEKFCQFF--EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIH------------ITQSDGDILVFLTGQEDIEEAMDSLQERIKAL-GTKIRELIVLPIYSALPSEKQAKIFLPTPPG-ARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAID-----SKGGLSLIGRKMVEIPCDPMISNMILKSEKY--GCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYA---NNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTV 771          
BLAST of ATP-dependent RNA helicase, putative vs. Planmine SMEST
Match: SMESG000009126.1 (SMESG000009126.1)

HSP 1 Score: 342.043 bits (876), Expect = 8.428e-108
Identity = 203/585 (34.70%), Postives = 337/585 (57.61%), Query Frame = 1
Query:   19 IKHKPFAKKIKN--DEICSLPIYNYKDQILRDIKTCDNYIVISTTGSGKTTQIPKF---LYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGETVGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERTVNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYNVIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTNWSILIFLTGEDEIRRCCD-ILIEESKKLVRDKHKGLSVYPLYSALPSELQRLAVTESKDN-----LTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGLESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELYRANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETDLAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTVFEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHWCRKHCIKYAEMNRAVLVNKQLKEICKSLDL 1740
            + +KP+++K  +   +   LP+++YK++ ++ +      +++  TGSGKTTQIP++     +D+ ++ K +G +QPRR+A +S+A RV++E++ E+GE VGY +RFE  ++  T +K++TDG++LREA+ DP LK+Y +++LDE HERT+  D+L G++    +     N + LK ++MSAT+D + F N+FG N     I     P+ +    +  +DYV  +V V   +H  + + +I            L+FLTG++EI   C  I IE S   + D+   +S  PLYS+LP  +Q+    E+  N     ++R ++V+TNIAETSITI GV  VID GF+K+K  +P + +ESL +  +S+A A+QRAGRA R GPG CFRLY++  + + + + T  E+ R+NL+   L++  LG  D++ F +++ P  + + R+ ++L  L AID   +     +T+LG+ +  FPLDP+ +  L+ S  F  +C  DV  +V+ML+V         S   +           GD +++L +Y  F  +N+  +   WC  + I Y  +  A  V  QL  I     L
Sbjct:   28 LNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEISE-----NRSDLKLIVMSATLDAEKFQNYFG-NAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDI------------LLFLTGQEEIDEACRRIEIEISN--LGDQVGDVSCIPLYSSLPPNVQQRIFEEAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIIGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGV-----LTDLGRMMAEFPLDPQLSKTLIASCDF--NCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEF--INN-KKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKL 582          
The following BLAST results are available for this feature:
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DHX332.506e-13039.65DEAH-box helicase 33 [Source:HGNC Symbol;Acc:HGNC:... [more]
DHX356.604e-11334.52DEAH-box helicase 35 [Source:HGNC Symbol;Acc:HGNC:... [more]
DHX352.420e-11234.52DEAH-box helicase 35 [Source:HGNC Symbol;Acc:HGNC:... [more]
DHX82.917e-10635.74DEAH-box helicase 8 [Source:NCBI gene;Acc:1659][more]
DHX86.100e-10635.74DEAH-box helicase 8 [Source:NCBI gene;Acc:1659][more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mog-44.442e-10835.58Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
mog-16.739e-10834.53Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
mog-16.739e-10834.53Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
mog-54.002e-10735.28Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
ddx-154.116e-10535.61Pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG49011.481e-11637.17gene:FBgn0032194 transcript:FBtr0445415[more]
