Proactivator polypeptide

Overview
NameProactivator polypeptide
Smed IDSMED30019668
Length (bp)2787
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Proactivator polypeptide (SMED30019668) t-SNE clustered cells

Violin plots show distribution of expression levels for Proactivator polypeptide (SMED30019668) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Proactivator polypeptide (SMED30019668) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Proactivator polypeptide (SMED30019668) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019668

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 33

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30019668SMESG000042333.1 Contig3945GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019668SMESG000056914.1 Contig4448uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019668SMESG000056914.1 Contig4448newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
intestinal phagocyteSMED30019668SMESG000042333.1 dd_Smed_v6_241_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019668SMESG000042333.1 dd_Smed_v6_241_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30019668SMESG000042755.1 SMESG000042071.1 SMESG000042059.1 SMESG000042052.1 Contig3945GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30019668SMESG000042333.1 Contig3945GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
intestinal phagocyteSMED30019668SMESG000042755.1 SMESG000042071.1 SMESG000042059.1 SMESG000042052.1 Contig3945GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019668SMESG000042333.1 Contig4448uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019668SMESG000042333.1 Contig4448newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019668SMESG000042333.1 Contig3945GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019668SMESG000056914.1 Contig4448uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019668SMESG000056914.1 Contig4448newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019668SMESG000042333.1 Contig332GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30019668SMESG000042333.1 Contig5906uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019668SMESG000042333.1 Contig5906newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019668SMESG000042333.1 Contig38472uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019668SMESG000042333.1 Contig38472newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019668SMESG000042333.1 Contig51967newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30019668SMESG000042333.1 dd_Smed_v4_241_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30019668SMESG000042333.1 dd_Smed_v4_241_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30019668SMESG000042333.1 dd_Smed_v4_241_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019668SMESG000042333.1 dd_Smed_v4_241_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019668SMESG000042333.1 dd_Smed_v4_241_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019668SMESG000042333.1 dd_Smed_v4_241_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019668SMESG000042333.1 dd_Smed_v4_241_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30019668SMESG000042333.1 dd_Smed_v4_390_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019668SMESG000042333.1 dd_Smed_v4_390_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019668SMESG000042755.1 SMESG000042071.1 SMESG000042059.1 SMESG000042052.1 Contig3945GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019668SMESG000042333.1 Contig20734uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019668SMESG000042333.1 Contig20734newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019668SMESG000042333.1 Contig4448uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019668SMESG000042333.1 Contig4448newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Proactivator polypeptide vs. Ensembl Human
Match: PSAP (prosaposin [Source:HGNC Symbol;Acc:HGNC:9498])

HSP 1 Score: 89.7373 bits (221), Expect = 6.098e-18
Identity = 116/531 (21.85%), Postives = 212/531 (39.92%), Query Frame = 2
Query: 1043 CGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLK--SISSQCSSLVDAYADQLITMISNHMDSKA-ICIAINACKGF-----SISQRKSA-----PNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIIL------NFVLSELD-VDKVCKVMGMCSMKKVSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRLGFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAKKQECINDINQYYSLVINIITEFLKPTL-CNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKN-TPISPLTVFANVCNLEDTDETNECLKHFRNLNSIVAAFHASRNIGEF-CKMTEMCKGSKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVWN 2566
            CG    C      KP       + CD+C+  VT A   +       ++  +++ K C  L   ++S+ C  +VD+Y   ++ +I   M     +C A+N C+        ++ +K       P     E  A  +A   +  Y  D  R             P  +     CQ  +    DI         FV + ++ V + C  +G        G+  ++C+  + +  ++A      Q++ +    +IC  +GF        + T +P       + + SK +   L+L   I  KK  +  KS++      C++C F+V E+  L+ N   +K I +  +        +  +EC   ++ Y S +++I+ E + P L C+ L LC+ T    +     V +++      C++C+K   +L +   KN T    L      C+        +C +       ++           F C     C  + K  +G ++C WGP +WC + + AA C   AV+HC+  VWN
Sbjct:   42 CGAVKHCLQTVWNKPTVKS---LPCDICKDVVTAAGDMLKDNATEEEILVYLE-KTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNLCESLQKHLAELNHQKQLESNKIPELDMTEVVAPFMANIPLLLYPQDGPRSK-----------PQPKDNGDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLG-------PGM-ADICKNYISQYSEIAI-----QMMMHMQPKEICALVGFCDEVKEMPMQTLVP-------AKVASKNVIPALELVEPI--KKHEVPAKSDVY-----CEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGTRLPALT----VHVTQPKDGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPSAHKPLLGTEKCIWGPSYWCQNTETAAQC--NAVEHCKRHVWN 524          

HSP 2 Score: 55.0694 bits (131), Expect = 4.844e-7
Identity = 86/438 (19.63%), Postives = 162/438 (36.99%), Query Frame = 2
Query:  581 CTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLP-SEVQSTCKLLLDGYVTQLYNLIKSLLD-GDRICPLIHLCSSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAP--------------------------------EIVSLIKSNV-----------------CSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTS--------------------------HSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKS--KICSHL-KSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGF---SISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMC--SMKKVSGIE 1639
            C  CK V      M    + +E   +     C+ LP   + ++CK ++D Y+  + ++IK  +     +C  ++LC  E+ Q  L     Q  L+   +   D+  V AP                                ++V+ I++ V                 C +L      IC +Y+S      + ++   + P++IC     C                              IKK     K  + C++CE  V      I   +N    K  + +  K+CS L KS+S +C  +VD Y   +++++   +  + +C  ++ C G    +++   + P   G  C+ C   V  +   +   + K  I   L+     +    + QC Q V E+  +++  ++  +D   VC  +G C  + K + G E
Sbjct:   63 CDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNLC--ESLQKHLAELNHQKQLESNKIPELDMTEVVAPFMANIPLLLYPQDGPRSKPQPKDNGDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAI-QMMMHMQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLI---DNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGTRLPALTVHVTQPKDGGF-CEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPSAHKPLLGTE 493          
BLAST of Proactivator polypeptide vs. Ensembl Human
Match: PSAP (prosaposin [Source:HGNC Symbol;Acc:HGNC:9498])

HSP 1 Score: 86.6557 bits (213), Expect = 7.104e-17
Identity = 102/482 (21.16%), Postives = 186/482 (38.59%), Query Frame = 2
Query: 1370 PNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQ--CQQLVDEFFDIILNFVLSELD-VDKVCKVMGMCS--------------------------------------------------MKKVSGIECEVCERVMDEVIQLAFSNHS---QQVVSNFIENKICPRLGFVKTE-CTSLIDTY--LPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNI-----------------NDDSAK----CKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAKKQECINDINQYYSLVINIITEFLKPTL-CNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKN-TPISPLTVFANVCNLEDTDETNECLKHFRNLNSIVAAFHASRNIGEF-CKMTEMCKGSKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVWN 2566
            P  K + CD C   VT   + + D A +  I  +L+ + C       +   C+++VD +  +IL+ +  E+    +VC  + +C                                                     K +G  C+ C +++ + IQ A   +S   Q +V +  E   C RLG    + C + I  Y  + +   +  S    K ICA +  C  + +  +  L+ + +                 ++  AK    C++C F+V E+  L+ N   +K I +  +        +  +EC   ++ Y S +++I+ E + P L C+ L LC+ T    +     V +++      C++C+K   +L +   KN T    L      C+        +C +       ++           F C     C  + K  +G ++C WGP +WC + + AA C   AV+HC+  VWN
Sbjct:   56 PTVKSLPCDICKDVVTAAGDMLKDNATEEEILVYLE-KTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNLCESLQKHLAELNHQKQLESNKIPELDMTEVVAPFMANIPLLLYPQDGPRSKPQPKDNGDVCQDCIQMVTD-IQTAVRTNSTFVQALVEHVKEE--CDRLGPGMADICKNYISQYSEIAIQMMMHMSLQQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGTRLPALT----VHVTQPKDGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPSAHKPLLGTEKCIWGPSYWCQNTETAAQC--NAVEHCKRHVWN 527          

HSP 2 Score: 55.0694 bits (131), Expect = 5.929e-7
Identity = 88/440 (20.00%), Postives = 163/440 (37.05%), Query Frame = 2
Query:  581 CTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLP-SEVQSTCKLLLDGYVTQLYNLIKSLLD-GDRICPLIHLCSSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAP--------------------------------EIVSLIKSNV-----------------CSKLNFFEKGICNSYVSNLVPTFVNEL-HSTLT-PQQICGNHHVCTS--------------------------HSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKS--KICSHL-KSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGF---SISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMC--SMKKVSGIE 1639
            C  CK V      M    + +E   +     C+ LP   + ++CK ++D Y+  + ++IK  +     +C  ++LC  E+ Q  L     Q  L+   +   D+  V AP                                ++V+ I++ V                 C +L      IC +Y+S      +  + H +L  P++IC     C                              IKK     K  + C++CE  V      I   +N    K  + +  K+CS L KS+S +C  +VD Y   +++++   +  + +C  ++ C G    +++   + P   G  C+ C   V  +   +   + K  I   L+     +    + QC Q V E+  +++  ++  +D   VC  +G C  + K + G E
Sbjct:   63 CDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNLC--ESLQKHLAELNHQKQLESNKIPELDMTEVVAPFMANIPLLLYPQDGPRSKPQPKDNGDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMSLQQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLI---DNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGTRLPALTVHVTQPKDGGF-CEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPSAHKPLLGTE 496          
BLAST of Proactivator polypeptide vs. Ensembl Human
Match: PSAPL1 (prosaposin like 1 (gene/pseudogene) [Source:HGNC Symbol;Acc:HGNC:33131])

HSP 1 Score: 73.559 bits (179), Expect = 9.807e-13
Identity = 113/530 (21.32%), Postives = 206/530 (38.87%), Query Frame = 2
Query: 1043 CGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKS--ISSQCSSLVDAYADQLITMISNHMDSKA--ICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFL---KMRICPIFQSEKIQCQQLVDEFFD----IILNFVLSELDVDKVCKVMGMCSMKKVSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRLGFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKPTLCNELRLCNSTTTSIIMSQ-----PLVKMSRAILSSNCQLCEKFY-FHLQKIFLKNTPISPLTVFANVCNLEDTDETNECLKHF--RNLNSIVAAFHASRNIGEFCKMTEMCKGSKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVWNQM 2572
            CG    C      KP A     + CD+C+     A + ++     + + + +  K C  L S   S+ C  +VDA++  +++M+    DS    +C A++ C+     QR              HLA  +    +S      ++  F+    +   P    E   CQ  V +       +  N  L++L++ + C+ +G        G+   +C+  +       F   + Q +      ++C + GF +          L     L +      V   EL L     +K+  + MK+ +      C++C  VV +L   L +   +  I + LE  VC    A   +ECI  ++ Y   ++ ++ +     +C  +RLC +   +  +       P  +       S C  C++        +  K+T    L  F   C++       +C KHF  +    ++ +     +    CK    C G +   +G  QC+ GP FWC S++ A  C   AV+HC+  VW +M
Sbjct:   43 CGAVGYCQGAVWNKPTAKS---LPCDVCQDIAAAAGNGLNPDATESDILALVM-KTCEWLPSQESSAGCKWMVDAHSSAILSMLRGAPDSAPAQVCTALSLCEPL---QR--------------HLATLR---PLSKEDTFEAVAPFMANGPLTFHPRQAPEGALCQDCVRQVSRLQEAVRSNLTLADLNIQEQCESLG-------PGLAV-LCKNYL-----FQFFVPADQALRLLPPQELCRKGGFCEE---------LGAPARLTQVVAMDGVPSLELGL----PRKQSEMQMKAGVT-----CEVCMNVVQKLDHWLMSNSSELMITHALER-VCSVMPASITKECIILVDTYSPSLVQLVAKITPEKVCKFIRLCGNRRRARAVHDAYAIVPSPEWDAENQGSFCNGCKRLLTVSSHNLESKSTKRDILVAFKGGCSILPLPYMIQC-KHFVTQYEPVLIESLKDMMDPVAVCKKVGACHGPRTPLLGTDQCALGPSFWCRSQEAAKLC--NAVQHCQKHVWKEM 513          
BLAST of Proactivator polypeptide vs. Ensembl Human
Match: PSAP (prosaposin [Source:HGNC Symbol;Acc:HGNC:9498])

HSP 1 Score: 51.2174 bits (121), Expect = 3.293e-6
Identity = 39/161 (24.22%), Postives = 66/161 (40.99%), Query Frame = 2
Query: 2090 INIITEFLKPTLCNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKN-TPISPLTVFANVCNLEDTDETNECLKHFRNLNSIVAAFHASRNIGEF-CKMTEMCKGSKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVWN 2566
            I +  E     +C+ L LC+ T    +     V +++      C++C+K   +L +   KN T    L      C+        +C +       ++           F C     C  + K  +G ++C WGP +WC + + AA C   AV+HC+  VWN
Sbjct:   86 ILVYLEVSPELVCSMLHLCSGTRLPALT----VHVTQPKDGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPSAHKPLLGTEKCIWGPSYWCQNTETAAQC--NAVEHCKRHVWN 240          
BLAST of Proactivator polypeptide vs. Ensembl Celegans
Match: spp-10 (SaPosin-like Protein family [Source:UniProtKB/TrEMBL;Acc:Q4JFH6])

HSP 1 Score: 52.373 bits (124), Expect = 4.863e-7
Identity = 43/196 (21.94%), Postives = 83/196 (42.35%), Query Frame = 2
Query:  842 CQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTL-TPQQICGNHHVCTSHSI------------KKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHM-DSKAICIAINACKGFSISQRKSAPNFKGI 1387
            C+ C +VI  + +        E + ++   +C + ++ ++  C  +VS L   F+++L   L  P  +C   H+C++  I            +     +   I CD C+  V   K+ +   ++  + + F++  +C  L      C  +VD Y  Q I  +   + D   +C+ I AC   S +Q   A  + GI
Sbjct:   38 CEECENVIKRISEAAKDPKKIEELKIVLGMMCRETSYADE--CRLFVSQL-DKFIDKLQPFLKNPHAVCTRLHICSNKKIDSFRRILLEFAKRAQKTFDAPAIVCDECQFVVKELKTVVEDKKSQAEARDFLRENVCKSLGQYRGFCDLVVDEYLPQFIQELDAILQDPHQVCVDIKACNSAS-AQGLKARKYVGI 229          
BLAST of Proactivator polypeptide vs. Ensembl Celegans
Match: spp-10 (SaPosin-like Protein family [Source:UniProtKB/TrEMBL;Acc:Q4JFH6])

HSP 1 Score: 50.0618 bits (118), Expect = 6.739e-6
Identity = 40/189 (21.16%), Postives = 79/189 (41.80%), Query Frame = 2
Query:  842 CQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTL-TPQQICGNHHVCTSHSI------------KKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHM-DSKAICIAINACKGFSISQRKS 1366
            C+ C +VI  + +        E + ++   +C + ++ ++  C  +VS L   F+++L   L  P  +C   H+C++  I            +     +   I CD C+  V   K+ +   ++  + + F++  +C  L      C  +VD Y  Q I  +   + D   +C+ I AC   S    K+
Sbjct:   38 CEECENVIKRISEAAKDPKKIEELKIVLGMMCRETSYADE--CRLFVSQL-DKFIDKLQPFLKNPHAVCTRLHICSNKKIDSFRRILLEFAKRAQKTFDAPAIVCDECQFVVKELKTVVEDKKSQAEARDFLRENVCKSLGQYRGFCDLVVDEYLPQFIQELDAILQDPHQVCVDIKACNSASAQGLKA 223          
BLAST of Proactivator polypeptide vs. Ensembl Fly
Match: Sap-r (gene:FBgn0000416 transcript:FBtr0085713)

HSP 1 Score: 96.6709 bits (239), Expect = 5.539e-20
Identity = 128/589 (21.73%), Postives = 246/589 (41.77%), Query Frame = 2
Query:  557 IKFQNDDVCTKCKQ-VFQFLESMFSKVSPDEFKFLIESLICNQLP-SEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLC--------------------------SSENTQITLGSWQ--CQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHST----LTPQQICGNHHVCTSH-----SIKKP----IASEKGV-IECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCSMKKVSGIE-CEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL-GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLC--SLISQKKINLLMKSNIND--DSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVIN-IITEFLKPTLCNELRLCNSTTTSI 2167
            +    D +CT CK  V Q  + + S  + +E K + E   C  +P   +Q  C  + D ++ +L   + S ++ D++C +  LC                          SSE T++ +   Q  C  C  +  ++    A     ++V  +  ++C  L+ F     +   +N+V T+ N+++      LT   +C    VC S        K+P    +A + G  I C+LCE  V   +  +       + K  ++   C   K    +C S+VD Y   +   + + +D+   C  I  C+  S S  K  P             +  +   I     K +I+   K     +  SE    QQ   E  D+       +L +D +       ++  V G E C +CE ++  + +   +  +   + + +EN IC +L   V  +C + ++ Y   + +L    LN + +C  +++C  +L  ++ + +      +D  D   C +C F V +    + +   + +I+  L N +C H   + K+EC++ +N Y + +I+ +IT+F    +C +L+LC  TT ++
Sbjct:   64 VPVDTDSICTICKDMVTQARDQLKSNQTEEELKEVFEG-SCKLIPIKPIQKECIKVADDFLPELVEALASQMNPDQVCSVAGLCNSARIDELYKNGIQAGLDGTVQNEDDSSEETELAMQPNQLSCGNCNLLSRLMHSKFAATDRDDMVETM-LHMCGSLSSF-----SDACANIVLTYFNDIYDHVSKHLTTDAVCHVSGVCASRYHQHEEEKQPQEALVALDAGDDIPCELCEQLVKHLRDVLVANTTETEFKQVMEG-FCKQSKGFKDECLSIVDQYYHVIYETLVSKLDANGACCMIGICQKNSASSMKDVP-------------IMPLLPVIEPAQVKITIEKLEKHEKKQLGASEPKFSQQ---EILDM-------QLPIDHLMGAANPGAL--VEGGELCTLCEYMLHFIQETLATPSTDDEIKHTVEN-ICAKLPSGVAGQCRNFVEMYGDAVIALLVQGLNPRDVCPLMQMCPKNLPKKEDVEVFNPQPASDEQDPPTCPLCLFAVEQAQMKIRDNKSKDNIKKVL-NGLCSHLPNEIKEECVDFVNTYSNELIDMLITDFKPQEICVQLKLCPKTTYAL 617          

HSP 2 Score: 94.7449 bits (234), Expect = 1.805e-19
Identity = 101/477 (21.17%), Postives = 189/477 (39.62%), Query Frame = 2
Query:  773 DRICPLIHLCSSENT-QITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKK---------PIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKS-ISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSIS--------------QRKSAP---NFKGIE--------------------CDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCSMKKVSGIE----------------------------CEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL-GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLL 1972
            D   P+ HL  + N   +  G   C  C  ++  +++ LA  S  + +     N+C+KL     G C ++V       +  L   L P+ +C    +C  +  KK         P + E+    C LC   V  A+  I   ++ + +K  +   +CSHL + I  +C   V+ Y+++LI M+      + IC+ +  C   + +              + KS+    +F  IE                    C  C   V  +++ +     + SIK+ L+     + +    +C +++D++ D I + +L E+D   +C  +GMC +  +  +E                            C +CE +M ++     +   Q  +   IE  +C RL   V+ +C + +D Y   +  L  S +  K +C +L+LC  ++           + D+  +C +CH V   LL  L
Sbjct:  413 DMQLPIDHLMGAANPGALVEGGELCTLCEYMLHFIQETLATPSTDDEIKHTVENICAKLPSGVAGQCRNFVEMYGDAVIALLVQGLNPRDVCPLMQMCPKNLPKKEDVEVFNPQPASDEQDPPTCPLCLFAVEQAQMKIRDNKSKDNIKKVLNG-LCSHLPNEIKEECVDFVNTYSNELIDMLITDFKPQEICVQLKLCPKTTYALWDLRISLEDDVDGEDKSSSEEISFNDIESLEELPPQLAFDPGFTAAPNCLICEELVKTLEKRMGKHPTRDSIKHILEESCDRMRKPMNTKCHKVIDKYGDKIADLLLKEMDPKLICTELGMCILADLDDLEVDEALKYDVIALPRQDNKLSSSIKEPPTCVLCEFIMTKLDADLKNKTEQDDIKRAIE-AVCNRLPATVRKQCDTFVDGYASAVLKLL-SDVPPKQVCQKLQLCFSVA-----------VTDEVLECGVCHGVTQALLPFL 875          

HSP 3 Score: 89.3521 bits (220), Expect = 1.023e-17
Identity = 159/848 (18.75%), Postives = 312/848 (36.79%), Query Frame = 2
Query:  158 CLKGPTYWCATYQNAEKCDRITECFMGQGD-QKNKVDISHHKNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKS-QLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIF-NSIK------FQNDD---------------VCTKCKQVFQFLESMFSKVSPDEFKFLIESLI--CNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQ-----------ITLGSWQ---CQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEK---GICNSYVSNLVPTFVNELHS----------------------------TLTPQQICGNHHVCTSHSIKKPIASE----------------------------KGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKS-ISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIE---------------CDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSE-KIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMC-----------------------------SMKKVSGIE-----------------CEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL-GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSL-----------ISQKKINLLMKSNINDDSAK----CKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKPTLCNELRLCNSTTTS 2164
            C  GP+YWC  + N+++C     C     + QK  VD         C  C   V      +     +E +       C  +  K  Q +C K  + F P +   L+ +  P+++C +  +C   N+    +++ N I+       QN+D                C  C  + + + S F+    D+   ++E+++  C  L S     C  ++  Y   +Y+ +   L  D +C +  +C+S   Q           + L +     C+ C  ++  LR  L   +       +    C +   F+     I + Y   +  T V++L +                             + P Q+         H  K+  ASE                            +G   C LCE  +   +  ++ P   +++K  +++ IC+ L S ++ QC + V+ Y D +I ++   ++ + +C  +  C        K+ P  + +E               C  C  AV + +  I D   K +IK  L   +C    +E K +C   V+ + + +++ ++++    ++C  + +C                             S   +  +E                 C +CE ++  + +    + ++  + + +E   C R+   + T+C  +ID Y   I  L    ++ K+IC EL +C L           +    I L  + N    S K    C +C F++++L   L N   Q  I+  +E  VC    A  +++C   ++ Y S V+ ++++     +C +L+LC S   +
Sbjct:   31 CTWGPSYWCGNFSNSKECRATRHCIQTVWETQKVPVDTDS-----ICTICKDMVTQARDQLKSNQTEEELKEVFEGSCKLIPIKPIQKECIKVADDFLPELVEALASQMNPDQVCSVAGLC---NSARIDELYKNGIQAGLDGTVQNEDDSSEETELAMQPNQLSCGNCNLLSRLMHSKFAATDRDD---MVETMLHMCGSL-SSFSDACANIVLTYFNDIYDHVSKHLTTDAVCHVSGVCASRYHQHEEEKQPQEALVALDAGDDIPCELCEQLVKHLRDVLVANTTETEFKQVMEGFCKQSKGFKDECLSIVDQYYHVIYETLVSKLDANGACCMIGICQKNSASSMKDVPIMPLLPVIEPAQVKITIEKLEKHEKKQLGASEPKFSQQEILDMQLPIDHLMGAANPGALVEGGELCTLCEYMLHFIQETLATPSTDDEIKHTVEN-ICAKLPSGVAGQCRNFVEMYGDAVIALLVQGLNPRDVCPLMQMCP-------KNLPKKEDVEVFNPQPASDEQDPPTCPLCLFAVEQAQMKIRDNKSKDNIKKVLN-GLCSHLPNEIKEECVDFVNTYSNELIDMLITDFKPQEICVQLKLCPKTTYALWDLRISLEDDVDGEDKSSSEEISFNDIESLEELPPQLAFDPGFTAAPNCLICEELVKTLEKRMGKHPTRDSIKHILEES-CDRMRKPMNTKCHKVIDKYGDKIADLLLKEMDPKLICTELGMCILADLDDLEVDEALKYDVIALPRQDNKLSSSIKEPPTCVLCEFIMTKLDADLKNKTEQDDIKRAIE-AVCNRLPATVRKQCDTFVDGYASAVLKLLSDVPPKQVCQKLQLCFSVAVT 855          

HSP 4 Score: 53.9138 bits (128), Expect = 8.187e-7
Identity = 87/499 (17.43%), Postives = 173/499 (34.67%), Query Frame = 2
Query:  278 KNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVC-KNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKV----SPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCS----------------------SENTQITLGSWQ--------------------CQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCT---------------------------SHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKS-ISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDI 1549
            + G+ C  C   +  ++  +   S  + +      IC  L       C+  V  +   +   L     P  +C L+Q+C KN       ++FN     ++     C      +E    K+    S D  K ++  L C+ LP+E++  C   ++ Y  +L +++ +      IC  + LC                       S + +I+    +                    C  C +++  L K +      + +  I    C ++       C+  +        + L   + P+ IC    +C                            S SIK+P         C LCE  +T   + +      + +K  I++ +C+ L + +  QC + VD YA  ++ ++S+ +  K +C  +  C  FS++          +EC  CH     +  ++ +     S    L+M          + C+ L  +++ I
Sbjct:  432 EGGELCTLCEYMLHFIQETLATPSTDDEIKHTVENICAKLPSGVAGQCRNFVEMYGDAVIALLVQGLNPRDVCPLMQMCPKNLPKKEDVEVFNPQPASDEQDPPTCPLCLFAVEQAQMKIRDNKSKDNIKKVLNGL-CSHLPNEIKEECVDFVNTYSNELIDMLITDFKPQEICVQLKLCPKTTYALWDLRISLEDDVDGEDKSSSEEISFNDIESLEELPPQLAFDPGFTAAPNCLICEELVKTLEKRMGKHPTRDSIKHILEESCDRMRKPMNTKCHKVIDKYGDKIADLLLKEMDPKLICTELGMCILADLDDLEVDEALKYDVIALPRQDNKLSSSIKEPPT-------CVLCEFIMTKLDADLKNKTEQDDIKRAIEA-VCNRLPATVRKQCDTFVDGYASAVLKLLSD-VPPKQVCQKLQLC--FSVAVTDEV-----LECGVCHGVTQALLPFLREKKDNVSEVTALQMT--------SVGCENLPAKYYKI 905          
BLAST of Proactivator polypeptide vs. Ensembl Fly
Match: Sap-r (gene:FBgn0000416 transcript:FBtr0085714)

HSP 1 Score: 94.7449 bits (234), Expect = 2.006e-19
Identity = 101/477 (21.17%), Postives = 189/477 (39.62%), Query Frame = 2
Query:  773 DRICPLIHLCSSENT-QITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKK---------PIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKS-ISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSIS--------------QRKSAP---NFKGIE--------------------CDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCSMKKVSGIE----------------------------CEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL-GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLL 1972
            D   P+ HL  + N   +  G   C  C  ++  +++ LA  S  + +     N+C+KL     G C ++V       +  L   L P+ +C    +C  +  KK         P + E+    C LC   V  A+  I   ++ + +K  +   +CSHL + I  +C   V+ Y+++LI M+      + IC+ +  C   + +              + KS+    +F  IE                    C  C   V  +++ +     + SIK+ L+     + +    +C +++D++ D I + +L E+D   +C  +GMC +  +  +E                            C +CE +M ++     +   Q  +   IE  +C RL   V+ +C + +D Y   +  L  S +  K +C +L+LC  ++           + D+  +C +CH V   LL  L
Sbjct:  336 DMQLPIDHLMGAANPGALVEGGELCTLCEYMLHFIQETLATPSTDDEIKHTVENICAKLPSGVAGQCRNFVEMYGDAVIALLVQGLNPRDVCPLMQMCPKNLPKKEDVEVFNPQPASDEQDPPTCPLCLFAVEQAQMKIRDNKSKDNIKKVLNG-LCSHLPNEIKEECVDFVNTYSNELIDMLITDFKPQEICVQLKLCPKTTYALWDLRISLEDDVDGEDKSSSEEISFNDIESLEELPPQLAFDPGFTAAPNCLICEELVKTLEKRMGKHPTRDSIKHILEESCDRMRKPMNTKCHKVIDKYGDKIADLLLKEMDPKLICTELGMCILADLDDLEVDEALKYDVIALPRQDNKLSSSIKEPPTCVLCEFIMTKLDADLKNKTEQDDIKRAIE-AVCNRLPATVRKQCDTFVDGYASAVLKLL-SDVPPKQVCQKLQLCFSVA-----------VTDEVLECGVCHGVTQALLPFL 798          

HSP 2 Score: 89.7373 bits (221), Expect = 7.528e-18
Identity = 124/543 (22.84%), Postives = 231/543 (42.54%), Query Frame = 2
Query:  629 KVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLY-NLIKSLLDG-----DRICPLIHLCSSENTQITLGSWQ--CQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHST----LTPQQICGNHHVCTSH-----SIKKP----IASEKGV-IECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCSMKKVSGIE-CEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL-GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLC--SLISQKKINLLMKSNIND--DSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVIN-IITEFLKPTLCNELRLCNSTTTSI 2167
            KV+ D    L+E+L     P +V S   L     + +LY N I++ LDG     D         SSE T++ +   Q  C  C  +  ++    A     ++V  +  ++C  L+ F     +   +N+V T+ N+++      LT   +C    VC S        K+P    +A + G  I C+LCE  V   +  +       + K  ++   C   K    +C S+VD Y   +   + + +D+   C  I  C+  S S  K  P             +  +   I     K +I+   K     +  SE    QQ   E  D+       +L +D +       ++  V G E C +CE ++  + +   +  +   + + +EN IC +L   V  +C + ++ Y   + +L    LN + +C  +++C  +L  ++ + +      +D  D   C +C F V +    + +   + +I+  L N +C H   + K+EC++ +N Y + +I+ +IT+F    +C +L+LC  TT ++
Sbjct:   40 KVADDFLPELVEALASQMNPDQVCSVAGLCNSARIDELYKNGIQAGLDGTVQNEDD--------SSEETELAMQPNQLSCGNCNLLSRLMHSKFAATDRDDMVETM-LHMCGSLSSF-----SDACANIVLTYFNDIYDHVSKHLTTDAVCHVSGVCASRYHQHEEEKQPQEALVALDAGDDIPCELCEQLVKHLRDVLVANTTETEFKQVMEG-FCKQSKGFKDECLSIVDQYYHVIYETLVSKLDANGACCMIGICQKNSASSMKDVP-------------IMPLLPVIEPAQVKITIEKLEKHEKKQLGASEPKFSQQ---EILDM-------QLPIDHLMGAANPGAL--VEGGELCTLCEYMLHFIQETLATPSTDDEIKHTVEN-ICAKLPSGVAGQCRNFVEMYGDAVIALLVQGLNPRDVCPLMQMCPKNLPKKEDVEVFNPQPASDEQDPPTCPLCLFAVEQAQMKIRDNKSKDNIKKVL-NGLCSHLPNEIKEECVDFVNTYSNELIDMLITDFKPQEICVQLKLCPKTTYAL 540          

HSP 3 Score: 76.2554 bits (186), Expect = 1.026e-13
Identity = 131/657 (19.94%), Postives = 261/657 (39.73%), Query Frame = 2
Query:  452 IYRELSMEATPEKICGLVQVC-----KNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLES-MFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKS-ISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIE---------------CDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSE-KIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMC-----------------------------SMKKVSGIE-----------------CEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL-GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSL-----------ISQKKINLLMKSNINDDSAK----CKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKPTLCNELRLCNSTTTS 2164
            IY  +S   T + +C +  VC     ++       +   ++   +D  C  C+Q+ + L   + +  +  EFK ++E   C Q     +  C  ++D Y   +Y  + S LD +  C +I +C  +N+  ++        L VI            P  V +       KL   EK      +    P F  +    +   Q+  +H +  ++    P A  +G   C LCE  +   +  ++ P   +++K  +++ IC+ L S ++ QC + V+ Y D +I ++   ++ + +C  +  C        K+ P  + +E               C  C  AV + +  I D   K +IK  L   +C    +E K +C   V+ + + +++ ++++    ++C  + +C                             S   +  +E                 C +CE ++  + +    + ++  + + +E   C R+   + T+C  +ID Y   I  L    ++ K+IC EL +C L           +    I L  + N    S K    C +C F++++L   L N   Q  I+  +E  VC    A  +++C   ++ Y S V+ ++++     +C +L+LC S   +
Sbjct:  162 IYDHVSKHLTTDAVCHVSGVCASRYHQHEEEKQPQEALVALDAGDDIPCELCEQLVKHLRDVLVANTTETEFKQVMEGF-CKQSKG-FKDECLSIVDQYYHVIYETLVSKLDANGACCMIGICQ-KNSASSMKDVPIMPLLPVI-----------EPAQVKI----TIEKLEKHEK----KQLGASEPKFSQQ---EILDMQLPIDHLMGAAN----PGALVEGGELCTLCEYMLHFIQETLATPSTDDEIKHTVEN-ICAKLPSGVAGQCRNFVEMYGDAVIALLVQGLNPRDVCPLMQMCP-------KNLPKKEDVEVFNPQPASDEQDPPTCPLCLFAVEQAQMKIRDNKSKDNIKKVLN-GLCSHLPNEIKEECVDFVNTYSNELIDMLITDFKPQEICVQLKLCPKTTYALWDLRISLEDDVDGEDKSSSEEISFNDIESLEELPPQLAFDPGFTAAPNCLICEELVKTLEKRMGKHPTRDSIKHILEES-CDRMRKPMNTKCHKVIDKYGDKIADLLLKEMDPKLICTELGMCILADLDDLEVDEALKYDVIALPRQDNKLSSSIKEPPTCVLCEFIMTKLDADLKNKTEQDDIKRAIE-AVCNRLPATVRKQCDTFVDGYASAVLKLLSDVPPKQVCQKLQLCFSVAVT 778          

HSP 4 Score: 59.6918 bits (143), Expect = 1.074e-8
Identity = 77/429 (17.95%), Postives = 163/429 (38.00%), Query Frame = 2
Query:  968 CNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKK------------------------PIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKG-FSISQRKSAPN--------FKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCSMKKVSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRLGFVKTECT--SLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAKKQECINDINQYYSLVINIITEFLKP-TLCNELRLC 2146
            C     + +P  V  L S + P Q+C    +C S  I +                         +A +   + C  C +      S  +  +  + V++ +   +C  L S S  C+++V  Y + +   +S H+ + A+C     C   +   + +  P            I C+ C   V  +++ +     +T  K  ++   C   +  K +C  +VD+++ +I   ++S+LD +  C ++G+C     S ++ +V    +  VI+ A      ++    +E     +LG  + + +   ++D  LP+   +  +   + V   EL                         C +C +++  +   L  P     I++ +EN           +C N +  Y   VI ++ + L P  +C  +++C
Sbjct:   38 CIKVADDFLPELVEALASQMNPDQVCSVAGLCNSARIDELYKNGIQAGLDGTVQNEDDSSEETELAMQPNQLSCGNCNLLSRLMHSKFAATDRDDMVETMLH--MCGSLSSFSDACANIVLTYFNDIYDHVSKHLTTDAVCHVSGVCASRYHQHEEEKQPQEALVALDAGDDIPCELCEQLVKHLRDVLVANTTETEFKQVME-GFCKQSKGFKDECLSIVDQYYHVIYETLVSKLDANGACCMIGICQKNSASSMK-DVPIMPLLPVIEPA----QVKITIEKLEKHEKKQLGASEPKFSQQEILDMQLPIDHLMGAANPGALVEGGEL-------------------------CTLCEYMLHFIQETLATPSTDDEIKHTVENICAKLPSGVAGQCRNFVEMYGDAVIALLVQGLNPRDVCPLMQMC 433          

HSP 5 Score: 52.7582 bits (125), Expect = 1.538e-6
Identity = 87/499 (17.43%), Postives = 173/499 (34.67%), Query Frame = 2
Query:  278 KNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVC-KNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKV----SPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCS----------------------SENTQITLGSWQ--------------------CQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCT---------------------------SHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLK-SISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDI 1549
            + G+ C  C   +  ++  +   S  + +      IC  L       C+  V  +   +   L     P  +C L+Q+C KN       ++FN     ++     C      +E    K+    S D  K ++  L C+ LP+E++  C   ++ Y  +L +++ +      IC  + LC                       S + +I+    +                    C  C +++  L K +      + +  I    C ++       C+  +        + L   + P+ IC    +C                            S SIK+P         C LCE  +T   + +      + +K  I++ +C+ L  ++  QC + VD YA  ++ ++S+ +  K +C  +  C  FS++          +EC  CH     +  ++ +     S    L+M          + C+ L  +++ I
Sbjct:  355 EGGELCTLCEYMLHFIQETLATPSTDDEIKHTVENICAKLPSGVAGQCRNFVEMYGDAVIALLVQGLNPRDVCPLMQMCPKNLPKKEDVEVFNPQPASDEQDPPTCPLCLFAVEQAQMKIRDNKSKDNIKKVLNGL-CSHLPNEIKEECVDFVNTYSNELIDMLITDFKPQEICVQLKLCPKTTYALWDLRISLEDDVDGEDKSSSEEISFNDIESLEELPPQLAFDPGFTAAPNCLICEELVKTLEKRMGKHPTRDSIKHILEESCDRMRKPMNTKCHKVIDKYGDKIADLLLKEMDPKLICTELGMCILADLDDLEVDEALKYDVIALPRQDNKLSSSIKEPPT-------CVLCEFIMTKLDADLKNKTEQDDIKRAIEA-VCNRLPATVRKQCDTFVDGYASAVLKLLSD-VPPKQVCQKLQLC--FSVAVTDEV-----LECGVCHGVTQALLPFLREKKDNVSEVTALQMT--------SVGCENLPAKYYKI 828          
BLAST of Proactivator polypeptide vs. Ensembl Zebrafish
Match: psap (prosaposin [Source:ZFIN;Acc:ZDB-GENE-020108-1])

HSP 1 Score: 87.8113 bits (216), Expect = 1.731e-17
Identity = 106/505 (20.99%), Postives = 203/505 (40.20%), Query Frame = 2
Query: 1292 NHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKI--QCQQLVDEFFDIILNFVLSELD-VDKVCKVMGMCSMKKVSGIECEVCERVMDEV-------------IQL---------------------AFSNHSQ---QVVSNFIENKI------CPRLGFVKTE-CTSLIDTYLPVIFSLARSTLNSKVICAELKLC-------------------------SLISQKKINLLMKSNIND--DSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKP-TLCNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKNTPISPLT-VFANVCN-LEDT--DETNECLKHFRNLNSIVAAFHASRNIGEFCKMTEMCKGSKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVWN 2566
             ++ + ++C A+  C+        + P  K + CD C   +  +++ + D   ++ +  +L+ + C +   E +  QC+++VD +F +++  +  ELD    VC  +G+C  ++ +  + ++    + +V              QL                      F N +Q   +V S+FI   I      C  LG   ++ C   I  Y P++F    S +  K ICA    C                         ++  +K +  +   N+    DS +C IC +V+ E+  ++ +   +  I   +E  VC    +    +C + I  Y   +I+++ +   P T+C+ L LC+  +   +M +             C +C+    ++  I  +N   S +      VC+ L D   DE N+ ++ +  L   +       +    C     C  + +  +G  QCSWGP +WC + Q AA C   A+ HC   VW+
Sbjct:   32 QNVKTASLCGAVQHCQ----QNVWNKPQMKTVPCDLCKEVLVVVEQLLKDNVTESELLGYLE-KACQLIPDEGLANQCKEIVDNYFPVLMGIIQGELDDPGVVCGALGLCVSQQAALAKAQLTSNEIPQVDLNQRVSPFLLNIPQLLYPEEKRETPKQKGDVCQDCVTFINDTQDEARVNSSFISTLIAQVENQCELLGPGMSDMCKEYISQYGPLVFQQLMS-MQPKDICARAGFCPTKQKSVPMEKLLPAKSIPAVKMFPAVKVEKPVATMPAKNLVRVRDSPQCAICEYVMKEIENMIQDQTSEAEIVQAVEK-VCNILPSTLTAQCKDLIETYGQAIIDLLVQEADPKTVCSFLALCSGVSHVPVMDK-----QHFAAGGFCDVCKMAVRYVDGILEQNATQSEIEEAVLKVCSFLPDAVKDECNQLIEQYEPLLVQLLLQTLDPDF--VCMKLGACPEAVQRLLGLNQCSWGPAYWCKNVQTAARC--NALNHCRRHVWS 520          

HSP 2 Score: 70.4774 bits (171), Expect = 4.752e-12
Identity = 101/465 (21.72%), Postives = 189/465 (40.65%), Query Frame = 2
Query:  491 ICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMF-SKVSPDEFKFLIESLICNQLPSE-VQSTCKLLLDGYVTQLYNLIKSLLDGDRI-CPLIHLCSSENTQITLGSWQ-----------------------------------------CQTCLDVIVVLRKDLAGVSAPEIVSLIK--SNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHS------------------------IKKPIAS--EKGVI------ECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKS-ISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNF-KGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIF-QSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMC--SMKKVSGI 1636
            +CG VQ C+         ++N  + +    C  CK+V   +E +    V+  E    +E   C  +P E + + CK ++D Y   L  +I+  LD   + C  + LC S+  Q  L   Q                                         CQ C+  I    +D A V++  I +LI    N C  L      +C  Y+S   P    +L S + P+ IC     C +                          ++KP+A+   K ++      +C +CE  +   ++ I    +  ++   ++ K+C+ L S +++QC  L++ Y   +I ++    D K +C  +  C G S        +F  G  CD C +AV  +   +   A ++ I+  + +++C     + K +C QL++++  +++  +L  LD D VC  +G C  +++++ G+
Sbjct:   39 LCGAVQHCQQN-------VWNKPQMKTVP-CDLCKEVLVVVEQLLKDNVTESELLGYLEK-ACQLIPDEGLANQCKEIVDNYFPVLMGIIQGELDDPGVVCGALGLCVSQ--QAALAKAQLTSNEIPQVDLNQRVSPFLLNIPQLLYPEEKRETPKQKGDVCQDCVTFIND-TQDEARVNSSFISTLIAQVENQCELLGPGMSDMCKEYISQYGPLVFQQLMS-MQPKDICARAGFCPTKQKSVPMEKLLPAKSIPAVKMFPAVKVEKPVATMPAKNLVRVRDSPQCAICEYVMKEIENMIQDQTSEAEIVQAVE-KVCNILPSTLTAQCKDLIETYGQAIIDLLVQEADPKTVCSFLALCSGVSHVPVMDKQHFAAGGFCDVCKMAVRYVDGILEQNATQSEIEEAV-LKVCSFLPDAVKDECNQLIEQYEPLLVQLLLQTLDPDFVCMKLGACPEAVQRLLGL 488          
BLAST of Proactivator polypeptide vs. Ensembl Zebrafish
Match: psap (prosaposin [Source:ZFIN;Acc:ZDB-GENE-020108-1])

HSP 1 Score: 85.8853 bits (211), Expect = 6.517e-17
Identity = 106/506 (20.95%), Postives = 202/506 (39.92%), Query Frame = 2
Query: 1292 NHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKI--QCQQLVDEFFDIILNFVLSELDVDKV-CKVMGMCSMKKVSGIECEVCERVMDEV-------------IQL---------------------AFSNHSQ---QVVSNFIENKI------CPRLGFVKTE-CTSLIDTYLPVIFS-LARSTLNSKVICAELKLC-------------------------SLISQKKINLLMKSNIND--DSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKP-TLCNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKNTPISPLT-VFANVCN-LEDT--DETNECLKHFRNLNSIVAAFHASRNIGEFCKMTEMCKGSKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVWN 2566
             ++ + ++C A+  C+        + P  K + CD C   +  +++ + D   ++ +  +L+ + C +   E +  QC+++VD +F +++  +  ELD   V C  +G+C  ++ +  + ++    + +V              QL                      F N +Q   +V S+FI   I      C  LG   ++ C   I  Y P++F  L       K ICA    C                         ++  +K +  +   N+    DS +C IC +V+ E+  ++ +   +  I   +E  VC    +    +C + I  Y   +I+++ +   P T+C+ L LC+  +   +M +             C +C+    ++  I  +N   S +      VC+ L D   DE N+ ++ +  L   +       +    C     C  + +  +G  QCSWGP +WC + Q AA C   A+ HC   VW+
Sbjct:   32 QNVKTASLCGAVQHCQ----QNVWNKPQMKTVPCDLCKEVLVVVEQLLKDNVTESELLGYLE-KACQLIPDEGLANQCKEIVDNYFPVLMGIIQGELDDPGVVCGALGLCVSQQAALAKAQLTSNEIPQVDLNQRVSPFLLNIPQLLYPEEKRETPKQKGDVCQDCVTFINDTQDEARVNSSFISTLIAQVENQCELLGPGMSDMCKEYISQYGPLVFQQLMSMEQQPKDICARAGFCPTKQKSVPMEKLLPAKSIPAVKMFPAVKVEKPVATMPAKNLVRVRDSPQCAICEYVMKEIENMIQDQTSEAEIVQAVEK-VCNILPSTLTAQCKDLIETYGQAIIDLLVQEADPKTVCSFLALCSGVSHVPVMDK-----QHFAAGGFCDVCKMAVRYVDGILEQNATQSEIEEAVLKVCSFLPDAVKDECNQLIEQYEPLLVQLLLQTLDPDF--VCMKLGACPEAVQRLLGLNQCSWGPAYWCKNVQTAARC--NALNHCRRHVWS 522          