CG49011.481e-11637.17gene:FBgn0032194 transcript:FBtr0079947[more]
CG49011.481e-11637.17gene:FBgn0032194 transcript:FBtr0445414[more]
Dhx158.070e-11436.25gene:FBgn0033160 transcript:FBtr0336909[more]
Dhx158.070e-11436.25gene:FBgn0033160 transcript:FBtr0088966[more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx331.461e-13240.53DEAH (Asp-Glu-Ala-His) box polypeptide 33 [Source:... [more]
dhx403.774e-10935.49DEAH (Asp-Glu-Ala-His) box polypeptide 40 [Source:... [more]
AL833789.31.570e-10735.92DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:N... [more]
dhx82.110e-10735.96DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:Z... [more]
dhx83.280e-10735.92DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:Z... [more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DHX337.545e-13541.30DEAH-box helicase 33 [Source:NCBI gene;Acc:447985][more]
DHX331.197e-13441.30DEAH-box helicase 33 [Source:NCBI gene;Acc:447985][more]
DHX339.554e-13341.23DEAH-box helicase 33 [Source:NCBI gene;Acc:447985][more]
DHX333.408e-13241.15DEAH-box helicase 33 [Source:NCBI gene;Acc:447985][more]
nudt214.843e-11635.91nudix hydrolase 21 [Source:Xenbase;Acc:XB-GENE-921... [more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhx334.388e-13039.54DEAH (Asp-Glu-Ala-His) box polypeptide 33 [Source:... [more]
Dhx355.230e-11234.18DEAH (Asp-Glu-Ala-His) box polypeptide 35 [Source:... [more]
Dhx351.792e-11134.18DEAH (Asp-Glu-Ala-His) box polypeptide 35 [Source:... [more]
Dhx81.432e-10635.74DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:M... [more]
Dhx86.453e-10635.74DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:M... [more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9H6R0|DHX33_HUMAN1.203e-12939.65ATP-dependent RNA helicase DHX33 OS=Homo sapiens O... [more]
sp|Q80VY9|DHX33_MOUSE3.070e-12939.54ATP-dependent RNA helicase DHX33 OS=Mus musculus O... [more]
sp|Q54NJ4|DHX15_DICDI5.949e-11738.15Putative pre-mRNA-splicing factor ATP-dependent RN... [more]
sp|Q9H5Z1|DHX35_HUMAN1.162e-11134.52Probable ATP-dependent RNA helicase DHX35 OS=Homo ... [more]
sp|Q54F05|DHX8_DICDI1.421e-11137.39ATP-dependent RNA helicase dhx8 OS=Dictyostelium d... [more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2B4T1116.581e-13940.27Putative ATP-dependent RNA helicase DHX33 OS=Stylo... [more]
A0A1S3J0N44.526e-13840.74putative ATP-dependent RNA helicase DHX33 OS=Lingu... [more]
A0A3M6V0241.125e-13739.90Uncharacterized protein OS=Pocillopora damicornis ... [more]
A7SUS35.584e-13740.14Predicted protein OS=Nematostella vectensis OX=453... [more]
A0A2G8KKM08.880e-13639.90Putative ATP-dependent RNA helicase DHX33 isoform ... [more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx336.129e-13640.56DEAH (Asp-Glu-Ala-His) box polypeptide 33 [Source:... [more]
dhx402.807e-10936.57DEAH (Asp-Glu-Ala-His) box polypeptide 40 [Source:... [more]
zgc:1588282.747e-10735.75DEAH-box helicase 35 [Source:HGNC Symbol;Acc:HGNC:... [more]
dhx85.126e-10735.92DEAH-box helicase 8 [Source:NCBI gene;Acc:10303579... [more]
dhx81.435e-10635.92DEAH-box helicase 8 [Source:NCBI gene;Acc:10303579... [more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx81.422e-10735.21DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:Z... [more]
dhx332.682e-8737.86DEAH (Asp-Glu-Ala-His) box polypeptide 33 [Source:... [more]
zgc:1588281.468e-7229.57DEAH-box helicase 35 [Source:HGNC Symbol;Acc:HGNC:... [more]