HSP 2 Score: 68.1662 bits (165), Expect = 2.480e-11
Identity = 101/466 (21.67%), Postives = 188/466 (40.34%), Query Frame = 2
Query:  491 ICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMF-SKVSPDEFKFLIESLICNQLPSE-VQSTCKLLLDGYVTQLYNLIKSLLDGDRI-CPLIHLCSSENTQITLGSWQ-----------------------------------------CQTCLDVIVVLRKDLAGVSAPEIVSLIK--SNVCSKLNFFEKGICNSYVSNLVPTFVNELHST-LTPQQICGNHHVCTSHS------------------------IKKPIAS--EKGVI------ECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKS-ISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNF-KGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIF-QSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMC--SMKKVSGI 1636
            +CG VQ C+         ++N  + +    C  CK+V   +E +    V+  E    +E   C  +P E + + CK ++D Y   L  +I+  LD   + C  + LC S+  Q  L   Q                                         CQ C+  I    +D A V++  I +LI    N C  L      +C  Y+S   P    +L S    P+ IC     C +                          ++KP+A+   K ++      +C +CE  +   ++ I    +  ++   ++ K+C+ L S +++QC  L++ Y   +I ++    D K +C  +  C G S        +F  G  CD C +AV  +   +   A ++ I+  + +++C     + K +C QL++++  +++  +L  LD D VC  +G C  +++++ G+
Sbjct:   39 LCGAVQHCQQN-------VWNKPQMKTVP-CDLCKEVLVVVEQLLKDNVTESELLGYLEK-ACQLIPDEGLANQCKEIVDNYFPVLMGIIQGELDDPGVVCGALGLCVSQ--QAALAKAQLTSNEIPQVDLNQRVSPFLLNIPQLLYPEEKRETPKQKGDVCQDCVTFIND-TQDEARVNSSFISTLIAQVENQCELLGPGMSDMCKEYISQYGPLVFQQLMSMEQQPKDICARAGFCPTKQKSVPMEKLLPAKSIPAVKMFPAVKVEKPVATMPAKNLVRVRDSPQCAICEYVMKEIENMIQDQTSEAEIVQAVE-KVCNILPSTLTAQCKDLIETYGQAIIDLLVQEADPKTVCSFLALCSGVSHVPVMDKQHFAAGGFCDVCKMAVRYVDGILEQNATQSEIEEAV-LKVCSFLPDAVKDECNQLIEQYEPLLVQLLLQTLDPDFVCMKLGACPEAVQRLLGL 490          

HSP 3 Score: 51.9878 bits (123), Expect = 3.279e-6
Identity = 50/214 (23.36%), Postives = 90/214 (42.06%), Query Frame = 2
Query:  269 SHHKNGDYCDACMKFVQSV--EAHIPKISEQEFVNLAGNLICNN--LKGKSQLD-CKKEVNFFAPLIYREL-SMEATPEKICGLVQVCKN------------TNAMSFSKIF---------------NSIKFQNDDVCTKCKQVFQFLESMF-SKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSS 808
            +  + GD C  C+ F+     EA +       F++     + N   L G    D CK+ ++ + PL++++L SME  P+ IC     C                ++   K+F               N ++ ++   C  C+ V + +E+M   + S  E    +E  +CN LPS + + CK L++ Y   + +L+    D   +C  + LCS 
Sbjct:  181 TPKQKGDVCQDCVTFINDTQDEARV----NSSFISTLIAQVENQCELLGPGMSDMCKEYISQYGPLVFQQLMSMEQQPKDICARAGFCPTKQKSVPMEKLLPAKSIPAVKMFPAVKVEKPVATMPAKNLVRVRDSPQCAICEYVMKEIENMIQDQTSEAEIVQAVEK-VCNILPSTLTAQCKDLIETYGQAIIDLLVQEADPKTVCSFLALCSG 389          
BLAST of Proactivator polypeptide vs. Ensembl Zebrafish
Match: sftpba (surfactant protein Ba [Source:ZFIN;Acc:ZDB-GENE-091204-378])

HSP 1 Score: 53.5286 bits (127), Expect = 3.631e-7
Identity = 63/261 (24.14%), Postives = 99/261 (37.93%), Query Frame = 2
Query: 1826 NSKVICAELKLCSLISQKKINLLMKSNIN----------DDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAKKQ-ECINDINQYYSLVINIITEFLKPT-LCNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKN-TPISPLTVFANVCNLEDTDETNECLKHF-RNLNSIVAAFHASRNIGEFCKMTEMCKGSKKHHV-GKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVW 2563
            N   IC  L LC      KI  L+ ++++          + S +C +C ++VS L  L      Q  I   LE+ +C  F    Q +C   + +Y  ++++++     P  +C  LRLC  +   I            +  SNC  C       Q     N T     +   +VC L + +   +C  +  RN   +       +   + CK   +C    K  V     CS GP + C   Q A  C  GA   C+  VW
Sbjct:    2 NPSEICTYLGLCGGRDSGKIKDLLLNHMSKTGTMPPMQMESSVQCSVCTYIVSTLGFLFPKERTQNIITVLLES-LCKEFPPLVQPQCNKLVGKYVQMLVDMLLNNTSPNFICTLLRLCEISERQI----------NTLALSNCDSCLTLAVLTQMHLGSNATEHQAASFLDSVCQL-NPNAMPKCETYIERNGKQLSLFLSKQQGALDTCKSANLCPSDDKESVITADPCSLGPKYSCRDLQTAVEC--GAFSFCQKSVW 248          

HSP 2 Score: 51.2174 bits (121), Expect = 2.261e-6
Identity = 58/230 (25.22%), Postives = 97/230 (42.17%), Query Frame = 2
Query:  482 PEKICGLVQVCKNT----------NAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSK-VSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQI-TLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIG 1135
            P +IC  + +C             N MS +     ++ ++   C+ C  +   L  +F K  + +    L+ESL C + P  VQ  C  L+  YV  L +++ +    + IC L+ LC     QI TL    C +CL + V+ +  L   +     +    +VC +LN      C +Y+         +L   L+ QQ  G    C S ++  P   ++ VI  D C +G
Sbjct:    3 PSEICTYLGLCGGRDSGKIKDLLLNHMSKTGTMPPMQMESSVQCSVCTYIVSTLGFLFPKERTQNIITVLLESL-CKEFPPLVQPQCNKLVGKYVQMLVDMLLNNTSPNFICTLLRLCEISERQINTLALSNCDSCLTLAVLTQMHLGSNATEHQAASFLDSVC-QLNPNAMPKCETYIER----NGKQLSLFLSKQQ--GALDTCKSANL-CPSDDKESVITADPCSLG 223          
BLAST of Proactivator polypeptide vs. Ensembl Xenopus
Match: psap (prosaposin (variant Gaucher disease and variant metachromatic leukodystrophy) [Source:NCBI gene;Acc:550039])

HSP 1 Score: 83.5741 bits (205), Expect = 4.473e-16
Identity = 108/505 (21.39%), Postives = 204/505 (40.40%), Query Frame = 2
Query: 1106 VIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLK--SISSQCSSLVDAYADQLITMISNHMDSKAI-CIAINACKGF-----SISQRKSAPNFKGIECDACHLAVTKIKEY--ISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIIL-NFVLSELDVDKVCKVMGMCSMKKVSGIECEVCERVMDEVIQL---AFSNHSQQVVSNFIENKICPRLGFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKPT-LCNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKN-TPISPLTVFANVCNLEDTDETNECLKHFRNLNSI-VAAFHASRNIGEFCKMTEMCKGSKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVWN 2566
             + CD+C+  +T   +F+       ++K ++ +K+C  L    +S+ C   +  Y   ++ M+   + +  + C A+  C        S+   K     +  + DA  L    I     + +P  +T  K      IC         C +LV +  D +  N   S+  VD                 ECE+ +  M E+ +     FS+ + QV+      ++C  +GF   E ++ +   +P    +  + +   V   E  L                   +   C++C  ++S++  LL N   +++I++ LE  VC    A+  Q+C + I +YY  +I ++ +   P  +C  L  C++   ++   +  +   +A     C +C+    ++ ++  KN T I      + VCN       +EC         + V     + +    C    +C+ S+K  +G ++C WGP +WC   + AA C   AV HC   VWN
Sbjct:    2 ALPCDMCKEVITVVGNFLKDNMTQGEIKDYL-NKMCDLLPDPGLSATCKQELSEYFPIVLNMLEQELSNPGVLCSALGLCTSLQRHLASLKHPKQLLTNEIPDVDASKLVYPYIVNVPQLLNPQEET-FKEPKTGDICN-------DCLKLVSDVQDALRSNASFSKNLVDHALH-------------ECELLDPGMAEMCKSYINQFSDVAIQVLLQMQPKQLCSMVGFCDQEKSTPLQNIIPAKTLIPAAKVQPAVKITENPLAG-----------------NGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEK-VCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSARRKNLQNVK--ISAEKAAAGDYCTVCKMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLCQ-SEKVLLGTEKCMWGPSYWCKDMETAANC--NAVDHCRRHVWN 461          

HSP 2 Score: 83.5741 bits (205), Expect = 4.676e-16
Identity = 106/454 (23.35%), Postives = 199/454 (43.83%), Query Frame = 2
Query:  581 CTKCKQVFQFLESMF-SKVSPDEFKFLIESLICNQLPSE-VQSTCKLLLDGYVTQLYNLIKSLLDGDRI-CPLIHLCSSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEK--------GICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGA-KSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQ-CQQLVDEFFDIILNFVLSELDVDKVCKVMGMCSMKK-------------VSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL-GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLC 1861
            C  CK+V   + +     ++  E K  +  + C+ LP   + +TCK  L  Y   + N+++  L    + C  + LC+S   Q  L S +    L     L  ++  V A ++V     NV   LN  E+         ICN  +  LV    + L S  +  +   +H                 + EC+L + G+    KS+I++         F    I   L+    Q  S+V     +  T + N + +K +  A        I++   A N  G+ C+ C L +++I++ + +   K +IK+ L+ ++C +  +E  Q C+ +++E++D ++  +  E +   +C  +G CS ++              +G  C VC+ +M  V +L   N ++  + NF+ +++C  L   ++ EC+ L++ Y P+   L    L+   ICA+L LC
Sbjct:    5 CDMCKEVITVVGNFLKDNMTQGEIKDYLNKM-CDLLPDPGLSATCKQELSEYFPIVLNMLEQELSNPGVLCSALGLCTS--LQRHLASLKHPKQL-----LTNEIPDVDASKLVYPYIVNVPQLLNPQEETFKEPKTGDICNDCLK-LVSDVQDALRSNASFSKNLVDH----------------ALHECELLDPGMAEMCKSYINQ---------FSDVAIQVLLQMQPKQLCSMVGFCDQEKSTPLQNIIPAKTLIPAAKVQPAVKITENPLAGN--GVFCEVCQLMISQIEKLLDNNRTKENIKHSLE-KVCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSARRKNLQNVKISAEKAAAGDYCTVCKMMMKYVDELLEKNATEIRIKNFL-SRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLC 420          

HSP 3 Score: 65.0846 bits (157), Expect = 3.373e-10
Identity = 48/189 (25.40%), Postives = 85/189 (44.97%), Query Frame = 2
Query:  281 NGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVN-FFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITLGSWQC 844
            NG +C+ C   +  +E  +     +E +  +   +C  L  +    C+  +  ++ PLI   L  EA P+ IC  +  C        +   ++ K    D CT CK + ++++ +  K + +       S +CN LP  +Q  C  L++ Y      L+   LD   IC  +HLC SE  ++ LG+ +C
Sbjct:  247 NGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEKVCKLLPAEYSQKCEDIIEEYYDPLI-ELLEQEANPQFICTTLGYCSARRKNLQNVKISAEKAAAGDYCTVCKMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLCQSE--KVLLGTEKC 432          

HSP 4 Score: 53.9138 bits (128), Expect = 8.959e-7
Identity = 68/303 (22.44%), Postives = 126/303 (41.58%), Query Frame = 2
Query:  278 KNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLD------CKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSF------------SKIFNSIKFQNDDV------CTKCKQVFQFLESMFSKVSPDE-FKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSS-----ENTQITL-----GSWQCQTCLDVIVVLRKDLAGVSAPEI-VSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSI 1078
            K GD C+ C+K V  V+  +     +   + + NL+ + L     LD      CK  +N F+ +  + L ++  P+++C +V  C    +               +K+  ++K   + +      C  C+ +   +E +       E  K  +E  +C  LP+E    C+ +++ Y   L  L++   +   IC  +  CS+     +N +I+      G + C  C  +++    +L   +A EI +    S VC+ L    +  C+  V+   P FV  L   L P  IC   H+C S  +
Sbjct:  132 KTGDICNDCLKLVSDVQDAL-----RSNASFSKNLVDHALHECELLDPGMAEMCKSYINQFSDVAIQVL-LQMQPKQLCSMVGFCDQEKSTPLQNIIPAKTLIPAAKVQPAVKITENPLAGNGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEK-VCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSARRKNLQNVKISAEKAAAGDY-CTVC-KMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLCQSEKV 425          
BLAST of Proactivator polypeptide vs. Ensembl Xenopus
Match: psap (prosaposin (variant Gaucher disease and variant metachromatic leukodystrophy) [Source:NCBI gene;Acc:550039])

HSP 1 Score: 82.4185 bits (202), Expect = 1.129e-15
Identity = 106/454 (23.35%), Postives = 199/454 (43.83%), Query Frame = 2
Query:  581 CTKCKQVFQFLESMF-SKVSPDEFKFLIESLICNQLPSE-VQSTCKLLLDGYVTQLYNLIKSLLDGDRI-CPLIHLCSSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEK--------GICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGA-KSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQ-CQQLVDEFFDIILNFVLSELDVDKVCKVMGMCSMKK-------------VSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL-GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLC 1861
            C  CK+V   + +     ++  E K  +  + C+ LP   + +TCK  L  Y   + N+++  L    + C  + LC+S   Q  L S +    L     L  ++  V A ++V     NV   LN  E+         ICN  +  LV    + L S  +  +   +H                 + EC+L + G+    KS+I++         F    I   L+    Q  S+V     +  T + N + +K +  A        I++   A N  G+ C+ C L +++I++ + +   K +IK+ L+ ++C +  +E  Q C+ +++E++D ++  +  E +   +C  +G CS ++              +G  C VC+ +M  V +L   N ++  + NF+ +++C  L   ++ EC+ L++ Y P+   L    L+   ICA+L LC
Sbjct:   29 CDMCKEVITVVGNFLKDNMTQGEIKDYLNKM-CDLLPDPGLSATCKQELSEYFPIVLNMLEQELSNPGVLCSALGLCTS--LQRHLASLKHPKQL-----LTNEIPDVDASKLVYPYIVNVPQLLNPQEETFKEPKTGDICNDCLK-LVSDVQDALRSNASFSKNLVDH----------------ALHECELLDPGMAEMCKSYINQ---------FSDVAIQVLLQMQPKQLCSMVGFCDQEKSTPLQNIIPAKTLIPAAKVQPAVKITENPLAGN--GVFCEVCQLMISQIEKLLDNNRTKENIKHSLE-KVCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSARRKNLQNVKISAEKAAAGDYCTVCKMMMKYVDELLEKNATEIRIKNFL-SRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLC 444          

HSP 2 Score: 72.7886 bits (177), Expect = 1.303e-12
Identity = 102/498 (20.48%), Postives = 205/498 (41.16%), Query Frame = 2
Query: 1106 VIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLK--SISSQCSSLVDAYADQLITMISNHMDSKAI-CIAINACKGF-----SISQRKSAPNFKGIECDACHLAVTKIKEY--ISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIIL-NFVLSELDVDKVCKVMGMCSMKKVSGIECEVCERVMDEVIQL---AFSNHSQQVVSNFIENKICPRLGFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKPT-LCNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKN-TPISPLTVFANVCNLEDTDETNECLKHFRNLNSI-VAAFHASRNIGEFCKMTEMCKGSKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKH 2545
             + CD+C+  +T   +F+       ++K ++ +K+C  L    +S+ C   +  Y   ++ M+   + +  + C A+  C        S+   K     +  + DA  L    I     + +P  +T  K      IC         C +LV +  D +  N   S+  VD                 ECE+ +  M E+ +     FS+ + QV+      ++C  +GF   E ++ +   +P     A++ + +  +   +K+             ++ +  +   C++C  ++S++  LL N   +++I++ LE  VC    A+  Q+C + I +YY  +I ++ +   P  +C  L  C++   ++   +  +   +A     C +C+    ++ ++  KN T I      + VCN       +EC         + V     + +    C    +C+ S+K  +G ++C WGP +WC   + AA C     KH
Sbjct:   26 ALPCDMCKEVITVVGNFLKDNMTQGEIKDYL-NKMCDLLPDPGLSATCKQELSEYFPIVLNMLEQELSNPGVLCSALGLCTSLQRHLASLKHPKQLLTNEIPDVDASKLVYPYIVNVPQLLNPQEET-FKEPKTGDICN-------DCLKLVSDVQDALRSNASFSKNLVDHALH-------------ECELLDPGMAEMCKSYINQFSDVAIQVLLQMQPKQLCSMVGFCDQEKSTPLQNIIP-----AKTLIPAAKVQPAVKI------------TENPLAGNGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEK-VCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSARRKNLQNVK--ISAEKAAAGDYCTVCKMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLCQ-SEKVLLGTEKCMWGPSYWCKDMETAANCNRYCSKH 480          

HSP 3 Score: 64.6994 bits (156), Expect = 3.923e-10
Identity = 48/189 (25.40%), Postives = 85/189 (44.97%), Query Frame = 2
Query:  281 NGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVN-FFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITLGSWQC 844
            NG +C+ C   +  +E  +     +E +  +   +C  L  +    C+  +  ++ PLI   L  EA P+ IC  +  C        +   ++ K    D CT CK + ++++ +  K + +       S +CN LP  +Q  C  L++ Y      L+   LD   IC  +HLC SE  ++ LG+ +C
Sbjct:  271 NGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEKVCKLLPAEYSQKCEDIIEEYYDPLI-ELLEQEANPQFICTTLGYCSARRKNLQNVKISAEKAAAGDYCTVCKMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLCQSE--KVLLGTEKC 456          

HSP 4 Score: 53.5286 bits (127), Expect = 1.430e-6
Identity = 67/303 (22.11%), Postives = 128/303 (42.24%), Query Frame = 2
Query:  278 KNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLD------CKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSF------------SKIFNSIKFQNDDV------CTKCKQVFQFLESMF-SKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSS-----ENTQITL-----GSWQCQTCLDVIVVLRKDLAGVSAPEI-VSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSI 1078
            K GD C+ C+K V  V+  +     +   + + NL+ + L     LD      CK  +N F+ +  + L ++  P+++C +V  C    +               +K+  ++K   + +      C  C+ +   +E +  +  + +  K  +E  +C  LP+E    C+ +++ Y   L  L++   +   IC  +  CS+     +N +I+      G + C  C  +++    +L   +A EI +    S VC+ L    +  C+  V+   P FV  L   L P  IC   H+C S  +
Sbjct:  156 KTGDICNDCLKLVSDVQDAL-----RSNASFSKNLVDHALHECELLDPGMAEMCKSYINQFSDVAIQVL-LQMQPKQLCSMVGFCDQEKSTPLQNIIPAKTLIPAAKVQPAVKITENPLAGNGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEK-VCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSARRKNLQNVKISAEKAAAGDY-CTVC-KMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLCQSEKV 449          
BLAST of Proactivator polypeptide vs. Ensembl Xenopus
Match: psap (prosaposin (variant Gaucher disease and variant metachromatic leukodystrophy) [Source:NCBI gene;Acc:550039])

HSP 1 Score: 82.0333 bits (201), Expect = 1.757e-15
Identity = 106/454 (23.35%), Postives = 199/454 (43.83%), Query Frame = 2
Query:  581 CTKCKQVFQFLESMF-SKVSPDEFKFLIESLICNQLPSE-VQSTCKLLLDGYVTQLYNLIKSLLDGDRI-CPLIHLCSSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEK--------GICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGA-KSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQ-CQQLVDEFFDIILNFVLSELDVDKVCKVMGMCSMKK-------------VSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL-GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLC 1861
            C  CK+V   + +     ++  E K  +  + C+ LP   + +TCK  L  Y   + N+++  L    + C  + LC+S   Q  L S +    L     L  ++  V A ++V     NV   LN  E+         ICN  +  LV    + L S  +  +   +H                 + EC+L + G+    KS+I++         F    I   L+    Q  S+V     +  T + N + +K +  A        I++   A N  G+ C+ C L +++I++ + +   K +IK+ L+ ++C +  +E  Q C+ +++E++D ++  +  E +   +C  +G CS ++              +G  C VC+ +M  V +L   N ++  + NF+ +++C  L   ++ EC+ L++ Y P+   L    L+   ICA+L LC
Sbjct:    8 CDMCKEVITVVGNFLKDNMTQGEIKDYLNKM-CDLLPDPGLSATCKQELSEYFPIVLNMLEQELSNPGVLCSALGLCTS--LQRHLASLKHPKQL-----LTNEIPDVDASKLVYPYIVNVPQLLNPQEETFKEPKTGDICNDCLK-LVSDVQDALRSNASFSKNLVDH----------------ALHECELLDPGMAEMCKSYINQ---------FSDVAIQVLLQMQPKQLCSMVGFCDQEKSTPLQNIIPAKTLIPAAKVQPAVKITENPLAGN--GVFCEVCQLMISQIEKLLDNNRTKENIKHSLE-KVCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSARRKNLQNVKISAEKAAAGDYCTVCKMMMKYVDELLEKNATEIRIKNFL-SRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLC 423          

HSP 2 Score: 71.633 bits (174), Expect = 3.677e-12
Identity = 100/490 (20.41%), Postives = 203/490 (41.43%), Query Frame = 2
Query: 1109 IECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLK--SISSQCSSLVDAYADQLITMISNHMDSKAI-CIAINACKGF-----SISQRKSAPNFKGIECDACHLAVTKIKEY--ISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIIL-NFVLSELDVDKVCKVMGMCSMKKVSGIECEVCERVMDEVIQL---AFSNHSQQVVSNFIENKICPRLGFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKPT-LCNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKN-TPISPLTVFANVCNLEDTDETNECLKHFRNLNSI-VAAFHASRNIGEFCKMTEMCKGSKKHHVGKKQCSWGPGFWCISRQHAAGC 2524
            + CD+C+  +T   +F+       ++K ++ +K+C  L    +S+ C   +  Y   ++ M+   + +  + C A+  C        S+   K     +  + DA  L    I     + +P  +T  K      IC         C +LV +  D +  N   S+  VD                 ECE+ +  M E+ +     FS+ + QV+      ++C  +GF   E ++ +   +P     A++ + +  +   +K+             ++ +  +   C++C  ++S++  LL N   +++I++ LE  VC    A+  Q+C + I +YY  +I ++ +   P  +C  L  C++   ++   +  +   +A     C +C+    ++ ++  KN T I      + VCN       +EC         + V     + +    C    +C+ S+K  +G ++C WGP +WC   + AA C
Sbjct:    6 LPCDMCKEVITVVGNFLKDNMTQGEIKDYL-NKMCDLLPDPGLSATCKQELSEYFPIVLNMLEQELSNPGVLCSALGLCTSLQRHLASLKHPKQLLTNEIPDVDASKLVYPYIVNVPQLLNPQEET-FKEPKTGDICN-------DCLKLVSDVQDALRSNASFSKNLVDHALH-------------ECELLDPGMAEMCKSYINQFSDVAIQVLLQMQPKQLCSMVGFCDQEKSTPLQNIIP-----AKTLIPAAKVQPAVKI------------TENPLAGNGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEK-VCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSARRKNLQNVK--ISAEKAAAGDYCTVCKMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLCQ-SEKVLLGTEKCMWGPSYWCKDMETAANC 452          

HSP 3 Score: 64.6994 bits (156), Expect = 4.165e-10
Identity = 48/189 (25.40%), Postives = 85/189 (44.97%), Query Frame = 2
Query:  281 NGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVN-FFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITLGSWQC 844
            NG +C+ C   +  +E  +     +E +  +   +C  L  +    C+  +  ++ PLI   L  EA P+ IC  +  C        +   ++ K    D CT CK + ++++ +  K + +       S +CN LP  +Q  C  L++ Y      L+   LD   IC  +HLC SE  ++ LG+ +C
Sbjct:  250 NGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEKVCKLLPAEYSQKCEDIIEEYYDPLI-ELLEQEANPQFICTTLGYCSARRKNLQNVKISAEKAAAGDYCTVCKMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLCQSE--KVLLGTEKC 435          

HSP 4 Score: 53.9138 bits (128), Expect = 1.050e-6
Identity = 68/303 (22.44%), Postives = 126/303 (41.58%), Query Frame = 2
Query:  278 KNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLD------CKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSF------------SKIFNSIKFQNDDV------CTKCKQVFQFLESMFSKVSPDE-FKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSS-----ENTQITL-----GSWQCQTCLDVIVVLRKDLAGVSAPEI-VSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSI 1078
            K GD C+ C+K V  V+  +     +   + + NL+ + L     LD      CK  +N F+ +  + L ++  P+++C +V  C    +               +K+  ++K   + +      C  C+ +   +E +       E  K  +E  +C  LP+E    C+ +++ Y   L  L++   +   IC  +  CS+     +N +I+      G + C  C  +++    +L   +A EI +    S VC+ L    +  C+  V+   P FV  L   L P  IC   H+C S  +
Sbjct:  135 KTGDICNDCLKLVSDVQDAL-----RSNASFSKNLVDHALHECELLDPGMAEMCKSYINQFSDVAIQVL-LQMQPKQLCSMVGFCDQEKSTPLQNIIPAKTLIPAAKVQPAVKITENPLAGNGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEK-VCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSARRKNLQNVKISAEKAAAGDY-CTVC-KMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLCQSEKV 428          
BLAST of Proactivator polypeptide vs. Ensembl Xenopus
Match: psap (prosaposin (variant Gaucher disease and variant metachromatic leukodystrophy) [Source:NCBI gene;Acc:550039])

HSP 1 Score: 77.7962 bits (190), Expect = 4.207e-14
Identity = 57/248 (22.98%), Postives = 116/248 (46.77%), Query Frame = 2
Query: 1226 SISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAP---------------------NFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQ-CQQLVDEFFDIILNFVLSELDVDKVCKVMGMCSMKK-------------VSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL-GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLC 1861
             ++  C S ++ ++D  I ++   M  K +C  +  C      Q KS P                        G+ C+ C L +++I++ + +   K +IK+ L+ ++C +  +E  Q C+ +++E++D ++  +  E +   +C  +G CS ++              +G  C VC+ +M  V +L   N ++  + NF+ +++C  L   ++ EC+ L++ Y P+   L    L+   ICA+L LC
Sbjct:  196 GMAEMCKSYINQFSDVAIQVLL-QMQPKQLCSMVGFC-----DQEKSTPLQNIIPAKTLIPAAKITENPLAGNGVFCEVCQLMISQIEKLLDNNRTKENIKHSLE-KVCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSARRKNLQNVKISAEKAAAGDYCTVCKMMMKYVDELLEKNATEIRIKNFL-SRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLC 435          

HSP 2 Score: 71.2478 bits (173), Expect = 4.775e-12
Identity = 105/494 (21.26%), Postives = 202/494 (40.89%), Query Frame = 2
Query: 1097 EKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLK--SISSQCSSLVDAYADQLITMISNHMDSKAI-CIAINACKGF-----SISQRKSAPNFKGIECDACHLAVTKIKEY--ISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIIL-NFVLSELDVDKVCKVMGMCSMKKVSGIECEVCERVMDEVIQL---AFSNHSQQVVSNFIENKICPRLGFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKPT-LCNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKN-TPISPLTVFANVCNLEDTDETNECLKHFRNLNSI-VAAFHASRNIGEFCKMTEMCKGSKKHHVGKKQCSWGPGFWCISRQHAAGC 2524
             +  + CD+C+  +T   +F+       ++K ++ +K+C  L    +S+ C   +  Y   ++ M+   + +  + C A+  C        S+   K     +  + DA  L    I     + +P  +T  K      IC         C +LV +  D +  N   S+  VD                 ECE+ +  M E+ +     FS+ + QV+      ++C  +GF   E                +ST    +I A+    +LI   KI    ++ +  +   C++C  ++S++  LL N   +++I++ LE  VC    A+  Q+C + I +YY  +I ++ +   P  +C  L  C++   ++   +  +   +A     C +C+    ++ ++  KN T I      + VCN       +EC         + V     + +    C    +C+ S+K  +G ++C WGP +WC   + AA C
Sbjct:   20 RQKALPCDMCKEVITVVGNFLKDNMTQGEIKDYL-NKMCDLLPDPGLSATCKQELSEYFPIVLNMLEQELSNPGVLCSALGLCTSLQRHLASLKHPKQLLTNEIPDVDASKLVYPYIVNVPQLLNPQEET-FKEPKTGDICN-------DCLKLVSDVQDALRSNASFSKNLVDHALH-------------ECELLDPGMAEMCKSYINQFSDVAIQVLLQMQPKQLCSMVGFCDQE----------------KSTPLQNIIPAK----TLIPAAKIT---ENPLAGNGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEK-VCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSARRKNLQNVK--ISAEKAAAGDYCTVCKMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLCQ-SEKVLLGTEKCMWGPSYWCKDMETAANC 464          

HSP 3 Score: 64.6994 bits (156), Expect = 4.561e-10
Identity = 48/189 (25.40%), Postives = 85/189 (44.97%), Query Frame = 2
Query:  281 NGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVN-FFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITLGSWQC 844
            NG +C+ C   +  +E  +     +E +  +   +C  L  +    C+  +  ++ PLI   L  EA P+ IC  +  C        +   ++ K    D CT CK + ++++ +  K + +       S +CN LP  +Q  C  L++ Y      L+   LD   IC  +HLC SE  ++ LG+ +C
Sbjct:  262 NGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEKVCKLLPAEYSQKCEDIIEEYYDPLI-ELLEQEANPQFICTTLGYCSARRKNLQNVKISAEKAAAGDYCTVCKMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLCQSE--KVLLGTEKC 447          

HSP 4 Score: 55.8398 bits (133), Expect = 3.010e-7
Identity = 69/297 (23.23%), Postives = 123/297 (41.41%), Query Frame = 2
Query:  278 KNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLD------CKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSF------------SKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDE-FKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSS-----ENTQITL-----GSWQCQTCLDVIVVLRKDLAGVSAPEI-VSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSI 1078
            K GD C+ C+K V  V+  +     +   + + NL+ + L     LD      CK  +N F+ +  + L ++  P+++C +V  C    +               +KI  +    N   C  C+ +   +E +       E  K  +E  +C  LP+E    C+ +++ Y   L  L++   +   IC  +  CS+     +N +I+      G + C  C  +++    +L   +A EI +    S VC+ L    +  C+  V+   P FV  L   L P  IC   H+C S  +
Sbjct:  153 KTGDICNDCLKLVSDVQDAL-----RSNASFSKNLVDHALHECELLDPGMAEMCKSYINQFSDVAIQVL-LQMQPKQLCSMVGFCDQEKSTPLQNIIPAKTLIPAAKITENPLAGNGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEK-VCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSARRKNLQNVKISAEKAAAGDY-CTVC-KMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLCQSEKV 440          
BLAST of Proactivator polypeptide vs. Ensembl Xenopus
Match: psap (prosaposin (variant Gaucher disease and variant metachromatic leukodystrophy) [Source:NCBI gene;Acc:550039])

HSP 1 Score: 77.0258 bits (188), Expect = 6.246e-14
Identity = 112/505 (22.18%), Postives = 207/505 (40.99%), Query Frame = 2
Query: 1106 VIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLK--SISSQCSSLVDAYADQLITMISNHMDSKAI-CIAINACKGF-----SISQRKSAPNFKGIECDACHLAVTKIKEY--ISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIIL-NFVLSELDVDKVCKVMGMCSMKKVSGIECEVCERVMDEVIQL---AFSNHSQQVVSNFIENKICPRLGFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKPT-LCNELRLC-----NSTTTSIIMSQPLVKMS--RAILSSNCQLCEKFYFHLQKIFLKN-TPISPLTVFANVCNLEDTDETNECLKHFRNLNSI-VAAFHASRNIGEFCKMTEMCKGSKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKH 2545
             + CD+C+  +T   +F+       ++K ++ +K+C  L    +S+ C   +  Y   ++ M+   + +  + C A+  C        S+   K     +  + DA  L    I     + +P  +T  K      IC         C +LV +  D +  N   S+  VD                 ECE+ +  M E+ +     FS+ + QV+      ++C  +GF   E                +ST    +I A+    +LI   KI    ++ +  +   C++C  ++S++  LL N   +++I++ LE  VC    A+  Q+C + I +YY  +I ++ +   P  +C  L  C     N    +++   PL+K+S  +A     C +C+    ++ ++  KN T I      + VCN       +EC         + V     + +    C    +C+ S+K  +G ++C WGP +WC   + AA C     KH
Sbjct:   24 ALPCDMCKEVITVVGNFLKDNMTQGEIKDYL-NKMCDLLPDPGLSATCKQELSEYFPIVLNMLEQELSNPGVLCSALGLCTSLQRHLASLKHPKQLLTNEIPDVDASKLVYPYIVNVPQLLNPQEET-FKEPKTGDICN-------DCLKLVSDVQDALRSNASFSKNLVDHALH-------------ECELLDPGMAEMCKSYINQFSDVAIQVLLQMQPKQLCSMVGFCDQE----------------KSTPLQNIIPAK----TLIPAAKIT---ENPLAGNGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEK-VCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSARRKNLQNGNMLRGIPLLKISAEKAAAGDYCTVCKMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLCQ-SEKVLLGTEKCMWGPSYWCKDMETAANCNRYCSKH 481          

HSP 2 Score: 74.7146 bits (182), Expect = 2.836e-13
Identity = 109/477 (22.85%), Postives = 208/477 (43.61%), Query Frame = 2
Query:  539 SKIFNSIKFQNDDVCTKCKQVFQFLESMF-SKVSPDEFKFLIESLICNQLPSE-VQSTCKLLLDGYVTQLYNLIKSLLDGDRI-CPLIHLCSSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEK--------GICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGA-KSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQ-CQQLVDEFFDIILNFVLSELDVDKVCKVMGMCSMKK----------------------VSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL-GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLC 1861
            ++ FN  +      C  CK+V   + +     ++  E K  +  + C+ LP   + +TCK  L  Y   + N+++  L    + C  + LC+S   Q  L S +    L     L  ++  V A ++V     NV   LN  E+         ICN  +       V+++   L            ++ S  K +  +  + EC+L + G+    KS+I++         F    I   L+    Q  S+V     +  T + N + +K +   I A K   I++   A N  G+ C+ C L +++I++ + +   K +IK+ L+ ++C +  +E  Q C+ +++E++D ++  +  E +   +C  +G CS ++                       +G  C VC+ +M  V +L   N ++  + NF+ +++C  L   ++ EC+ L++ Y P+   L    L+   ICA+L LC
Sbjct:   13 TRDFNPHQGPKALPCDMCKEVITVVGNFLKDNMTQGEIKDYLNKM-CDLLPDPGLSATCKQELSEYFPIVLNMLEQELSNPGVLCSALGLCTS--LQRHLASLKHPKQL-----LTNEIPDVDASKLVYPYIVNVPQLLNPQEETFKEPKTGDICNDCLK-----LVSDVQDALR-----------SNASFSKNLV-DHALHECELLDPGMAEMCKSYINQ---------FSDVAIQVLLQMQPKQLCSMVGFCDQEKSTPLQNIIPAKTL---IPAAK---ITENPLAGN--GVFCEVCQLMISQIEKLLDNNRTKENIKHSLE-KVCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSARRKNLQNGNMLRGIPLLKISAEKAAAGDYCTVCKMMMKYVDELLEKNATEIRIKNFL-SRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLC 445          

HSP 3 Score: 63.1586 bits (152), Expect = 1.521e-9
Identity = 50/198 (25.25%), Postives = 89/198 (44.95%), Query Frame = 2
Query:  281 NGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVN-FFAPLIYRELSMEATPEKICGLVQVC-------KNTNAMSFSKIF--NSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITLGSWQC 844
            NG +C+ C   +  +E  +     +E +  +   +C  L  +    C+  +  ++ PLI   L  EA P+ IC  +  C       +N N +    +   ++ K    D CT CK + ++++ +  K + +       S +CN LP  +Q  C  L++ Y      L+   LD   IC  +HLC SE  ++ LG+ +C
Sbjct:  263 NGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEKVCKLLPAEYSQKCEDIIEEYYDPLI-ELLEQEANPQFICTTLGYCSARRKNLQNGNMLRGIPLLKISAEKAAAGDYCTVCKMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLCQSE--KVLLGTEKC 457          

HSP 4 Score: 53.1434 bits (126), Expect = 1.792e-6
Identity = 67/305 (21.97%), Postives = 119/305 (39.02%), Query Frame = 2
Query:  278 KNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLD------CKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSF------------SKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDE-FKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITLGSW------------------QCQTCLDVIVVLRKDLAGVSAPEI-VSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSI 1078
            K GD C+ C+K V  V+  +     +   + + NL+ + L     LD      CK  +N F+ +  + L ++  P+++C +V  C    +               +KI  +    N   C  C+ +   +E +       E  K  +E  +C  LP+E    C+ +++ Y   L  L++   +   IC  +  CS+    +  G+                    C  C  +++    +L   +A EI +    S VC+ L    +  C+  V+   P FV  L   L P  IC   H+C S  +
Sbjct:  154 KTGDICNDCLKLVSDVQDAL-----RSNASFSKNLVDHALHECELLDPGMAEMCKSYINQFSDVAIQVL-LQMQPKQLCSMVGFCDQEKSTPLQNIIPAKTLIPAAKITENPLAGNGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEK-VCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSARRKNLQNGNMLRGIPLLKISAEKAAAGDYCTVC-KMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLCQSEKV 450          
BLAST of Proactivator polypeptide vs. Ensembl Mouse
Match: Psapl1 (prosaposin-like 1 [Source:MGI Symbol;Acc:MGI:1924193])

HSP 1 Score: 73.1738 bits (178), Expect = 7.105e-13
Identity = 108/523 (20.65%), Postives = 197/523 (37.67%), Query Frame = 2
Query: 1061 CTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKS--ISSQCSSLVDAYADQLITMISN--HMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQ------CQQLVDEFFDII-LNFVLSELDVDKVCKVMGMCSMKKVSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRLGFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLEN--HVCPHFGAKKQECINDINQYYSLVINIITEFLKPTLCNELRLCNS-----TTTSIIMSQPLVKMSRAILSSNCQLCEKFY-FHLQKIFLKNTPISPLTVFANVCNLEDTDETNECLKHFRNLNSI-VAAFHASRNIGEFCKMTEMCKGSKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVWNQ 2569
            C S    KP       + C +C+     A + ++     + + + +  K C  L S   S++C  +V+ ++  +++M+S     D  ++C A+  C+     QR              HLA T  +  ++       +  FL         S+  +      C QL+    D +  N  L+E+ V   C+ MG        G+   +CE  +      A     +Q +      ++C + GF + E              L R      V   E+++      +   L M+  +      C +C  +V EL   L     +  I + LE    V P      Q+CI  ++ Y   ++ ++++     +C  ++LC S     + +  + + P + +      S CQ C++      Q +  K+T    L  F   C +       +C +       + + +     N  + CK    C G K   +G  QC  GP FWC S + A  C   A++HC+  VW +
Sbjct:   52 CQSAVWNKPTVKS---LPCSVCQDVAAAAGNGVNPGATESDILTSVM-KTCEWLPSQESSAKCKWMVNNHSAAVLSMLSGAQETDLASVCTALTLCEPL---QR--------------HLAETTSERPLTQEDANEVMAPFLSNGALSFHPSQMPEGAVCHDCVQLISLLQDALESNLTLAEVTVQNQCQSMG-------PGLA-ALCENYIHRQFVPA-----KQTLQGLPPQEVCRKGGFCERESAHW----------LTRVAAVDGVPSLEMEM-----PRTNELQMQLGLT-----CDVCLNLVQELDKWLVTNSTEALISHTLERVCTVVPE--PLVQQCITLVDTYSPELVQLMSKVTPEKVCETIKLCGSKRRARSISRAVATTPSLPVDEENQGSFCQGCKRLLGMSSQNLDHKSTKRDILNAFKGGCRILPLPYVMQCNRFVAEYEPVLIESLKFMMNPTDLCKKMGACHGPKTPLLGTDQCVMGPSFWCKSPEAAEMC--NALEHCQRLVWKK 516          
BLAST of Proactivator polypeptide vs. Ensembl Mouse
Match: Psap (prosaposin [Source:MGI Symbol;Acc:MGI:97783])

HSP 1 Score: 58.5362 bits (140), Expect = 3.223e-8
Identity = 73/364 (20.05%), Postives = 136/364 (37.36%), Query Frame = 2
Query: 1640 CEVCERVMDEVIQLAFSNHSQQVVSNFIEN--KICPRLG-FVKTECTSLIDTYLPVIFSLARSTLN-SKVICAELKLCSLISQKKI-----------NLLMKSNINDDSAK----------CKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAKKQECINDINQYYSLVINIITEFLKPT-LCNELRLCNSTTTSI-IMSQPLVKMSRAILSSN--------------------------CQLCEKFYFHLQKIFLKN-TPISPLTVFANVCNLEDTDETNECLKHFRNLNSIVAAFHAS-RNIGEFCKMTEMCKGSKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVWN 2566
            C+ C +++ +V     +N S   +  F+++  + C RLG  V   C + +D Y  V   +    L   K IC     C+ + +  +           N+L    + D   +          C+ C FV+++   L+ N   ++ +   L N         + +C   +  +   +++I    + P+ LC  + LC +    +  + QP   +  A+L                             C++C+K   +L+    KN T    L      C+        +C         ++        + G  C    +C  + K  +G ++C WGP +WC + + AA C   AV HC+  VWN
Sbjct:  197 CQDCMKLVSDVQTAVKTNSS--FIQGFVDHVKEDCDRLGPGVSDICKNYVDQYSEVCVQMLMHMLQQPKEICVLAGFCNEVKRVPMKTLVPATETIKNILPALEMMDPYEQNLVQAHNVILCQTCQFVMNKFSELIVNNATEELLVKGLSNACALLPDPARTKCQEVVGTFGPSLLDIFIHEVNPSSLCGVIGLCAARPELVEALEQPAPAIVSALLKEPTPPKQPAQPKQSALPAHVPPQKNGGFCEVCKKLVLYLEHNLEKNSTKEEILAALEKGCSFLPDPYQKQCDDFVAEYEPLLLEILVEVMDPGFVCSKIGVCPSAYKLLLGTEKCVWGPSYWCQNMETAARC--NAVDHCKRHVWN 556          
BLAST of Proactivator polypeptide vs. Ensembl Mouse
Match: Psap (prosaposin [Source:MGI Symbol;Acc:MGI:97783])

HSP 1 Score: 57.7658 bits (138), Expect = 5.249e-8
Identity = 72/363 (19.83%), Postives = 136/363 (37.47%), Query Frame = 2
Query: 1640 CEVCERVMDEVIQLAFSNHSQQVVSNFIEN--KICPRLG-FVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKI-----------NLLMKSNINDDSAK----------CKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAKKQECINDINQYYSLVINIITEFLKPT-LCNELRLCNSTTTSI-IMSQPLVKMSRAILSSN--------------------------CQLCEKFYFHLQKIFLKN-TPISPLTVFANVCNLEDTDETNECLKHFRNLNSIVAAFHAS-RNIGEFCKMTEMCKGSKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVWN 2566
            C+ C +++ +V     +N S   +  F+++  + C RLG  V   C + +D Y  V   +    +  K IC     C+ + +  +           N+L    + D   +          C+ C FV+++   L+ N   ++ +   L N         + +C   +  +   +++I    + P+ LC  + LC +    +  + QP   +  A+L                             C++C+K   +L+    KN T    L      C+        +C         ++        + G  C    +C  + K  +G ++C WGP +WC + + AA C   AV HC+  VWN
Sbjct:  197 CQDCMKLVSDVQTAVKTNSS--FIQGFVDHVKEDCDRLGPGVSDICKNYVDQYSEVCVQMLMH-MQPKEICVLAGFCNEVKRVPMKTLVPATETIKNILPALEMMDPYEQNLVQAHNVILCQTCQFVMNKFSELIVNNATEELLVKGLSNACALLPDPARTKCQEVVGTFGPSLLDIFIHEVNPSSLCGVIGLCAARPELVEALEQPAPAIVSALLKEPTPPKQPAQPKQSALPAHVPPQKNGGFCEVCKKLVLYLEHNLEKNSTKEEILAALEKGCSFLPDPYQKQCDDFVAEYEPLLLEILVEVMDPGFVCSKIGVCPSAYKLLLGTEKCVWGPSYWCQNMETAARC--NAVDHCKRHVWN 554          
BLAST of Proactivator polypeptide vs. Ensembl Mouse
Match: Psap (prosaposin [Source:MGI Symbol;Acc:MGI:97783])

HSP 1 Score: 57.7658 bits (138), Expect = 5.320e-8
Identity = 72/363 (19.83%), Postives = 136/363 (37.47%), Query Frame = 2
Query: 1640 CEVCERVMDEVIQLAFSNHSQQVVSNFIEN--KICPRLG-FVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKI-----------NLLMKSNINDDSAK----------CKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAKKQECINDINQYYSLVINIITEFLKPT-LCNELRLCNSTTTSI-IMSQPLVKMSRAILSSN--------------------------CQLCEKFYFHLQKIFLKN-TPISPLTVFANVCNLEDTDETNECLKHFRNLNSIVAAFHAS-RNIGEFCKMTEMCKGSKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVWN 2566
            C+ C +++ +V     +N S   +  F+++  + C RLG  V   C + +D Y  V   +    +  K IC     C+ + +  +           N+L    + D   +          C+ C FV+++   L+ N   ++ +   L N         + +C   +  +   +++I    + P+ LC  + LC +    +  + QP   +  A+L                             C++C+K   +L+    KN T    L      C+        +C         ++        + G  C    +C  + K  +G ++C WGP +WC + + AA C   AV HC+  VWN
Sbjct:  194 CQDCMKLVSDVQTAVKTNSS--FIQGFVDHVKEDCDRLGPGVSDICKNYVDQYSEVCVQMLMH-MQPKEICVLAGFCNEVKRVPMKTLVPATETIKNILPALEMMDPYEQNLVQAHNVILCQTCQFVMNKFSELIVNNATEELLVKGLSNACALLPDPARTKCQEVVGTFGPSLLDIFIHEVNPSSLCGVIGLCAARPELVEALEQPAPAIVSALLKEPTPPKQPAQPKQSALPAHVPPQKNGGFCEVCKKLVLYLEHNLEKNSTKEEILAALEKGCSFLPDPYQKQCDDFVAEYEPLLLEILVEVMDPGFVCSKIGVCPSAYKLLLGTEKCVWGPSYWCQNMETAARC--NAVDHCKRHVWN 551          
BLAST of Proactivator polypeptide vs. Ensembl Mouse
Match: Psap (prosaposin [Source:MGI Symbol;Acc:MGI:97783])