dhx341.331e-7129.90DEAH (Asp-Glu-Ala-His) box polypeptide 34 [Source:... [more]
dqx11.803e-5328.60DEAQ box RNA-dependent ATPase 1 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PRP433.199e-11335.54RNA helicase in the DEAH-box family; functions in ... [more]
PRP221.353e-10934.33DEAH-box RNA-dependent ATPase/ATP-dependent RNA he... [more]
PRP162.543e-9835.55DEAH-box RNA helicase involved in second catalytic... [more]
PRP25.946e-9835.91RNA-dependent DExD/H-box ATPase; required for acti... [more]
DHR21.024e-9433.74Predominantly nucleolar DEAH-box ATP-dependent RNA... [more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO325317.723e-14140.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458616.096e-9833.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326294.663e-8335.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356221.959e-7738.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370043.022e-6831.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx332.016e-13740.18DEAH-box helicase 33 [Source:NCBI gene;Acc:1011708... [more]
zgc:1588282.512e-11035.38DEAH-box helicase 35 [Source:NCBI gene;Acc:1011612... [more]
dhx151.077e-10634.91pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
dhx152.284e-10634.91pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
DHX154.048e-10635.31DEAH-box helicase 15 [Source:NCBI gene;Acc:1053574... [more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057503.14.472e-2898.98SMESG000057503.1[more]
SMESG000065130.11.574e-11036.64SMESG000065130.1[more]
SMESG000030778.12.506e-10935.33SMESG000030778.1[more]
SMESG000030778.16.155e-10935.33SMESG000030778.1[more]
SMESG000009126.18.428e-10834.70SMESG000009126.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019670 ID=SMED30019670|Name=ATP-dependent RNA helicase, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=1982bp
ATGAAGCGAAGCCTTCAAATCAAACATAAACCTTTTGCTAAAAAAATTAA
AAACGACGAAATATGTAGCCTGCCAATTTATAATTATAAAGATCAAATAT
TACGTGATATAAAAACCTGTGACAATTATATTGTTATAAGTACAACTGGG
TCAGGAAAAACTACTCAAATACCCAAATTTCTTTATAATGATGATGTTAA
TAAAGGTAAAATGATAGGAATTTCTCAACCACGTAGAATTGCAACTATCA
GTATAGCTACTCGTGTTTCTGAAGAAATGAATTGCGAAGTTGGAGAAACC
GTTGGTTACAGTGTTAGATTTGAATACCGATCAACGAAGAGAACTAAAAT
TAAATTTATGACTGATGGTTTAATGCTGAGAGAAGCAGTTTTAGATCCTC
TACTTAAGTCATATAATATTTTAATCCTTGACGAAGTTCACGAAAGGACT
GTTAATAATGATTTACTTTTCGGTGTAGTTCTAAACGCACAAAAACTTCG
TAAACAGAAAAACATGGCTCCATTAAAATGCGTAATTATGTCTGCAACAA
TGGATCCTAAACCATTTATAAATTTTTTTGGAGAAAACACAAAATATAAT
GTCATCGATTCTGTTGCTCATCCATTAACTATGAAAAGCCTTGTTCAGCA
ATCCGATGATTATGTGCGCAATAGCGTCATTGTTTGTTTTCAATTGCACA
TGGGTAAAATTCAAGCAGAAATTTCCAAAGATTTCGTGTCAAATACAAAT
TGGAGTATTCTTATATTTCTTACCGGTGAAGATGAAATCCGTAGATGTTG
TGATATTTTGATAGAAGAATCTAAAAAGTTGGTAAGAGATAAACATAAAG
GATTATCTGTGTATCCTCTTTATTCTGCATTGCCATCTGAATTGCAAAGA
TTAGCAGTTACTGAGTCAAAGGATAATTTGACTAGAAATGTGATAGTTTC
AACTAATATTGCAGAAACATCTATAACAATTCCGGGTGTAAGAGTTGTTA
TTGACTGTGGATTCAGTAAACAAAAATTTGTCCATCCGGTTTCCGGTCTG
GAGTCGCTTCAGATTAGACCTATTTCTCAAGCTCAAGCTGAACAAAGAGC
GGGTAGAGCGTCTCGGTTAGGTCCAGGAATTTGCTTTCGTCTTTACACTG
ATCATCATTTTGAATCCGTTATGCCAAAGGAAACCTTATCTGAATTATAT
CGAGCGAATCTTGCTACTGCTTCTTTGACCATTTTCAATCTCGGATTTCA
TGACGTTCTCAAGTTCCCTTGGCTTGAAAAACCGGATGTCAATCAAGTGA
AACGATCGATAAACATTTTGAAAGATCTCGCTGCTATTGATGAAACGGAT
TTAGCCGGTGAATATCAAATCACTGAGCTAGGCAAAACGCTTTTAAGATT
TCCACTTGATCCTCGCTTTGCATTTGCGTTATTGGAATCCTCGAAATTCC
AGAATAGTTGTCTAGTCGACGTGACAGCCGTGGTTGCCATGTTGACAGTA