HSP 1 Score: 56.9954 bits (136), Expect = 8.981e-8
Identity = 72/365 (19.73%), Postives = 136/365 (37.26%), Query Frame = 2
Query: 1640 CEVCERVMDEVIQLAFSNHSQQVVSNFIEN--KICPRLG-FVKTECTSLIDTYLPVIFSLARSTLN--SKVICAELKLCSLISQKKI-----------NLLMKSNINDDSAK----------CKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAKKQECINDINQYYSLVINIITEFLKPT-LCNELRLCNSTTTSI-IMSQPLVKMSRAILSSN--------------------------CQLCEKFYFHLQKIFLKN-TPISPLTVFANVCNLEDTDETNECLKHFRNLNSIVAAFHAS-RNIGEFCKMTEMCKGSKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVWN 2566
            C+ C +++ +V     +N S   +  F+++  + C RLG  V   C + +D Y  V   +    +    K IC     C+ + +  +           N+L    + D   +          C+ C FV+++   L+ N   ++ +   L N         + +C   +  +   +++I    + P+ LC  + LC +    +  + QP   +  A+L                             C++C+K   +L+    KN T    L      C+        +C         ++        + G  C    +C  + K  +G ++C WGP +WC + + AA C   AV HC+  VWN
Sbjct:  197 CQDCMKLVSDVQTAVKTNSS--FIQGFVDHVKEDCDRLGPGVSDICKNYVDQYSEVCVQMLMHMVGRQPKEICVLAGFCNEVKRVPMKTLVPATETIKNILPALEMMDPYEQNLVQAHNVILCQTCQFVMNKFSELIVNNATEELLVKGLSNACALLPDPARTKCQEVVGTFGPSLLDIFIHEVNPSSLCGVIGLCAARPELVEALEQPAPAIVSALLKEPTPPKQPAQPKQSALPAHVPPQKNGGFCEVCKKLVLYLEHNLEKNSTKEEILAALEKGCSFLPDPYQKQCDDFVAEYEPLLLEILVEVMDPGFVCSKIGVCPSAYKLLLGTEKCVWGPSYWCQNMETAARC--NAVDHCKRHVWN 557          
BLAST of Proactivator polypeptide vs. UniProt/SwissProt
Match: sp|P07602|SAP_HUMAN (Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 2.928e-17
Identity = 116/531 (21.85%), Postives = 212/531 (39.92%), Query Frame = 2
Query: 1043 CGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLK--SISSQCSSLVDAYADQLITMISNHMDSKA-ICIAINACKGF-----SISQRKSA-----PNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIIL------NFVLSELD-VDKVCKVMGMCSMKKVSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRLGFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAKKQECINDINQYYSLVINIITEFLKPTL-CNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKN-TPISPLTVFANVCNLEDTDETNECLKHFRNLNSIVAAFHASRNIGEF-CKMTEMCKGSKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVWN 2566
            CG    C      KP       + CD+C+  VT A   +       ++  +++ K C  L   ++S+ C  +VD+Y   ++ +I   M     +C A+N C+        ++ +K       P     E  A  +A   +  Y  D  R             P  +     CQ  +    DI         FV + ++ V + C  +G        G+  ++C+  + +  ++A      Q++ +    +IC  +GF        + T +P       + + SK +   L+L   I  KK  +  KS++      C++C F+V E+  L+ N   +K I +  +        +  +EC   ++ Y S +++I+ E + P L C+ L LC+ T    +     V +++      C++C+K   +L +   KN T    L      C+        +C +       ++           F C     C  + K  +G ++C WGP +WC + + AA C   AV+HC+  VWN
Sbjct:   42 CGAVKHCLQTVWNKPTVKS---LPCDICKDVVTAAGDMLKDNATEEEILVYLE-KTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNLCESLQKHLAELNHQKQLESNKIPELDMTEVVAPFMANIPLLLYPQDGPRSK-----------PQPKDNGDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLG-------PGM-ADICKNYISQYSEIAI-----QMMMHMQPKEICALVGFCDEVKEMPMQTLVP-------AKVASKNVIPALELVEPI--KKHEVPAKSDVY-----CEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGTRLPALT----VHVTQPKDGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPSAHKPLLGTEKCIWGPSYWCQNTETAAQC--NAVEHCKRHVWN 524          

HSP 2 Score: 55.0694 bits (131), Expect = 2.326e-6
Identity = 86/438 (19.63%), Postives = 162/438 (36.99%), Query Frame = 2
Query:  581 CTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLP-SEVQSTCKLLLDGYVTQLYNLIKSLLD-GDRICPLIHLCSSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAP--------------------------------EIVSLIKSNV-----------------CSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTS--------------------------HSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKS--KICSHL-KSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGF---SISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMC--SMKKVSGIE 1639
            C  CK V      M    + +E   +     C+ LP   + ++CK ++D Y+  + ++IK  +     +C  ++LC  E+ Q  L     Q  L+   +   D+  V AP                                ++V+ I++ V                 C +L      IC +Y+S      + ++   + P++IC     C                              IKK     K  + C++CE  V      I   +N    K  + +  K+CS L KS+S +C  +VD Y   +++++   +  + +C  ++ C G    +++   + P   G  C+ C   V  +   +   + K  I   L+     +    + QC Q V E+  +++  ++  +D   VC  +G C  + K + G E
Sbjct:   63 CDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNLC--ESLQKHLAELNHQKQLESNKIPELDMTEVVAPFMANIPLLLYPQDGPRSKPQPKDNGDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAI-QMMMHMQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLI---DNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGTRLPALTVHVTQPKDGGF-CEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPSAHKPLLGTE 493          
BLAST of Proactivator polypeptide vs. UniProt/SwissProt
Match: sp|P26779|SAP_BOVIN (Prosaposin OS=Bos taurus OX=9913 GN=PSAP PE=1 SV=3)

HSP 1 Score: 83.9593 bits (206), Expect = 2.497e-15
Identity = 106/511 (20.74%), Postives = 191/511 (37.38%), Query Frame = 2
Query: 1292 NHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQ--CQQLVDEFFDIILNFVLSELD-VDKVCKVMGMCSM---------------------------------------------------KKVSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKI------CPRLGFVKTE-CTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSN---------------INDDSAK------CKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKPTL-CNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKN-TPISPLTVFANVCNLEDTDETNECLKHFRNLNSIVAAFHASRNIGEF-CKMTEMCKGSKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVWN 2566
             ++ + A C A+  C    +    S P  K + CD C   +T     + D A +  I  +L+ R C       +   C+++VD +  +IL+ +  ++    +VC  + +C                                                     KK +G  C+ C +++ +V +   +N      S F+E  +      C RLG   ++ C + I+ Y  V   +    +  K IC     C  + +  +  L+ +                I  D A       C++C FVV E+  L+ N   ++ I + L+  VC        ++C   ++ Y S +++I+ +   P L C+ L LC+S      +    V++        C++C+K   +L +   KN T    L      C+        +C +       ++           F C     C  + K  +G ++C WGP +WC + + AA C   AV+HC   VWN
Sbjct:   34 QNVKTAADCGAVQHC----LQTVWSKPTVKSLPCDICKDVITAAGNLLKDNATEQEILMYLE-RTCDWLPKPNMSASCKEIVDSYLPVILDMIKGQMSHPGEVCSALNLCESLQKHLAELNHQKQLESNQIPELDMAEVVAPFMANIPFLLYPQDGSHSKPQPKKANGNVCQDCIQLVTDVQEALRTN------STFVEALVDHAKEECDRLGPGMSDMCKNYINQYSEVAIQMVMH-MQPKEICVLAGFCDEVKEMPMKTLVPAEVVSENVIPALGLVEPIKKDPAPAKADIYCEVCEFVVKEVAKLIDNNRTEEEILHALDK-VCSKLPTSLAEQCQEVVDTYGSSILSILLDEASPELVCSMLHLCSSRG----LPAATVRVMPRKDGGFCEVCKKLVGYLDRNLEKNSTKEQILAALEKGCSFLPDQYRKQCDQFVTEYEPVLIEILVEVMDPSFVCLKIGACPAAHKPLLGAEKCVWGPSYWCQNMESAALC--NAVEHCRRHVWN 525          

HSP 2 Score: 60.077 bits (144), Expect = 7.603e-8
Identity = 111/544 (20.40%), Postives = 195/544 (35.85%), Query Frame = 2
Query:   86 YILFKMRFLIFGFLISVCYAFDFDCLKGPTYWCATYQNAEKCDRITECFMGQGDQKNKVDISHHKNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLL---DGDRICPLIHLCSSENTQITLGSWQCQTCL----DVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSN------------------LVPTFVNELHS----TLTPQQICGNHHVCT---SHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLK-SISSQCSSLVDAYADQLITMISNHMDSKAICIAINAC--KGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMC 1612
            Y  F +  L+ G L S       +C +G   WC   + A  C  +  C      +     +        CD C                ++ +  AGNL+ +N         ++E+     L+Y E + +  P+    +   CK         I + IK Q       C       ES+   ++    +  +ES   NQ+P       +L +   V      I  LL   DG    P        N  +      CQ C+    DV   LR +   V A  +V   K   C +L      +C +Y++                   ++  F +E+      TL P ++   + +        IKK  A  K  I C++CE  V      I       ++   +  K+CS L  S++ QC  +VD Y   +++++ +    + +C  ++ C  +G   +  +  P   G  C+ C   V  +   +   + K  I   L+     +    + QC Q V E+  +++  ++  +D   VC  +G C
Sbjct:    2 YSFFVLASLLGGALASPVLGLR-ECTRGSAVWCQNVKTAADCGAVQHCLQTVWSKPTVKSLP-------CDIC----------------KDVITAAGNLLKDNAT-------EQEI-----LMYLERTCDWLPKP--NMSASCKEIVDSYLPVILDMIKGQMSHPGEVCS-ALNLCESLQKHLAELNHQKQLES---NQIP-------ELDMAEVVAPFMANIPFLLYPQDGSHSKPQP---KKANGNV------CQDCIQLVTDVQEALRTNSTFVEA--LVDHAKEE-CDRLGPGMSDMCKNYINQYSEVAIQMVMHMQPKEICVLAGFCDEVKEMPMKTLVPAEVVSENVIPALGLVEPIKKDPAPAKADIYCEVCEFVVKEVAKLIDNNRTEEEILHAL-DKVCSKLPTSLAEQCQEVVDTYGSSILSILLDEASPELVCSMLHLCSSRGLPAATVRVMPRKDGGFCEVCKKLVGYLDRNLEKNSTKEQILAALEKGCSFLPDQYRKQCDQFVTEYEPVLIEILVEVMDPSFVCLKIGAC 483          
BLAST of Proactivator polypeptide vs. UniProt/SwissProt
Match: sp|O13035|SAP_CHICK (Prosaposin OS=Gallus gallus OX=9031 GN=PSAP PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.608e-12
Identity = 113/518 (21.81%), Postives = 197/518 (38.03%), Query Frame = 2
Query:  155 DCLKGPTYWCATYQNAEKCDRITECFMGQGDQKNKVDISHHKNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKS-QLDCKKEVNFFAPLIYRELSME-ATPEKICGLVQVC----KNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLES---------MFSKVSPDEFKFLIESLI--CNQLPSEVQSTCKLLLDGYVTQLYNLIKSLL-----DGDRICP-LIHLCSSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSK---ICSHLK-SISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIF-QSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCSMKK 1624
            DC KGP  WC + + A +C  +  C      Q+N V      N   CD C + V  V   +     ++ +       C  L  +    +CK+ V+ + P+I   +  E   PE +C  + +C    K+  AM   K   S K    D        F  L S         ++ +  P +     E +   C +L ++VQ          V      +KSL+     + DR+ P +  +C S  ++ +          D+ + +   +      +I +++             G C S  S  VP        TL P Q+    H     +++K    EK    C++CE  V      +      NK +  I  +   +C  L  S+  QC   ++ Y   LI M+    + +A+C+ +  C      Q+       G  CD C + V    + +   A  T I+  L+ ++C    +S   QC Q V+++  +++  +   +D   VC  +G+C   K
Sbjct:   25 DCAKGPEVWCQSLRTASQCGAVKHC------QQN-VWSKPAVNSIPCDLCKELVTVVGKVLKDNGTEDEIRSYLEKRCEFLPDQGLASECKEIVDSYLPVIMDMIKEEFDKPEVVCSALSLCQSLQKHLAAMKLQKQLQSNKIPELD--------FSELTSPFMANVPLLLYPQDKPKQKSKATEDVCQDCIRLVTDVQEA--------VRTNATFVKSLVAHAKEECDRLGPGMSDMCKSYISEYS----------DLAIQMMMHMKDQQPKDICAMV-------------GFCPSVKS--VPL------QTLVPAQVV---HEVKMETVEKATVQEKTFSVCEICETMVKEVTGLLES----NKTEEEIVHEMEVVCYLLPASVKDQCKDFIEVYGQALIDMLLEATNPEAVCVMLKCCAANKPPQQPVVVKPAGGFCDICKMIVAYADKELEKNATTTEIEALLE-KVCHFLPESVSDQCVQFVEQYEPVVVQLLAEMMDPTFVCTKLGVCGAAK 480          

HSP 2 Score: 71.633 bits (174), Expect = 1.564e-11
Identity = 97/458 (21.18%), Postives = 180/458 (39.30%), Query Frame = 2
Query: 1043 CGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHL--KSISSQCSSLVDAYADQLITMISNHMD-SKAICIAINACKGFS-------------------------------------ISQRKSAPNFKGIE--CDACHLAVTKIKEYISDPARKTSIKNFLKM------RICPIFQSEKIQCQQLVDEFFDIILNFVLSELDVDK--VCKVMGMC-SMK----------------KVSGIE-----------CEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL-GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK--KQECINDINQYYSLVINIITEFLKPT-LCNELRLCNSTTTSII 2170
            CG    C  +   KP  +    I CDLC+  VT     +      ++++S+++ + C  L  + ++S+C  +VD+Y   ++ MI    D  + +C A++ C+                                          Q K     K  E  C  C   VT ++E +   A  T +K+ +        R+ P        C+  + E+ D+ +  ++   D     +C ++G C S+K                K+  +E           CE+CE ++ EV  L  SN +++ + + +E  +C  L   VK +C   I+ Y   +  +     N + +C  LK C+     +  +++K         C IC  +V+     L        IE  LE  VC HF  +    +C+  + QY  +V+ ++ E + PT +C +L +C +    ++
Sbjct:   43 CGAVKHCQQNVWSKPAVNS---IPCDLCKELVTVVGKVLKDNGTEDEIRSYLEKR-CEFLPDQGLASECKEIVDSYLPVIMDMIKEEFDKPEVVCSALSLCQSLQKHLAAMKLQKQLQSNKIPELDFSELTSPFMANVPLLLYPQDKPKQKSKATEDVCQDCIRLVTDVQEAVRTNA--TFVKSLVAHAKEECDRLGPGMSD---MCKSYISEYSDLAIQMMMHMKDQQPKDICAMVGFCPSVKSVPLQTLVPAQVVHEVKMETVEKATVQEKTFSVCEICETMVKEVTGLLESNKTEEEIVHEMEV-VCYLLPASVKDQCKDFIEVYGQALIDMLLEATNPEAVCVMLKCCAANKPPQQPVVVKPA----GGFCDICKMIVAYADKELEKNATTTEIEALLEK-VC-HFLPESVSDQCVQFVEQYEPVVVQLLAEMMDPTFVCTKLGVCGAAKKPLL 484          
BLAST of Proactivator polypeptide vs. UniProt/SwissProt
Match: sp|Q6NUJ1|SAPL1_HUMAN (Proactivator polypeptide-like 1 OS=Homo sapiens OX=9606 GN=PSAPL1 PE=2 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 4.710e-12
Identity = 113/530 (21.32%), Postives = 206/530 (38.87%), Query Frame = 2
Query: 1043 CGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKS--ISSQCSSLVDAYADQLITMISNHMDSKA--ICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFL---KMRICPIFQSEKIQCQQLVDEFFD----IILNFVLSELDVDKVCKVMGMCSMKKVSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRLGFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKPTLCNELRLCNSTTTSIIMSQ-----PLVKMSRAILSSNCQLCEKFY-FHLQKIFLKNTPISPLTVFANVCNLEDTDETNECLKHF--RNLNSIVAAFHASRNIGEFCKMTEMCKGSKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVWNQM 2572
            CG    C      KP A     + CD+C+     A + ++     + + + +  K C  L S   S+ C  +VDA++  +++M+    DS    +C A++ C+     QR              HLA  +    +S      ++  F+    +   P    E   CQ  V +       +  N  L++L++ + C+ +G        G+   +C+  +       F   + Q +      ++C + GF +          L     L +      V   EL L     +K+  + MK+ +      C++C  VV +L   L +   +  I + LE  VC    A   +ECI  ++ Y   ++ ++ +     +C  +RLC +   +  +       P  +       S C  C++        +  K+T    L  F   C++       +C KHF  +    ++ +     +    CK    C G +   +G  QC+ GP FWC S++ A  C   AV+HC+  VW +M
Sbjct:   43 CGAVGYCQGAVWNKPTAKS---LPCDVCQDIAAAAGNGLNPDATESDILALVM-KTCEWLPSQESSAGCKWMVDAHSSAILSMLRGAPDSAPAQVCTALSLCEPL---QR--------------HLATLR---PLSKEDTFEAVAPFMANGPLTFHPRQAPEGALCQDCVRQVSRLQEAVRSNLTLADLNIQEQCESLG-------PGLAV-LCKNYL-----FQFFVPADQALRLLPPQELCRKGGFCEE---------LGAPARLTQVVAMDGVPSLELGL----PRKQSEMQMKAGVT-----CEVCMNVVQKLDHWLMSNSSELMITHALER-VCSVMPASITKECIILVDTYSPSLVQLVAKITPEKVCKFIRLCGNRRRARAVHDAYAIVPSPEWDAENQGSFCNGCKRLLTVSSHNLESKSTKRDILVAFKGGCSILPLPYMIQC-KHFVTQYEPVLIESLKDMMDPVAVCKKVGACHGPRTPLLGTDQCALGPSFWCRSQEAAKLC--NAVQHCQKHVWKEM 513          
BLAST of Proactivator polypeptide vs. UniProt/SwissProt
Match: sp|Q8C1C1|SAPL1_MOUSE (Proactivator polypeptide-like 1 OS=Mus musculus OX=10090 GN=Psapl1 PE=1 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 6.291e-12
Identity = 108/523 (20.65%), Postives = 197/523 (37.67%), Query Frame = 2
Query: 1061 CTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKS--ISSQCSSLVDAYADQLITMISN--HMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQ------CQQLVDEFFDII-LNFVLSELDVDKVCKVMGMCSMKKVSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRLGFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLEN--HVCPHFGAKKQECINDINQYYSLVINIITEFLKPTLCNELRLCNS-----TTTSIIMSQPLVKMSRAILSSNCQLCEKFY-FHLQKIFLKNTPISPLTVFANVCNLEDTDETNECLKHFRNLNSI-VAAFHASRNIGEFCKMTEMCKGSKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVWNQ 2569
            C S    KP       + C +C+     A + ++     + + + +  K C  L S   S++C  +V+ ++  +++M+S     D  ++C A+  C+     QR              HLA T  +  ++       +  FL         S+  +      C QL+    D +  N  L+E+ V   C+ MG        G+   +CE  +      A     +Q +      ++C + GF + E              L R      V   E+++      +   L M+  +      C +C  +V EL   L     +  I + LE    V P      Q+CI  ++ Y   ++ ++++     +C  ++LC S     + +  + + P + +      S CQ C++      Q +  K+T    L  F   C +       +C +       + + +     N  + CK    C G K   +G  QC  GP FWC S + A  C   A++HC+  VW +
Sbjct:   49 CQSAVWNKPTVKS---LPCSVCQDVAAAAGNGVNPGATESDILTSVM-KTCEWLPSQESSAKCKWMVNNHSAAVLSMLSGAQETDLASVCTALTLCEPL---QR--------------HLAETTSERPLTQEDANEVMAPFLSNGALSFHPSQMPEGAVCHDCVQLISLLQDALESNLTLAEVTVQNQCQSMG-------PGLA-ALCENYIHRQFVPA-----KQTLQGLPPQEVCRKGGFCERESAHW----------LTRVAAVDGVPSLEMEM-----PRTNELQMQLGLT-----CDVCLNLVQELDKWLVTNSTEALISHTLERVCTVVPE--PLVQQCITLVDTYSPELVQLMSKVTPEKVCETIKLCGSKRRARSISRAVATTPSLPVDEENQGSFCQGCKRLLGMSSQNLDHKSTKRDILNAFKGGCRILPLPYVMQCNRFVAEYEPVLIESLKFMMNPTDLCKKMGACHGPKTPLLGTDQCVMGPSFWCKSPEAAEMC--NALEHCQRLVWKK 513          
BLAST of Proactivator polypeptide vs. TrEMBL
Match: A0A2R5L700 (Putative prosaposin OS=Ornithodoros turicata OX=34597 PE=4 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.574e-44
Identity = 189/814 (23.22%), Postives = 348/814 (42.75%), Query Frame = 2
Query:  293 CDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKF----QNDDVCTKCKQVFQFLESMFSK-VSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTS--HSIKKPIASEKGV----IECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHL-KSISSQCSSLVDAYADQLITMISNHMDSKAICIAINAC--KGFSISQRKS--APNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCS----------MKKVS---GIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKIC---PRLGFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKIC----HFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKPTL-CNELRLCNSTTTSIIMSQPLVKMSRAILS---SNCQLCEKFYFHLQKIFLKNTPISP--LTVFANVCNLEDTDETNECLKHFRNLNSIVAAFHA--SRNIGEF------CKMTEMCKGSKK----HHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVWNQ 2569
            C+ C+  V+ V+A +    ++  V  A    C  +       C + V+ +   +   L  E  P  +CGL+ +C    + S  +   +I      Q+   C  CK V +F E+   + V+ D  +++++ L CNQ   +    CK L+D  +  +   +   +    IC L  +C +        S  C  C +++ V+   L  V   E ++     VC+ +    +  C   V+      V+ +   LTP Q+C     C +   +I KP ASEK       EC LC+       + +   +   ++K  ++ ++C  + KS   +C +++  Y D L+++I        +C A+  C   G  + +  S  +P  +G EC  C   V  +   + D   +  +K  L+     + QS + +C  +V+ +FD++++ +L +   D+VC+ +G+C           ++K+S     EC +C+ V+  +      N ++Q +   + +++C   P+    K EC +++ TY  ++ SL         IC  L LC   S   +              C  C    HF+ +EL+   T   I++++     + +C     +  +EC   + +Y + VI ++ + L P++ C  +R C            LVK S A+ +     C  C          F ++T       +VF  VC         EC        S+V A+     RNIG+       C+  +MC  +++    H +G K+C++GP +WC S  HA+ C   A ++C+ KVW Q
Sbjct:  414 CELCIYLVKYVDAVLENKRDEAAVTHALEEACKLVPPHMHDRCVQLVDKYVDELIHILVEEDDPNLVCGLLGLCTGQTSTSSVQSHTAITAEKNPQDSIECEVCKAVIEFFENNLPEVVTKDVVEYVLDEL-CNQFSGDKAQECKNLVDKNIELILKYLTGEVAATAICRLAQMCEAPQVATKGVSPDCVVCKELVQVVYDQLKDVRTEEAIAKELERVCNLVPSSSRRTCVDIVNTYFEALVSLILQELTPDQVCSALKFCGAPGKAILKP-ASEKSPKHEDPECTLCKQVFQLVYNELKDNKTQEEIKQVLE-EVCDLVPKSSRQECVNMISNYFDLLVSLILQDFTPDEVCKALGICPPSGKVVPKPASTKSPKVEGSECTLCMDVVQFVYNELKDTKTEEEVKRVLEEVCTLVPQSSRQECVNMVNTYFDLLVSLILQDFTPDEVCQTLGLCPSSVKVVTKPKIQKISKDDNPECTLCKDVVQFIYAELKDNKTEQAIKEVL-DEVCNWVPQSS--KQECLNMVSTYFDLLVSLILQDFTPDQICQTLTLCPSSSHGDV-------------VCTFCQYALHFIQTELMDNKTEEKIKEAL-----DQLCARLPKEISEECQAFVEEYGAAVIVLLAQELDPSIVCVAVRACPKGG--------LVKQSMALHNLYFDKCDTC-SLVIGWADRFTQDTKTDEELASVFERVCKAVPAGVKQEC-------QSLVKAYGPFILRNIGQLGNSRQVCQAIDMCPKAQRAKSAHLLGSKKCTFGPAYWCHSEAHASAC--NAHEYCKKKVWKQ 1185          

HSP 2 Score: 85.8853 bits (211), Expect = 3.917e-13
Identity = 78/371 (21.02%), Postives = 149/371 (40.16%), Query Frame = 2
Query:  281 NGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVI--ECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKS-ISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKG 1384
             G  C  CM  VQ V   +     +E V      +C  +   S+ +C   VN +  L+   +  + TP+++C  + +C ++  +        I   ++  CT CK V QF+ +       ++    +   +CN +P   +  C  ++  Y   L +LI      D+IC  + LC S +     G   C  C   +  ++ +L      E +      +C++L       C ++V       +  L   L P  +C     C    + K   +   +   +CD C + +  A  F    +   ++ S  + ++C  + + +  +C SLV AY   ++  I    +S+ +C AI+ C     +QR  + +  G
Sbjct:  789 EGSECTLCMDVVQFVYNELKDTKTEEEVKRVLEEVCTLVPQSSRQECVNMVNTYFDLLVSLILQDFTPDEVCQTLGLCPSSVKVVTKPKIQKISKDDNPECTLCKDVVQFIYAELKDNKTEQAIKEVLDEVCNWVPQSSKQECLNMVSTYFDLLVSLILQDFTPDQICQTLTLCPSSSH----GDVVCTFCQYALHFIQTELMDNKTEEKIKEALDQLCARLPKEISEECQAFVEEYGAAVIVLLAQELDPSIVCVAVRACPKGGLVKQSMALHNLYFDKCDTCSLVIGWADRFTQDTKTDEELASVFE-RVCKAVPAGVKQECQSLVKAYGPFILRNIGQLGNSRQVCQAIDMCPK---AQRAKSAHLLG 1151          

HSP 3 Score: 70.4774 bits (171), Expect = 1.775e-8
Identity = 110/538 (20.45%), Postives = 208/538 (38.66%), Query Frame = 2
Query:  965 ICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKK-------------------PIAS--EKGVIECDLCEIGVTGAKSFISK-PENMNKVKSFIKSKIC-SHLKSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKG---IECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMC--SMKKVSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRLGFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENH---VCPHFGAKKQECINDINQYYSLVINIITEFLKPTL-CNELRLCNS-TTTSIIMSQPLVKMSRAILSS-NCQLC----EKFYFHLQKIFLKNTPISPLTVFANVCNLEDTDETNECLKHF-RNLNSIVAAFHASRNIGEFCKMTEMCKGSKKHHVG 2461
            +C   V   +P  ++ L S + P Q+C    +C  +  ++                   P+ S   +   EC  C   +  AK+ I   PE   ++ +    K+C  H K   ++C  +V  Y   +         ++  C+ I  C   S + + + P  KG   + CD C   V  ++ ++     +  +K  + +  C    S   +CQ L+DE+FD+   ++L  L+ ++ C  +G+C  S+ +V  +                               K+ P +   K     L        +    S+ +S  I   +KL   I  K     +K +      +C++C ++V  +  +L N   + ++ + LE     V PH   +   C+  +++Y   +I+I+ E   P L C  L LC   T+TS + S   +   +    S  C++C    E F  +L ++  K+       V   +CN    D+  EC     +N+  I+            C++ +MC+  +    G
Sbjct:  113 MCIRMVDEFIPDLIDMLVSRMDPDQVCTIAGLCNPNFFRQLRMQQNLIFSAFQSRIFLPPLTSTASRRTGECSRCLNTLQPAKAIIRLLPEAQVELLAL---KMCQDHHKDNLTECPLIVKKYFSPVYDYFYETAANQT-CVDIRRCPP-SETLKPNVPLVKGDDDLTCDFCKQLVGSLRNFLEANTTQDELKQAI-LAFCEDLGSAAEECQNLLDEYFDMFYTYLLEALEPERFCSTIGLCQTSLLRVPLV-------------------------------KLFPAVPATKVHLQKL-------QYPKKASSAHSPDITPLVKLMPGIPVK----YLKKDEPKKQVECELCIYLVKYVDAVLENKRDEAAVTHALEEACKLVPPHMHDR---CVQLVDKYVDELIHILVEEDDPNLVCGLLGLCTGQTSTSSVQSHTAITAEKNPQDSIECEVCKAVIEFFENNLPEVVTKDV---VEYVLDELCNQFSGDKAQECKNLVDKNIELILKYLTGEVAATAICRLAQMCEAPQVATKG 596          
BLAST of Proactivator polypeptide vs. TrEMBL
Match: K1QNB6 (Proactivator polypeptide OS=Crassostrea gigas OX=29159 GN=CGI_10021835 PE=4 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 4.958e-44
Identity = 186/850 (21.88%), Postives = 362/850 (42.59%), Query Frame = 2
Query:  254 NKVDISHHKNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKF----------QNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITL-----GSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGI-CNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTS---------HSIK---------KPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKS-ISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMC--SMKKVS---GIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL-GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINL-----------LMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAKKQECINDINQYYSLVINIITEFLKPTLCNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKNTPISPL-TVFANVCNLEDTDETNECLKHFRNLNSIVAA-FHASRNIGEFCKMTEMCKG----------------------------SKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMK 2557
            NK  I   +  D C   M  V+ ++   P   E+    +  +L C  L G     CK  V+ +A +++  ++ E  P  +C ++  CK T  ++   I   I+           +  ++C  C+ V   L+SM  K S  +      + +C +LP++    C   +  Y   + +LI   LD   +C ++ LC+SE+ ++ +      + +C  C  ++  +   L G    E +     +VC +L+  +    C+++V       ++ L S + P+++C    +CT+         H +K           + S    +EC +CE  ++   + + +  +   +++ +K  +CS L S IS +C+  V+ YAD +I ++    D K +C A+N C+  + ++   A     +EC  C   ++++   + +   + +I+N LKM    +  +   +C   V+++ D+++N ++ E D   VCK + +C  S K  S    +EC +CE +M EV  +   N S++ + N ++  +C +L   +  ECT  ++ Y  ++ +L     + K +C  L LCS   QKK N+           +    + D+  KC++C  +++ L   L      +++E  L + VC                           FL PT   E R+  ++  S+ +               C++CE    +L +   +N  +  +  +   VCN+  T    EC         ++A  F    +  + C+  ++C                              S++  +GKK+C++GP +WC S ++A  C   A +HC  K
Sbjct:  318 NKAKIGGVEECDLCKEVMSKVRDMDRD-PTNQEKIKAYIKTDL-CEKL-GSIADQCKTAVDEYADILFELIANELDPTTVCTMLGFCKTTYYVAAKPILPGIQLKPKVNVQEKPKAGELCDLCQMVINELDSMILKNSTTQEVEKALNSVCKRLPAKYSDDCSDFVKQYAPAILDLIGQELDPLTVCTVLKLCTSESKKLVIQKPVESTTECVLCEMIMKEVDTILQGSKVKEEIESALKSVCDRLSTGDLAKECSNFVMQYTEILIDLLKS-MPPKEVCSKLGLCTADKAPAKQQLHHVKLVSDKHNSVSHLHSVDASVECVVCEYIMSEVDNILKENRSREAIENALKM-VCSKLPSTISQECTDFVNQYADLVINLLIQEGDPKTVCKALNLCQASAKAKSVDA----SVECVLCEYIMSEVDNILKENRSREAIENALKMVCSKLPATISQECTDFVNQYADLVINLLIQEGDPKTVCKALNLCQASAKAKSVDASVECVLCEYIMSEVDNILKENRSREAIENALK-MVCSKLPATISQECTDFVNQYADLVINLLIQEGDPKTVCKALNLCS-SKQKKTNINSIRFLPIPGQVASLRLGDE--KCEVCEVILNYLDEALKENKTVQAVEALL-DQVC--------------------------NFL-PTTFKEERIFLTSVASLRLG-----------DEKCEVCEVILNYLDEALKENKTVQAVEALLDQVCNILPTTFKEECDTIVAQYGPVIAQLFSQLLDPKKICQEIKLCPSKYGVKQSLINHLMKKTKPAPKDTRLFFKSRQQKLGKKECTYGPSYWCASLKNAQKC--QAEEHCRTK 1113          

HSP 2 Score: 161.77 bits (408), Expect = 1.155e-36
Identity = 134/513 (26.12%), Postives = 237/513 (46.20%), Query Frame = 2
Query:  905 EIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASE---------------KGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACK-GFSISQRKSAPNFK-------------GIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSE-KIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCS--MKKV-------SGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL--GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCS--------------LISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKP-TLCNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKN 2272
            +I  ++K+ +C++L   E+G+C+  V  LVP  +  L S + PQ  C     C   +I K + +                 GV ECDLC+  ++  +     P N  K+K++IK+ +C  L SI+ QC + VD YAD L  +I+N +D   +C  +  CK  + ++ +   P  +             G  CD C + + ++   I   +    ++  L   +C    ++    C   V ++   IL+ +  ELD   VC V+ +C+   KK+       S  EC +CE +M EV  +   +  ++ + + +++ +C RL  G +  EC++ +  Y  ++  L +S +  K +C++L LC+              L+S K  N +   +  D S +C +C +++SE+  +L     +++IEN L+  VC    +   QEC + +NQY  LVIN++ +   P T+C  L LC ++           K      S  C LCE     +  I  +N
Sbjct:  244 QIKDMLKNVLCTQLPS-EEGLCDFIVDELVPQLLQTLGSEVDPQVFCNMMGFCNGTNINKALVTRIQYRTELKKLNKAKIGGVEECDLCKEVMSKVRDMDRDPTNQEKIKAYIKTDLCEKLGSIADQCKTAVDEYADILFELIANELDPTTVCTMLGFCKTTYYVAAKPILPGIQLKPKVNVQEKPKAGELCDLCQMVINELDSMILKNSTTQEVEKALN-SVCKRLPAKYSDDCSDFVKQYAPAILDLIGQELDPLTVCTVLKLCTSESKKLVIQKPVESTTECVLCEMIMKEVDTILQGSKVKEEIESALKS-VCDRLSTGDLAKECSNFVMQYTEILIDLLKS-MPPKEVCSKLGLCTADKAPAKQQLHHVKLVSDKH-NSVSHLHSVDASVECVVCEYIMSEVDNILKENRSREAIENALK-MVCSKLPSTISQECTDFVNQYADLVINLLIQEGDPKTVCKALNLCQAS----------AKAKSVDASVECVLCEYIMSEVDNILKEN 740          

HSP 3 Score: 160.999 bits (406), Expect = 1.847e-36
Identity = 182/828 (21.98%), Postives = 318/828 (38.41%), Query Frame = 2
Query:  155 DCLKGPTYWCATYQNAEKCDRITECFMGQGDQKNKVDISHHKNGDYCDACMKFVQSVEAHIPKISEQ----EFVNLAGNLI--------CNNLKGKSQL------------------------DCKKEVNF----------------FAPLIYRELSMEATPEKICGLVQVCKN--TNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSP-DEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITL-------------------GSWQCQTCLDVIVVLRK-DLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVC--TSHSIKKPI-------------ASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKS-ISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKI--QCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCSMKKV--------------------------SGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL-GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKP-TLCNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKN 2272
            +C  GP+YWC+  +NA+ C  +  C        +K  I        CD C   V+     +   S      EF  +A   +        C+ L  +S+L                        D    V F                  P   + ++   + E++C  V+ CK        + K    +  +   +C  C   F  ++ +    S  D+ K ++++++C QLPSE +  C  ++D  V QL   + S +D    C ++  C+  N    L                   G  +C  C +V+  +R  D    +  +I + IK+++C KL       C + V          + + L P  +C     C  T +   KPI                K    CDLC++ +    S I K     +V+  + S +C  L +  S  CS  V  YA  ++ +I   +D   +C  +  C   S       P     EC  C + + ++   +     K  I++ LK  +C    +  +  +C   V ++ +I+++  L  +   +VC  +G+C+  K                           + +EC VCE +M EV  +   N S++ + N ++  +C +L   +  ECT  ++ Y  ++ +L     + K +C  L LC   +        K+   D S +C +C +++SE+  +L     +++IEN L+  VC    A   QEC + +NQY  LVIN++ +   P T+C  L LC ++           K      S  C LCE     +  I  +N
Sbjct:   29 ECSWGPSYWCSHARNAKACGAVQHCL---DTVWSKQIIKEESQPASCDLCKMVVKETRKMLKSKSRDIKIVEFFTMACQFLPDESLKKECSVLATESELLIKLLKSNIVSKVLSLSFRSLASFDTGSHVRFKSHVTKQTKWPLKTGMLKPRDLKTVAAGRSDEQLCAAVKQCKGFEDKTHQYPKEVPKVSGKVTKICKDCVAFFGDIKQLIQDNSTIDQIKDMLKNVLCTQLPSE-EGLCDFIVDELVPQLLQTLGSEVDPQVFCNMMGFCNGTNINKALVTRIQYRTELKKLNKAKIGGVEECDLCKEVMSKVRDMDRDPTNQEKIKAYIKTDLCEKLGSIADQ-CKTAVDEYADILFELIANELDPTTVCTMLGFCKTTYYVAAKPILPGIQLKPKVNVQEKPKAGELCDLCQMVINELDSMILKNSTTQEVEKALNS-VCKRLPAKYSDDCSDFVKQYAPAILDLIGQELDPLTVCTVLKLCTSESKKLVIQKPVESTTECVLCEMIMKEVDTILQGSKVKEEIESALK-SVCDRLSTGDLAKECSNFVMQYTEILIDL-LKSMPPKEVCSKLGLCTADKAPAKQQLHHVKLVSDKHNSVSHLHSVDASVECVVCEYIMSEVDNILKENRSREAIENALK-MVCSKLPSTISQECTDFVNQYADLVINLLIQEGDPKTVCKALNLCQASA--------KAKSVDASVECVLCEYIMSEVDNILKENRSREAIENALK-MVCSKLPATISQECTDFVNQYADLVINLLIQEGDPKTVCKALNLCQAS----------AKAKSVDASVECVLCEYIMSEVDNILKEN 828          

HSP 4 Score: 141.354 bits (355), Expect = 2.787e-30
Identity = 148/684 (21.64%), Postives = 295/684 (43.13%), Query Frame = 2
Query:  251 KNKVDISHH-KNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMF--SKVSPDEFKFLIESLICNQLPS-EVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENT-------QITL---------------GSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHL-KSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCSMK---------------------KVSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRLGFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKP-TLCNELRLCNS 2152
            K KV++    K G+ CD C   +  +++ I K S  + V  A N +C  L  K   DC   V  +AP I   +  E  P  +C ++++C + +     K+      ++   C  C+ + + ++++   SKV  +E +  ++S +C++L + ++   C   +  Y   L +L+KS+     +C  + LC+++          + L                S +C  C  ++  +   L    + E +      VCSKL       C  +V+      +N L     P+ +C   ++C + +  K + +    +EC LCE  ++   + + +  +   +++ +K  +CS L  +IS +C+  V+ YAD +I ++    D K +C A+N C+  + ++   A     +EC  C   ++++   + +   + +I+N LKM    +  +   +C   V+++ D+++N ++ E D   VCK + +CS K                     ++   +CEVCE +++ + +    N + Q V   + +++C                +LP  F   R  L S    A L+L                      KC++C  +++ L   L      +++E  L + VC       K+EC   + QY  ++  + ++ L P  +C E++LC S
Sbjct:  419 KPKVNVQEKPKAGELCDLCQMVINELDSMILKNSTTQEVEKALNSVCKRLPAKYSDDCSDFVKQYAPAILDLIGQELDPLTVCTVLKLCTSES----KKLVIQKPVESTTECVLCEMIMKEVDTILQGSKVK-EEIESALKS-VCDRLSTGDLAKECSNFVMQYTEILIDLLKSM-PPKEVCSKLGLCTADKAPAKQQLHHVKLVSDKHNSVSHLHSVDASVECVVCEYIMSEVDNILKENRSREAIENALKMVCSKLPSTISQECTDFVNQYADLVINLLIQEGDPKTVCKALNLCQASAKAKSVDAS---VECVLCEYIMSEVDNILKENRSREAIENALKM-VCSKLPATISQECTDFVNQYADLVINLLIQEGDPKTVCKALNLCQASAKAKSVDA----SVECVLCEYIMSEVDNILKENRSREAIENALKMVCSKLPATISQECTDFVNQYADLVINLLIQEGDPKTVCKALNLCSSKQKKTNINSIRFLPIPGQVASLRLGDEKCEVCEVILNYLDEALKENKTVQAVEALL-DQVC---------------NFLPTTFKEERIFLTS---VASLRL-------------------GDEKCEVCEVILNYLDEALKENKTVQAVEALL-DQVCNILPTTFKEECDTIVAQYGPVIAQLFSQLLDPKKICQEIKLCPS 1048          

HSP 5 Score: 120.553 bits (301), Expect = 7.807e-24
Identity = 109/444 (24.55%), Postives = 186/444 (41.89%), Query Frame = 2
Query: 1274 LITMISNHMDSKAICIAINACKGFSISQR---KSAPNFKGIE---CDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMC----------------------SMKKVSGI-ECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRLGFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCS---LISQKK----INLLMKSNINDDSAK---CKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKP-TLCNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKNTPISPL-TVFANVCN-LEDTDETNECLKHFRNLNSIVAAFHASRNIGEFCKMTEMCKGSKK------HHV 2458
            L T+ +   D + +C A+  CKGF        K  P   G     C  C      IK+ I D +    IK+ LK  +C    SE+  C  +VDE    +L  + SE+D    C +MG C                      +  K+ G+ EC++C+ VM +V  +     +Q+ +  +I+  +C +LG +  +C + +D Y  ++F L  + L+   +C  L  C     ++ K     I L  K N+ +       C +C  V++EL +++      + +E  L N VC    AK   +C + + QY   ++++I + L P T+C  L+LC S +  +++ +P+        ++ C LCE     +  I   +     + +   +VC+ L   D   EC         I+     S    E C    +C   K       HHV
Sbjct:  178 LKTVAAGRSDEQ-LCAAVKQCKGFEDKTHQYPKEVPKVSGKVTKICKDCVAFFGDIKQLIQDNSTIDQIKDMLKNVLCTQLPSEEGLCDFIVDELVPQLLQTLGSEVDPQVFCNMMGFCNGTNINKALVTRIQYRTELKKLNKAKIGGVEECDLCKEVMSKVRDMDRDPTNQEKIKAYIKTDLCEKLGSIADQCKTAVDEYADILFELIANELDPTTVCTMLGFCKTTYYVAAKPILPGIQLKPKVNVQEKPKAGELCDLCQMVINELDSMILKNSTTQEVEKAL-NSVCKRLPAKYSDDCSDFVKQYAPAILDLIGQELDPLTVCTVLKLCTSESKKLVIQKPVES------TTECVLCEMIMKEVDTILQGSKVKEEIESALKSVCDRLSTGDLAKECSNFVMQYTEILIDLLKSMPPKEVCSKLGLCTADKAPAKQQLHHV 613          
BLAST of Proactivator polypeptide vs. TrEMBL
Match: A0A2G8K9Z3 (Uncharacterized protein OS=Stichopus japonicus OX=307972 GN=BSL78_18317 PE=4 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 6.777e-44
Identity = 167/710 (23.52%), Postives = 288/710 (40.56%), Query Frame = 2
Query:  281 NGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCS--SENTQI-TLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHL-KSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKG-------------FSISQRKSAP-NFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKI-QCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCSMKKVSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL-GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAKKQECINDINQYYSLVINIITEFLKPTL-CNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKNTPISPL-TVFANVCNLEDTDETNEC 2344
            NGD C  C  F Q V   +   S Q+ +     ++CN L       C++ V  + PL++  L     P  ICG +  C   ++     +       N D CT CK  FQ + +M    S  +        +CN L   +   C+  +  Y   ++N +   LD   IC  I  C   SE T++  L + QC  C +    +   L   S  +++     N+C+ L       C  YVS      +N L   L   Q                         C  C+       + ++ P    ++   +++ +C+ L  SI  QC   V  Y   +I  +  ++D  ++C  I  C G               +S     P   +G  C+ C L V++I+ Y+ D A +  I   L+ + C I  S    QC   +D++  ++L  +  E+D D+VC  + +C+ +     +C +CE VM ++  +     +   +   +E K+C  L G +  +C   +D Y P I +L    ++ ++IC  L LC   S+ +            S KC +C +V+ +L T+++       IE  LE       G+   +C   ++QY   +IN+I + + P L C  L LC +++ S +  Q         L   C LC+     ++ +  K + IS +      VC+L     + +C
Sbjct:  899 NGDQCTDCKNFFQDVATLLKNSSVQQMILQEIGMLCNELGPSIGPQCQQYVTEYGPLVFNMLLQYLDPTAICGDIGFCTAVSSPPPLHL-------NGDQCTDCKNFFQDVSTMLKNTSTQQMILQELETLCNNLGPSIGPQCQQYVSEYGPLVFNFLLQYLDPTAICGDIGFCPAMSEPTKLFQLNADQCTDCKNFFQDVSTILNNPSTQQMIIEDIENLCNSLGPSLGPQCQQYVSEYGSLVINFLLQYLNADQ-------------------------CTDCKNFFQDVVTILNNPSTQQQILQELET-LCNDLGPSIGPQCQQYVSEYGPLVINFLLQYLDPASVCSQIGFCSGMNEVISFVELQSALPVSPMNEEPLEEEGAGCEVCKLVVSQIEVYLKDGATEEEITAALE-KFCSILPSSLANQCTAFMDQYGPVVLKLLADEMDPDQVCSFLKLCAAEFQQSPKCTLCEYVMQKLETMISKQSTVAEIEAALE-KVCSLLPGSISDQCQQFVDQYTPTIINLIVQNVSPQLICRTLGLCKASSESEFQ---------QSPKCTLCEYVIQKLETMISKQSTVAEIEAALEKVCSLLPGSISDQCQQFVDQYTPTIINLIVQNVSPQLICRTLGLCKASSESDVHEQ---------LGPTCVLCQYVMKEVESLLAKESTISDIEAALDKVCSLMPGTLSQQC 1555          