TTCGAAAAGCTGTTTCACACTGAAAATTCCGATCGTGATTCTGTCAATGT
GTCGAGAGAATTCTATTCTCCCTTCGGAGATTTGGTTTCCATGTTGCGAA
TCTATCGGGCATTCACGAAATTAAATTCCGTCGATGAAAAGCAGCATTGG
TGTCGGAAGCACTGCATCAAGTATGCGGAAATGAATCGAGCCGTGTTGGT
CAATAAACAACTGAAAGAAATCTGCAAAAGCCTTGATTTGCCGATGAAAA
CCTGTCGAGAAGAAACTATCGATTGAGGAGAAACGAAAACAAAAATTTTC
TCATTCGTTTTCATCTTACTCGATGGTATACTCGAATCTTGCTGTTGGTA
ATGCCAGAATGTGTCTCCACCCAAGCTCCGTACTTTGTCTCAATAAAGTT
GCCCCAGAAATTGTGCTCTATATGGAATGTGTTGAGACCAAAAAGATTCA
TATGAGATACGCGTCGATGATTTCTCCTGAAT
back to top

protein sequence of SMED30019670-orf-1

>SMED30019670-orf-1 ID=SMED30019670-orf-1|Name=SMED30019670-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=592bp
MKRSLQIKHKPFAKKIKNDEICSLPIYNYKDQILRDIKTCDNYIVISTTG
SGKTTQIPKFLYNDDVNKGKMIGISQPRRIATISIATRVSEEMNCEVGET
VGYSVRFEYRSTKRTKIKFMTDGLMLREAVLDPLLKSYNILILDEVHERT
VNNDLLFGVVLNAQKLRKQKNMAPLKCVIMSATMDPKPFINFFGENTKYN
VIDSVAHPLTMKSLVQQSDDYVRNSVIVCFQLHMGKIQAEISKDFVSNTN
WSILIFLTGEDEIRRCCDILIEESKKLVRDKHKGLSVYPLYSALPSELQR
LAVTESKDNLTRNVIVSTNIAETSITIPGVRVVIDCGFSKQKFVHPVSGL
ESLQIRPISQAQAEQRAGRASRLGPGICFRLYTDHHFESVMPKETLSELY
RANLATASLTIFNLGFHDVLKFPWLEKPDVNQVKRSINILKDLAAIDETD
LAGEYQITELGKTLLRFPLDPRFAFALLESSKFQNSCLVDVTAVVAMLTV
FEKLFHTENSDRDSVNVSREFYSPFGDLVSMLRIYRAFTKLNSVDEKQHW
CRKHCIKYAEMNRAVLVNKQLKEICKSLDLPMKTCREETID*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR011709DUF1605
IPR007502Helicase-assoc_dom
IPR014001Helicase_ATP-bd
IPR001650Helicase_C
IPR027417P-loop_NTPase
IPR011545DEAD/DEAH_box_helicase_dom
Vocabulary: molecular function
TermDefinition
GO:0004386helicase activity
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004004ATP-dependent RNA helicase activity
GO:0008026ATP-dependent helicase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0000350generation of catalytic spliceosome for second transesterification step
GO:0000390spliceosomal complex disassembly
GO:0006397mRNA processing
GO:0008380RNA splicing
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0071007U2-type catalytic step 2 spliceosome
GO:0071021U2-type post-spliceosomal complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 22..217
e-value: 1.1E-16
score: 71.4
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 34..202
score: 16.476
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 268..374
e-value: 7.1E-17
score: 72.1
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 249..374
e-value: 1.8E-13
score: 50.8
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 241..415
score: 14.941
IPR007502Helicase-associated domainSMARTSM00847ha2_5coord: 435..532
e-value: 2.2E-16
score: 70.4
IPR007502Helicase-associated domainPFAMPF04408HA2coord: 437..527
e-value: 6.4E-15
score: 55.4
NoneNo IPR availableGENE3DG3DSA:1.20.120.1080coord: 420..520
e-value: 4.3E-11
score: 44.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 206..395
e-value: 3.8E-55
score: 188.2
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 2..203
e-value: 1.1E-66
score: 226.2
NoneNo IPR availablePANTHERPTHR18934:SF85ATP-DEPENDENT RNA HELICASE DHX8coord: 15..579
NoneNo IPR availablePANTHERPTHR18934ATP-DEPENDENT RNA HELICASEcoord: 15..579
NoneNo IPR availableCDDcd18791SF2_C_RHAcoord: 208..382
e-value: 1.07164E-59
score: 194.289
NoneNo IPR availableCDDcd17978DEXHc_DHX33coord: 24..194
e-value: 4.43168E-85
score: 260.732
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 32..185
e-value: 2.7E-6
score: 27.2
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 9..557