HSP 2 Score: 167.548 bits (423), Expect = 2.394e-38
Identity = 152/656 (23.17%), Postives = 286/656 (43.60%), Query Frame = 2
Query:  275 HKNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMS-FSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESL--ICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITLGSWQCQTC----LDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCT-----------------SHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHL-KSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQ-SEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCSMKKVSGIE----CEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL-GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAKKQECINDINQYYSLVINIITEFLKPTL-CNELRLC 2146
            H NGD C  C  F Q V   +   S Q+ +      +CNNL       C++ V+ + PL++  L     P  ICG +  C    AMS  +K+F      N D CT CK  FQ + ++ +  +P   + +IE +  +CN L   +   C+  +  Y + + N +   L+ D                     QC  C     DV+ +L       +  +I+  +++ +C+ L       C  YVS   P  +N L   L P  +C     C+                 S   ++P+  E     C++C++ V+  + ++       ++ + ++ K CS L  S+++QC++ +D Y   ++ ++++ MD   +C  +  C     ++ + +P     +C  C   + K++  IS  +    I+  L+ ++C +   S   QCQQ VD++   I+N ++  +    +C+ +G+C     S  +    C +CE V+ ++  +     +   +   +E K+C  L G +  +C   +D Y P I +L    ++ ++IC  L LC   S+  ++  +          C +C +V+ E+ +LL        IE  L+       G   Q+C   ++ Y   ++N++ +++ P L C  LRLC
Sbjct:  986 HLNGDQCTDCKNFFQDVSTMLKNTSTQQMILQELETLCNNLGPSIGPQCQQYVSEYGPLVFNFLLQYLDPTAICGDIGFCP---AMSEPTKLFQL----NADQCTDCKNFFQDVSTILN--NPSTQQMIIEDIENLCNSLGPSLGPQCQQYVSEYGSLVINFLLQYLNAD---------------------QCTDCKNFFQDVVTILNNP---STQQQILQELET-LCNDLGPSIGPQCQQYVSEYGPLVINFLLQYLDPASVCSQIGFCSGMNEVISFVELQSALPVSPMNEEPLEEEGA--GCEVCKLVVSQIEVYLKDGATEEEITAALE-KFCSILPSSLANQCTAFMDQYGPVVLKLLADEMDPDQVCSFLKLCA----AEFQQSP-----KCTLCEYVMQKLETMISKQSTVAEIEAALE-KVCSLLPGSISDQCQQFVDQYTPTIINLIVQNVSPQLICRTLGLCKASSESEFQQSPKCTLCEYVIQKLETMISKQSTVAEIEAALE-KVCSLLPGSISDQCQQFVDQYTPTIINLIVQNVSPQLICRTLGLCKASSESDVHEQL-------GPTCVLCQYVMKEVESLLAKESTISDIEAALDKVCSLMPGTLSQQCQQFVDTYTPTIVNLLVQYVPPRLVCVVLRLC 1586          

HSP 3 Score: 163.696 bits (413), Expect = 3.717e-37
Identity = 170/763 (22.28%), Postives = 299/763 (39.19%), Query Frame = 2
Query:  284 GDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCS--SENTQITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCS-MKKV----------------------SGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL-GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAKKQECINDINQYYSLVINIITEFLKPTL-CNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKNTPISPL-TVFANVCNLEDTDETNECLKHFRNLN-SIVAAFHASRNIGEFCKMTEMCKGSKKHHVGKKQCSWGP 2485
             D C  C  F Q V   +   S Q+ +  A   +CN+L       C++ V+ + PL    L     P  ICG +  C      +  K   S+   N D CT CK  FQ + ++    S  +       ++CN+L   +   C+  +  Y   ++N++   LD   IC  I  C+  S    + L   QC  C +    +   L   S  +++      +C+ L       C  YVS   P   N L   L P  ICG+   C + S    +  +    +C  C+       + ++ P     +   I++   S   S+  QC   V  Y   +I  +  ++++                           +C  C      +   +++P+ +  I   L+     +  S   QCQQ V E+  +++NF+L  LD   VC  +G CS M +V                       G  CEVC+ V+ ++        +++ ++  +E K C  L   +  +CT+ +D Y PV+  L    ++   +C+ LKLC+   Q+             S KC +C +V+ +L T+++       IE  LE       G+   +C   ++QY   +IN+I + + P L C  L LC +++ S     P            C LCE     L+ +  K + ++ +      VC+L     +++C +       +I+     + +    C+   +CK S +  V ++    GP
Sbjct:  809 ADQCADCKNFFQDVVTILNNPSTQQQILQAIETLCNDLGPSIGPQCQQYVSEYGPLAINFLLQYLDPNMICGEIGFCA-----ALPKQSMSLPSLNGDQCTDCKNFFQDVATLLKNSSVQQMILQEIGMLCNELGPSIGPQCQQYVTEYGPLVFNMLLQYLDPTAICGDIGFCTAVSSPPPLHLNGDQCTDCKNFFQDVSTMLKNTSTQQMILQELETLCNNLGPSIGPQCQQYVSEYGPLVFNFLLQYLDPTAICGDIGFCPAMSEPTKLF-QLNADQCTDCKNFFQDVSTILNNPSTQQMIIEDIENLCNSLGPSLGPQCQQYVSEYGSLVINFLLQYLNAD--------------------------QCTDCKNFFQDVVTILNNPSTQQQILQELETLCNDLGPSIGPQCQQYVSEYGPLVINFLLQYLDPASVCSQIGFCSGMNEVISFVELQSALPVSPMNEEPLEEEGAGCEVCKLVVSQIEVYLKDGATEEEITAALE-KFCSILPSSLANQCTAFMDQYGPVVLKLLADEMDPDQVCSFLKLCAAEFQQ-------------SPKCTLCEYVMQKLETMISKQSTVAEIEAALEKVCSLLPGSISDQCQQFVDQYTPTIINLIVQNVSPQLICRTLGLCKASSESEFQQSP-----------KCTLCEYVIQKLETMISKQSTVAEIEAALEKVCSLLPGSISDQCQQFVDQYTPTIINLIVQNVSPQLICRTLGLCKASSESDVHEQ---LGP 1511          

HSP 4 Score: 150.214 bits (378), Expect = 6.252e-33
Identity = 170/792 (21.46%), Postives = 316/792 (39.90%), Query Frame = 2
Query:  269 SHHKNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSP-DEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLC---SSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFS----ISQRKSAPNFK------GIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSE-KIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCS-----MKKVSGIECEVCERVMD-EVIQLAFSNHSQQVVSNFIENKICPRL-GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKPT-LCNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKNTPISPLTVFANVCNLEDTDETNECLKHFRNL-NSIVAAFHASRNIGEFCKMTEMC-KGSKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVWN 2566
            +  +    C  C   +Q +E  I K S    +  A   +C+ L G     C++ V+ + P I   +    +P+ IC  + +CK ++           +FQ    CT C+ V Q LE+M SK S   E +  +E  +C+ LP  +   C+  +D Y   + NLI   +    IC  + LC   S  +    LG   C  C  V+  +   LA  S    +      VCS +       C  +V    PT VN L   + P+ +C    +C       P+ +E     C +CE  ++     + +P                               Y  ++I +I+  +  K +C A+  C        +SQ ++  +          EC  C  A+ ++++ +   A +  I+ F    +C +     +  C  L++ +   ++   + +   +K+C ++ +C+     +K V+ +E E   R +   ++  +++  S++++     N +C RL   V  +C   +D Y   I  +  S      +C  + LC+    K +       +  ++  C IC FV   L   L     +  I+  L + VC    +   +EC   ++ Y   +I I+     P+ LC+ L+LC    +++   QP +    ++   +C++C       +    KNT                  E ++C+   +   N+I        +  + CK+ ++C +      +  ++C  GP FWC S  +A  C   AV+HC+  VWN
Sbjct: 1329 AEFQQSPKCTLCEYVMQKLETMISKQSTVAEIEAALEKVCSLLPGSISDQCQQFVDQYTPTIINLIVQNVSPQLICRTLGLCKASSES---------EFQQSPKCTLCEYVIQKLETMISKQSTVAEIEAALEK-VCSLLPGSISDQCQQFVDQYTPTIINLIVQNVSPQLICRTLGLCKASSESDVHEQLGPT-CVLCQYVMKEVESLLAKESTISDIEAALDKVCSLMPGTLSQQCQQFVDTYTPTIVNLLVQYVPPRLVCVVLRLCMFEEAPAPVLNEGANEFCAICEFAMSELDKILVEPNT----------------------------EYTKEIIFLITQSVSPKQVCAALTLCTSVDSADEVSQDETLDHIDEQKFEASTECIVCEYAMKELEKQLGKNATEQEIR-FALDEVCSLLPGTLQEDCSILINYYTTEVIYQFIRKYPANKICTLLKVCAAVDGELKSVAHVEVERSLRSLSVNLLSRSWNRCSRRILQRKALNSLCSRLPSTVAKDCQMFVDYYTEEIIFILVSQFPPSSLCTSINLCTASEIKGVT----EKVEQNTQFCTICEFVAKYLEEDLQKNSTEAEIKKAL-DLVCSKLPSTVTKECQMFVDYYTEEIIFILVSQFPPSKLCSSLQLC----SAVEEIQPQIDEDTSV---SCEVCVIAVRSAELYITKNT---------------TEQEIDKCVTFVQQFGNAIPELIVTFGDPDKICKLLDLCPQNVDVKQLMYEKCKTGPEFWCASETNADLC--DAVEHCKRHVWN 2051          

HSP 5 Score: 132.494 bits (332), Expect = 1.990e-27
Identity = 149/724 (20.58%), Postives = 292/724 (40.33%), Query Frame = 2
Query:  158 CLKGPTYWCATYQNAEKCDRITECFMGQGDQKNKVDISHHKNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKS--KICSHLKSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKM--RICPIFQSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCSMKKV------SGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRLGFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINL------LMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAKKQECINDINQYYSLVINIITEFLKP-TLCNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKNTP 2278
            C  GPTYWC + + A++C  +  C        N       K G++C+ C   V  +   + K S ++ +       C +L   ++ DC+  VN + P + + L  +  P+++C L+  CK   +++  +   S +            + Q ++   SK                            LL+   TQL+        GD++C                      C + I  ++K L   +   +++     +C  L  + K  C   V+ LVP  + +L   +  +Q C     C S    +P+        C  C+  +   K+ +S   N +  K  I+     C+ L S++ QC   V+ Y   + ++I  + D   IC +I  CK    S+     +F    C  C   +    ++++ P+ +   +N +K    IC + +     C Q+V E+  +I+  +L  L+ +  CK +G+C+ + +       G  C  C+  + +   L  +   Q+++    E  +C  +    ++C   I  Y  ++F +    +N K +C ++ LC+ +   +  L      ++K+   +D   C  C  +  ++   L+ PD+QK I   +E  +C   G    +C   ++QY  LV   + +++ P  +C+ + LC++          L +    + +  C  C+ F+  +  I   NTP
Sbjct:   23 CSHGPTYWCGSIKQAKECGAVQYC------SDNDWAAIRTKAGEFCNDCEIGVGLLTEQLEKASTEDEIIQIVEKFCTDLGALAE-DCRLVVNAYGPEMLKALIEKLQPDQVCALLGFCKPDTSVTDPQEDQSAQI-----------MLQLMDRASSK----------------------------LLEILGTQLFA-------GDKMC--------------------TDCTNFIGDVKKLLNNATVEAMITGEVKRLCQYLGAY-KTECELIVTTLVPQGIGQLVEKINAKQDCSQIGFCKSLHSDEPVPEPPTNDPCSDCKAFMGDVKTILS---NSSVQKMIIEDLENFCNDLGSLAPQCQEYVEQYGSLVFSLILQYFDPNMICSSIGFCK----SEEMVMASFD--VCTECKTYMGDFVQFLNTPSVQ---QNVMKQVTSICKMLKISD-NCDQVVSEYGPLIMKMLLQYLNPESFCKEIGVCASEAIPEALPEPGDLCTDCQSFVKDFDNLLNNYTVQEMLLKDFE-VLCKYVPNYSSDCKMYIKQYGALVFEVIAGLINPKTVCTDIGLCNGVRSPRPTLPKLPVEVLKALAPNDV--CADCKNLFQDVQNFLSEPDVQKMILGKIE-LLCNDLGPFGPQCKTYVDQYGPLVFTFLLQYIDPDAICSNVGLCSAD---------LPQSPAKVNADMCADCKAFFTDVSTIL--NTP 644          

HSP 6 Score: 128.642 bits (322), Expect = 3.048e-26
Identity = 151/710 (21.27%), Postives = 277/710 (39.01%), Query Frame = 2
Query:  266 ISHHKNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITLGSWQ--CQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGV---------IECDLCEIGVTGAKSFISKPENMNKVKSFIKSKI---CSHLKSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCS------------------MKKVSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRLGFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLE---NHVCPHFGAKKQECINDINQYYSLVINIITEFLKPTL-CNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCE--KFYFHLQKIFLKNTPI 2281
            +      D C  C  F+  V+  +   S Q+ +       CN+L G     C++ V  +  L++  +     P  IC  +  CK+   +  S           DVCT+CK          +  S  +      + IC  L  ++   C  ++  Y   +  ++   L+ +  C  I +C+SE     L      C  C   +      L   +  E++      +C  +  +    C  Y+          +   + P+ +C +  +C      +P   +  V           C  C+      ++F+S+P+    V+  I  KI   C+ L     QC + VD Y   + T +  ++D  AIC  +  C   S    +S        C  C    T +   ++ P  +  I   ++     +  S   QCQQ V E+  +++NFVL  LD   +C  +G C+                  M  V+G  C  C+ ++++   L  +   Q++  N +   +C   G +++EC  LI  Y P++F    + ++   IC ++ LC  ++     + +K++      +C  C     +++T+L NP  Q+ I   +E   N + P  G    +C   +++Y  L IN + ++L P + C E+  C +          L K S ++ S N   C   K +F      LKN+ +
Sbjct:  259 VPEPPTNDPCSDCKAFMGDVKTILSNSSVQKMIIEDLENFCNDL-GSLAPQCQEYVEQYGSLVFSLILQYFDPNMICSSIGFCKSEEMVMASF----------DVCTECKTYMGDFVQFLNTPSVQQNVMKQVTSICKML--KISDNCDQVVSEYGPLIMKMLLQYLNPESFCKEIGVCASEAIPEALPEPGDLCTDCQSFVKDFDNLLNNYTVQEMLLKDFEVLCKYVPNYSSD-CKMYIKQYGALVFEVIAGLINPKTVCTDIGLCNGVRSPRPTLPKLPVEVLKALAPNDVCADCKNLFQDVQNFLSEPD----VQKMILGKIELLCNDLGPFGPQCKTYVDQYGPLVFTFLLQYIDPDAICSNVGLC---SADLPQSPAKVNADMCADCKAFFTDVSTILNTPQVQQMILQEIESLCNDLGPSISPQCQQYVTEYGPLVINFVLQYLDPTSICGDIGFCTGVNTVRPLAFTAVKTILKMPTVAGDLCTDCKNLVNDADGLLKNATVQKMFLNDLA-VVCKYFGGLQSECKDLIMEYGPLLFDYIAAYIDPTTICDDIGLCPAVT-----VTLKAD------QCADCKNFFQDVVTILNNPSTQQQILQAIETLCNDLGPSIGP---QCQQYVSEYGPLAINFLLQYLDPNMICGEIGFCAA----------LPKQSMSLPSLNGDQCTDCKNFFQDVATLLKNSSV 922          

HSP 7 Score: 127.872 bits (320), Expect = 5.358e-26
Identity = 129/546 (23.63%), Postives = 241/546 (44.14%), Query Frame = 2
Query:  275 HKNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSP-DEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLK-SISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNF-KGIE--CDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQ--SEKIQCQQL-----VDEFFDIILNFVLSELDVDKVCKVMGMCSMKKVSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL-GFVKTECTSLIDTYLP-VIFSLARSTLNSKVICAELKLCSLI 1870
             + G  C+ C   V  +E ++   + +E +  A    C+ L       C   ++ + P++ + L+ E  P+++C  +++C             + +FQ    CT C+ V Q LE+M SK S   E +  +E  +C+ LP  +   C+  +D Y   + NLI   +    IC  + LC + +      S +C  C  VI  L   ++  S    +      VCS L       C  +V    PT +N +   ++PQ IC    +C + S +  +  + G   C LC+  +   +S ++K   ++ +++ +  K+CS +  ++S QC   VD Y   ++ ++  ++  + +C+ +  C    + +   AP   +G    C  C  A++++ + + +P  +     + K  I  I Q  S K  C  L     VD   ++  +  L  +D             K  +  EC VCE  M E+ +    N ++Q +  F  +++C  L G ++ +C+ LI+ Y   VI+   R    +K IC  LK+C+ +
Sbjct: 1248 EEEGAGCEVCKLVVSQIEVYLKDGATEEEITAALEKFCSILPSSLANQCTAFMDQYGPVVLKLLADEMDPDQVCSFLKLC-------------AAEFQQSPKCTLCEYVMQKLETMISKQSTVAEIEAALEK-VCSLLPGSISDQCQQFVDQYTPTIINLIVQNVSPQLICRTLGLCKASSESEFQQSPKCTLCEYVIQKLETMISKQSTVAEIEAALEKVCSLLPGSISDQCQQFVDQYTPTIINLIVQNVSPQLICRTLGLCKASS-ESDVHEQLGPT-CVLCQYVMKEVESLLAKESTISDIEAAL-DKVCSLMPGTLSQQCQQFVDTYTPTIVNLLVQYVPPRLVCVVLRLC----MFEEAPAPVLNEGANEFCAICEFAMSELDKILVEPNTE-----YTKEIIFLITQSVSPKQVCAALTLCTSVDSADEVSQDETLDHID-----------EQKFEASTECIVCEYAMKELEKQLGKNATEQEI-RFALDEVCSLLPGTLQEDCSILINYYTTEVIYQFIRKYPANK-ICTLLKVCAAV 1754          
BLAST of Proactivator polypeptide vs. TrEMBL
Match: A0A2T7PW46 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_00216 PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 5.433e-41
Identity = 183/832 (22.00%), Postives = 337/832 (40.50%), Query Frame = 2
Query:  293 CDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSI---KFQNDDVCTKCKQVFQFLESMFSK-VSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQ------ITLGSWQ------CQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVC------------TSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHL-KSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIE---------------------------------------------CDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSE-KIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCSMK-KVSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL--GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKPT-LCNELRLCNSTTTSIIMSQPLVKMSRAILSSN-CQLCEKFYFHLQKIFLKNTPISPLTVFAN-VCNLEDTDETNECLKHFRNLNSIVAAFHASR-NIGEFCKMTEMCKG----SKKHHVGKKQCSWGPGFWCISRQHAAGCG 2527
            C+ C + +Q +E  + +   +E V  A   +C+        +C++ V  ++  +   L  +     IC  + +C +T  ++  ++  +    K     +C  CKQV Q L+S+  K  + D+ +  ++  +C   P+ + S C+ L+  Y  Q+   I   L  + IC L+ LCS  N         T+G  +      C  C +V+  +   L      + +      VC          C   V+   P  +  +   L P++IC    +C            T+   +KP A   G I CDLC+  +    S + K   ++ ++  +  ++C     +ISSQC  LV  YA Q+I  I+  +  + IC  +  C   +  Q K++   +  E                                             CD C   + K+   +        I+  L  ++C +F +    QC+QLV ++   +++ ++ EL  D++C ++ +CS   K +G  C++C++V+  +  L   N +   +   + +++C RL    + ++C  L+  Y P I       L  + IC+ LKLCS   +K                C +C  V+  + +LL        IE  L + VC  F A    +C   + QY   +I  I E LKP  +C+ L LC+       + + +   + A+     C +C+    ++++   +   +  +    N VC L  TD T+EC    +    ++    A   N    C+  ++C      S    +G   C++GP +WC   ++A  CG
Sbjct:  780 CELCNQVMQLIETFLQQNRTEETVTKALQQVCSFFPDTISTECRQFVGRYSQEVINLLLQDLNATDICKKLGLCSDTRPVTGKELTTTAGDKKPSAGPICDLCKQVLQTLDSLLEKNRTVDDIEKALDR-VCKLFPATISSQCRQLVGQYAPQIIEYIAEELKPEEICSLLGLCSQGNGAQETKPVATIGEEKPSAGPICDLCKEVLQTVDSLLEKNRTVDDIEKALDQVCRLFPATISSQCRQLVAQYAPQIIEYIADELKPEEICSLLGLCSQGKKVQGKELTTATDEQKPAA---GPI-CDLCKEVLQAVDSLLEKNRTVDDIEKAL-DQVCRLFPATISSQCRQLVGQYAPQIIEYITEELKPEEICSLLGLCSQGNRDQGKASDGGRQTEAISWSHLRVVQSGLDNTGQSGREEQHSGQYHEAAVGELKPSAGPICDLCKEVLQKVDTLLEKNRTVDDIEKALD-QVCRLFPASIASQCRQLVAQYAPALIDLIVEELQPDEICSLLKLCSQSNKAAGPICDLCKQVLQTLDSLLEKNRTVDDIEKAL-DQVC-RLFPATIASQCRQLVGQYAPQIIEYIADELKPEEICSLLKLCSQGKKKPAA----------GPICDLCKEVLQAVDSLLEKNRTVDDIEKAL-DQVCRLFPATISSQCRQLVGQYAPQIIEYIAEELKPEEICSLLGLCSQGHNE--LGREVETQAVAVREGELCLICDTLLNYVEEGLNQQATVEEVEKLLNDVCKLFPTDLTSECSLLVQQFTPLIMQLLAEEVNPKAICETIKLCPSPNSTSHPKFLGLDPCTFGPAYWCAKLENAEECG 1589          

HSP 2 Score: 146.747 bits (369), Expect = 6.894e-32
Identity = 151/699 (21.60%), Postives = 289/699 (41.34%), Query Frame = 2
Query:  284 GDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSI---KFQNDDVCTKCKQVFQFLESMFSK-VSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSS----ENTQITLGSWQ--------CQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKG------------VIE----------------------------------CDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHL-KSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSE-KIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCSM---KKVSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL--GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLI-SQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKP-TLCNELRLCNSTTTS 2164
            G  CD C + +Q++++ + K    + +  A + +C          C++ V  +AP I   ++ E  PE+IC L+ +C   N    +K   +I   K     +C  CK+V Q ++S+  K  + D+ +  ++  +C   P+ + S C+ L+  Y  Q+   I   L  + IC L+ LCS     +  ++T  + +        C  C +V+  +   L      + +      VC          C   V    P  +  +   L P++IC    +C+  +  +  AS+ G            V++                                  CDLC+  +    + + K   ++ ++  +  ++C     SI+SQC  LV  YA  LI +I   +    IC  +  C   S S + + P      CD C   +  +   +        I+  L  ++C +F +    QC+QLV ++   I+ ++  EL  +++C ++ +CS    K  +G  C++C+ V+  V  L   N +   +   + +++C RL    + ++C  L+  Y P I       L  + IC+ L LCS   ++    +  ++    +   C IC  +++ +   L      + +E  L N VC  F      EC   + Q+  L++ ++ E + P  +C  ++LC S  ++
Sbjct:  876 GPICDLCKQVLQTLDSLLEKNRTVDDIEKALDRVCKLFPATISSQCRQLVGQYAPQIIEYIAEELKPEEICSLLGLCSQGNGAQETKPVATIGEEKPSAGPICDLCKEVLQTVDSLLEKNRTVDDIEKALDQ-VCRLFPATISSQCRQLVAQYAPQIIEYIADELKPEEICSLLGLCSQGKKVQGKELTTATDEQKPAAGPICDLCKEVLQAVDSLLEKNRTVDDIEKALDQVCRLFPATISSQCRQLVGQYAPQIIEYITEELKPEEICSLLGLCSQGNRDQGKASDGGRQTEAISWSHLRVVQSGLDNTGQSGREEQHSGQYHEAAVGELKPSAGPICDLCKEVLQKVDTLLEKNRTVDDIEKAL-DQVCRLFPASIASQCRQLVAQYAPALIDLIVEELQPDEICSLLKLC---SQSNKAAGPI-----CDLCKQVLQTLDSLLEKNRTVDDIEKALD-QVCRLFPATIASQCRQLVGQYAPQIIEYIADELKPEEICSLLKLCSQGKKKPAAGPICDLCKEVLQAVDSLLEKNRTVDDIEKAL-DQVC-RLFPATISSQCRQLVGQYAPQIIEYIAEELKPEEICSLLGLCSQGHNELGREVETQAVAVREGELCLICDTLLNYVEEGLNQQATVEEVEKLL-NDVCKLFPTDLTSECSLLVQQFTPLIMQLLAEEVNPKAICETIKLCPSPNST 1560          

HSP 3 Score: 144.436 bits (363), Expect = 3.959e-31
Identity = 186/824 (22.57%), Postives = 328/824 (39.81%), Query Frame = 2
Query:  293 CDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQNDDV----CTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCS---------SENTQITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGI---CNSYVSNLVPTFVNELHSTLTPQQICGNHHVC------------TSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHL-KSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIE-------CDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSE-KIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCSM-KKVSGIE---------------CEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL--GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCS-----------------LISQKKINLLMKSNINDDSAK------------------------CKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKP-TLCNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKNTPISPLT-VFANVCNLEDTDETNECLKHFRNLNSIVAAFHASR-NIGEFCKMTEMC-KGSKKHHVG 2461
            CD C   ++ VEA + +   ++ +  A   +C+ L   ++  C++ +N + P + R L  E  PE IC  +Q+C  T+    +K+  +   Q   +    C  C+ V   ++S+            +   IC+ LP+ +++ C   +  Y   +  L+   LD   +C  I LC+         +E+ +    +  C+ C  V+ ++   L      E V+     VCS   FF   I   C  +V       +N L   L    IC    +C            T+   KKP A   G I CDLC+  +    S + K   ++ ++  +  ++C     +ISSQC  LV  YA Q+I  I+  +  + IC  +  C   + +Q        G E       CD C   +  +   +        I+  L  ++C +F +    QC+QLV ++   I+ ++  EL  +++C ++G+CS  KKV G E               C++C+ V+  V  L   N +   +   + +++C RL    + ++C  L+  Y P I       L  + IC+ L LCS                  IS   + ++     N   +                         C +C  V+ ++ TLL        IE  L + VC  F A    +C   + QY   +I++I E L+P  +C+ L+LC+ +  +   + P+           C LC++    L  +  KN  +  +      VC L      ++C +        +  + A      E C + ++C +G KK   G
Sbjct:  588 CDICRFALEVVEAIVSRNRTEQSLVEALQQVCSLLTPSARPQCEQFINNYMPTLIRLLLQELDPEVICNELQLCNETD----NKVPETAHLQAASIGSIECEVCELVLGAIDSVLDGNRTLAAIEKVLGEICSILPATIRAQCVSFVSEYGPAVMELLADELDPQVVCIKIGLCNQAQVKQLLEAEDKRRPQATPVCELCNQVMQLIETFLQQNRTEETVTKALQQVCS---FFPDTISTECRQFVGRYSQEVINLLLQDLNATDICKKLGLCSDTRPVTGKELTTTAGDKKPSA---GPI-CDLCKQVLQTLDSLLEKNRTVDDIEKAL-DRVCKLFPATISSQCRQLVGQYAPQIIEYIAEELKPEEICSLLGLCSQGNGAQETKPVATIGEEKPSAGPICDLCKEVLQTVDSLLEKNRTVDDIEKALD-QVCRLFPATISSQCRQLVAQYAPQIIEYIADELKPEEICSLLGLCSQGKKVQGKELTTATDEQKPAAGPICDLCKEVLQAVDSLLEKNRTVDDIEKAL-DQVC-RLFPATISSQCRQLVGQYAPQIIEYITEELKPEEICSLLGLCSQGNRDQGKASDGGRQTEAISWSHLRVVQSGLDNTGQSGREEQHSGQYHEAAVGELKPSAGPICDLCKEVLQKVDTLLEKNRTVDDIEKAL-DQVCRLFPASIASQCRQLVAQYAPALIDLIVEELQPDEICSLLKLCSQSNKA---AGPI-----------CDLCKQVLQTLDSLLEKNRTVDDIEKALDQVCRLFPATIASQCRQLVGQYAPQIIEYIADELKPEEICSLLKLCSQGKKKPAAG 1381          

HSP 4 Score: 144.436 bits (363), Expect = 4.098e-31
Identity = 158/706 (22.38%), Postives = 293/706 (41.50%), Query Frame = 2
Query:  254 NKVDISHHKNGDY-CDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGL------------------------VQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESL--ICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQI---------TLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASE-----KGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHL-KSISSQCSSLVDAYADQLITMISNHMDSKAICIAINAC--------KGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSE-KIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCSM----------------KKVSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL--GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSL---ISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKP-TLCNELRLCN 2149
            N V     K GD  C+ CM  V  ++        Q  V    N  C  L G+    C+     +AP ++  ++ E  PE +C L                        V+V  + +    + +   +K    D C  C+   + +E++ S+   ++   L+E+L  +C+ L    +  C+  ++ Y+  L  L+   LD + IC  + LC+  + ++         ++GS +C+ C  V+  +   L G      +  +   +CS L    +  C S+VS   P  +  L   L PQ +C    +C    +K+ + +E     +    C+LC   +   ++F+ +      V   ++ ++CS    +IS++C   V  Y+ ++I ++   +++  IC  +  C        K  + +     P+   I CD C   +  +   +        I+  L  R+C +F +    QC+QLV ++   I+ ++  EL  +++C ++G+CS                 K  +G  C++C+ V+  V  L   N +   +   + +++C RL    + ++C  L+  Y P I       L  + IC+ L LCS    +  K++              C +C  V+  + +LL        IE  L + VC  F A    +C   + QY   +I  ITE LKP  +C+ L LC+
Sbjct:  456 NLVPTDVGKVGDIKCEECMAIVGFLQNLDRDAEVQTAVRKLFNDTCA-LLGQEAKQCQALAAQYAPQLFEIIASELDPESVCDLFLHCFKSSVEDDRGEDVVETNAVVVEVDPHADVQQSNAVSAEVKASIVD-CDICRFALEVVEAIVSRNRTEQS--LVEALQQVCSLLTPSARPQCEQFINNYMPTLIRLLLQELDPEVICNELQLCNETDNKVPETAHLQAASIGSIECEVCELVLGAIDSVLDGNRTLAAIEKVLGEICSILPATIRAQCVSFVSEYGPAVMELLADELDPQVVCIKIGLCNQAQVKQLLEAEDKRRPQATPVCELCNQVMQLIETFLQQNRTEETVTKALQ-QVCSFFPDTISTECRQFVGRYSQEVINLLLQDLNATDICKKLGLCSDTRPVTGKELTTTAGDKKPSAGPI-CDLCKQVLQTLDSLLEKNRTVDDIEKALD-RVCKLFPATISSQCRQLVGQYAPQIIEYIAEELKPEEICSLLGLCSQGNGAQETKPVATIGEEKPSAGPICDLCKEVLQTVDSLLEKNRTVDDIEKAL-DQVC-RLFPATISSQCRQLVAQYAPQIIEYIADELKPEEICSLLGLCSQGKKVQGKELTTATDEQKPAAGPICDLCKEVLQAVDSLLEKNRTVDDIEKAL-DQVCRLFPATISSQCRQLVGQYAPQIIEYITEELKPEEICSLLGLCS 1151          

HSP 5 Score: 135.961 bits (341), Expect = 1.678e-28
Identity = 167/874 (19.11%), Postives = 338/874 (38.67%), Query Frame = 2
Query:  158 CLKGPTYWCATYQNAEKCDRITECFMGQGDQKNKVDISHHKNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNL-KGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSPD---EFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITL--------------------------GSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGI----CNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKG---VIE---CDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACK-GFS-----ISQRKSAPNFKG----IECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMC------------------------------------SMKKVSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRLG-FVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKP-TLCNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKNTPISPLT-VFANVCNLEDTDETNECLKHF-RNLNSIVAAFHASRNIGEFCKMTEMCKGSKK-------HHVGKKQCSWGP 2485
            C  GP YWC++   A +C     C  G   +     ++     + C   +  VQ     +   +E++        +C  +   + + +CK+ V  + PL    L+     +++  ++ +C+        +    +K+Q     T+CK  + F+  + +++  D   + + +++S IC+++ +++   CKLL++  +  L + I +      IC L   CS+   +                             G  +C  C  V+  ++    G  +P   S+   N   KL  +E G+    C      L       L+  L P   C     C    +  P + E     V E   C  CE   +   + +   +++ +  +F K  +C ++ S+  +C+++VD     L+  ISN     + C ++  C  G S     +      P   G    I+C+ C   V  ++    D   +T+++       C +   E  QCQ L  ++   +   + SELD + VC +   C                                    +  K S ++C++C   ++ V  +   N ++Q +   ++ ++C  L    + +C   I+ Y+P +  L    L+ +VIC EL+LC+    K          +  S +C++C  V+  + ++L       +IE  L   +C    A  + +C++ +++Y   V+ ++ + L P  +C ++ LCN      ++     +  +A  +  C+LC +    ++    +N     +T     VC+      + EC +   R    ++       N  + CK   +C  ++           G K+ S GP
Sbjct:   24 CTWGPAYWCSSVTAAGRCSAFAHCMQGVWGKT----LADFLQTETCTTSVNKVQLARRLLVTKNEKDSATQILTSLCTLVTDSERRKECKEMVVTYLPLALELLTSSLKDDQVAWVLGLCEPAG-----RDVAPVKYQPSAEETRCKNCYTFVTDITARLGKDGGEKLQGILKSTICSEM-ADMAPVCKLLVENTIPDLLSEIANEAQPGDICRLADFCSNRGEEPKFRQLFKKTFRKLSTIISVVKAKIHDIEGRVECYECQKVVTSVKN--FGKDSPLRSSV--ENAFMKLCMYE-GLDTEECGDLSWGLFSQLDMFLYENLEPSSFCSQEFECIDSDLVPPPSVEDAQTPVYESSSCSDCEKFYSDISAILHDEDSVTRTVAFAKKTLCQNVGSLQYECNAMVDRLLPVLLGYISNSFTPASFCGSMAMCSPGLSPKFDIMKVVNLVPTDVGKVGDIKCEECMAIVGFLQNLDRDAEVQTAVRKLFN-DTCALLGQEAKQCQALAAQYAPQLFEIIASELDPESVCDLFLHCFKSSVEDDRGEDVVETNAVVVEVDPHADVQQSNAVSAEVKASIVDCDICRFALEVVEAIVSRNRTEQSLVEALQ-QVCSLLTPSARPQCEQFINNYMPTLIRLLLQELDPEVICNELQLCNETDNKVPETAHLQAASIGSIECEVCELVLGAIDSVLDGNRTLAAIEKVL-GEICSILPATIRAQCVSFVSEYGPAVMELLADELDPQVVCIKIGLCNQAQVKQLLEAEDKRRPQA--TPVCELCNQVMQLIETFLQQNRTEETVTKALQQVCSFFPDTISTECRQFVGRYSQEVINLLLQDLNATDICKKLGLCSDTRPVTGKELTTTAGDKKPSAGP 877          

HSP 6 Score: 113.62 bits (283), Expect = 1.231e-21
Identity = 162/760 (21.32%), Postives = 293/760 (38.55%), Query Frame = 2
Query:  293 CDACMKFVQSVEAHI-PKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFS--KIFNSIKFQ----NDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKS-----NVCSK-LNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHL-KSISSQCSSLVDAYADQLITMISNHMDSKAICIAINAC----KGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSE-KIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCSMKKVSGI-------------ECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRLGFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCS---LISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKP-TLCNELRLCNSTTTSIIMSQPLVKMSRAILSSN--CQLCEKFYFHLQKIFLKNTPISPLT-VFANVCNLEDTDETNECLKHFRNLNSIVAAFHASR-NIGEFCKMTEMCKGSKK 2449
            C  C KF   + A +  + S    V  A   +C N+ G  Q +C   V+   P++   +S   TP   CG + +C    +  F   K+ N +        D  C +C  +  FL+++                      +EVQ+         V +L+N   +LL  +                   + QCQ            LA   AP++  +I S     +VC   L+ F+  + +    ++V T  N +   + P     +  V  S+++   + +   +++CD+C   +   ++ +S+      +   ++ ++CS L  S   QC   ++ Y   LI ++   +D + IC  +  C         +    A +   IEC+ C L +  I   +       +I+  L   IC I  +  + QC   V E+   ++  +  ELD   VC  +G+C+  +V  +              CE+C +VM  +      N +++ V+  ++         + TEC   +  Y   + +L    LN+  IC +L LCS    ++ K++              C +C  V+  L +LL        IE  L + VC  F A    +C   + QY   +I  I E LKP  +C+ L LC S       ++P+  +     S+   C LC++    +  +  KN  +  +      VC L     +++C +        +  + A      E C +  +C   KK
Sbjct:  368 CSDCEKFYSDISAILHDEDSVTRTVAFAKKTLCQNV-GSLQYECNAMVDRLLPVLLGYISNSFTPASFCGSMAMCSPGLSPKFDIMKVVNLVPTDVGKVGDIKCEECMAIVGFLQNLDRD-------------------AEVQTA--------VRKLFNDTCALLGQE-------------------AKQCQA-----------LAAQYAPQLFEIIASELDPESVCDLFLHCFKSSVEDDRGEDVVET--NAVVVEVDP-----HADVQQSNAVSAEVKA--SIVDCDICRFALEVVEAIVSRNRTEQSLVEALQ-QVCSLLTPSARPQCEQFINNYMPTLIRLLLQELDPEVICNELQLCNETDNKVPETAHLQAASIGSIECEVCELVLGAIDSVLDGNRTLAAIEKVLG-EICSILPATIRAQCVSFVSEYGPAVMELLADELDPQVVCIKIGLCNQAQVKQLLEAEDKRRPQATPVCELCNQVMQLIETFLQQNRTEETVTKALQQVCSFFPDTISTECRQFVGRYSQEVINLLLQDLNATDICKKLGLCSDTRPVTGKELTTTAGDKKPSAGPICDLCKQVLQTLDSLLEKNRTVDDIEKAL-DRVCKLFPATISSQCRQLVGQYAPQIIEYIAEELKPEEICSLLGLC-SQGNGAQETKPVATIGEEKPSAGPICDLCKEVLQTVDSLLEKNRTVDDIEKALDQVCRLFPATISSQCRQLVAQYAPQIIEYIADELKPEEICSLLGLCSQGKK 1056          

HSP 7 Score: 96.2857 bits (238), Expect = 2.826e-16
Identity = 81/378 (21.43%), Postives = 159/378 (42.06%), Query Frame = 2
Query:  284 GDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSK-VSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICG-------NHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKS-ISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIE 1390
            G  CD C + +Q V+  + K    + +  A + +C          C++ V  +AP +   +  E  P++IC L+++C  +N  +              +C  CKQV Q L+S+  K  + D+ +  ++  +C   P+ + S C+ L+  Y  Q+   I   L  + IC L+ LCS    +   G   C  C +V+  +   L      + +      VC          C   V    P  +  +   L P++IC         H+        + +A  +G + C +C+  +   +  +++   + +V+  + + +C    + ++S+CS LV  +   ++ +++  ++ KAIC  I  C         S P F G++
Sbjct: 1211 GPICDLCKEVLQKVDTLLEKNRTVDDIEKALDQVCRLFPASIASQCRQLVAQYAPALIDLIVEELQPDEICSLLKLCSQSNKAAGP------------ICDLCKQVLQTLDSLLEKNRTVDDIEKALDQ-VCRLFPATIASQCRQLVGQYAPQIIEYIADELKPEEICSLLKLCSQGKKKPAAGPI-CDLCKEVLQAVDSLLEKNRTVDDIEKALDQVCRLFPATISSQCRQLVGQYAPQIIEYIAEELKPEEICSLLGLCSQGHNELGREVETQAVAVREGEL-CLICDTLLNYVEEGLNQQATVEEVEKLL-NDVCKLFPTDLTSECSLLVQQFTPLIMQLLAEEVNPKAICETIKLCPS---PNSTSHPKFLGLD 1569          

HSP 8 Score: 74.7146 bits (182), Expect = 9.990e-10
Identity = 62/278 (22.30%), Postives = 117/278 (42.09%), Query Frame = 2
Query:  269 SHHKNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSK-VSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSS---------ENTQITLGSWQ-CQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTS 1069
            S+   G  CD C + +Q++++ + K    + +  A + +C          C++ V  +AP I   ++ E  PE+IC L+++C               K     +C  CK+V Q ++S+  K  + D+ +  ++  +C   P+ + S C+ L+  Y  Q+   I   L  + IC L+ LCS          E   + +   + C  C  ++  + + L   +  E V  + ++VC          C+  V    P  +  L   + P+ IC    +C S
Sbjct: 1290 SNKAAGPICDLCKQVLQTLDSLLEKNRTVDDIEKALDQVCRLFPATIASQCRQLVGQYAPQIIEYIADELKPEEICSLLKLCSQGKK----------KPAAGPICDLCKEVLQAVDSLLEKNRTVDDIEKALDQ-VCRLFPATISSQCRQLVGQYAPQIIEYIAEELKPEEICSLLGLCSQGHNELGREVETQAVAVREGELCLICDTLLNYVEEGLNQQATVEEVEKLLNDVCKLFPTDLTSECSLLVQQFTPLIMQLLAEEVNPKAICETIKLCPS 1556          
BLAST of Proactivator polypeptide vs. TrEMBL
Match: R7VKI2 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_225175 PE=4 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.282e-40
Identity = 141/570 (24.74%), Postives = 243/570 (42.63%), Query Frame = 2
Query: 1019 STLTPQQICGNHHVCTSHSIKKPIASEKGVIE-CDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKS--ISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFK----GIE--CDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCSMKKVSGIE-------------------------CEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRLGFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKK-----INLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAKKQE-CINDINQYYSLVINIITEFLKPT-LCNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKNTPISPL-TVFANVCNLEDTDETNECLKHFRNLN-SIVAAFHASRNIGEFC------------KMTEMCKGSKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVW 2563
            S++   + C     C S + K     +K   E C  CE  V   KS +   +  ++V+ F+ S  CS + S  ++ +C+S VD Y ++++ +I+  MD + +C  +  C G +  + K  P        +E  C  C      IK YI+  + +  I+  +  ++C      + +C+QLV  F   IL  +    D D +C   G+C    +SG                           C +CE V+ EV  L     +Q  +  F++ ++C  LG VK  C   +D+Y  + F    + L+ K  C  L  C   S +       + L    +   S  C +C FV+SE+ +LL++   ++ I+  LE  VC       Q+ C++ +N Y  LVIN++T  L P  +C  + LC +  +        + +   +  + C +CE    ++  +  +N+ I+ +  V   VCN   T    +C         +IV       +  E C            +M E+ K   +  +G  +C++GP FWC S+++A  C    V HCE   W
Sbjct:   22 SSIANSKQCNAFDHCVSSTWKNNEIVDKDTDEVCQFCETVVGEVKSMLLNKKAQDEVRQFLDSA-CSVIPSAELAKECASTVDKYLEEILGLIAMEMDPQMVCSLMGLCTGLN-KENKPTPQLAVSPVNVEPLCTDCKKFFEDIKAYITSASTEKEIEEMIDDQLCTNLGGLEDECKQLVKTFLPEILQALAGAYDPDIICDAFGLCLNSSLSGARTLFHRLKLQKTPLFSAAKNSNSAETCMLCETVVGEVQTLTRDAATQAEIEAFLKTEVCAHLGSVKDACEITVDSYGSIFFEFLANELDPKTRCTSLGFCLAASNEVSPSHVFSPLKAPALVKASTTCVVCEFVMSEIDSLLSDNATEEDIKIALE-KVCKILPETIQDQCMDFVNMYSDLVINLLTHELNPEQICTAIGLCRTAKS--------IPVKAIVNDAMCSVCETVIQYVDTLLEENSTIAEIEAVLEKVCNFLPTSLQQQCDTIIETYGKTIVQMIVDDASPEEICTAIGLCTSVKTVEMVELIKPQNQLALGTNECTYGPSFWCASKENAVKC--NTVAHCEKHGW 578          

HSP 2 Score: 131.339 bits (329), Expect = 5.808e-28
Identity = 118/492 (23.98%), Postives = 214/492 (43.50%), Query Frame = 2
Query:  569 NDDVCTKCKQVFQFLESMF-SKVSPDEFKFLIESLICNQLPS-EVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSEN------TQITLGSWQ----CQTCLDVIVVLRKDLAGVSAP-EIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSI-------------KKPIAS----EKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKS-------APNF--KGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIF-QSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCSMKK-------VSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRLGF-VKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMK 1900
             D+VC  C+ V   ++SM  +K + DE +  ++S  C+ +PS E+   C   +D Y+ ++  LI   +D   +C L+ LC+  N       Q+ +        C  C      ++  +   S   EI  +I   +C+ L   E   C   V   +P  +  L     P  IC    +C + S+             K P+ S          C LCE  V   ++         ++++F+K+++C+HL S+   C   VD+Y       ++N +D K  C ++  C   S     S       AP        C  C   +++I   +SD A +  IK  L+ ++C I  ++ + QC   V+ + D+++N +  EL+ +++C  +G+C   K       V+   C VCE V+  V  L   N +   +   +E K+C  L   ++ +C ++I+TY   I  +     + + IC  + LC+ +   ++  L+K
Sbjct:   51 TDEVCQFCETVVGEVKSMLLNKKAQDEVRQFLDS-ACSVIPSAELAKECASTVDKYLEEILGLIAMEMDPQMVCSLMGLCTGLNKENKPTPQLAVSPVNVEPLCTDCKKFFEDIKAYITSASTEKEIEEMIDDQLCTNLGGLEDE-CKQLVKTFLPEILQALAGAYDPDIICDAFGLCLNSSLSGARTLFHRLKLQKTPLFSAAKNSNSAETCMLCETVVGEVQTLTRDAATQAEIEAFLKTEVCAHLGSVKDACEITVDSYGSIFFEFLANELDPKTRCTSLGFCLAASNEVSPSHVFSPLKAPALVKASTTCVVCEFVMSEIDSLLSDNATEEDIKIALE-KVCKILPETIQDQCMDFVNMYSDLVINLLTHELNPEQICTAIGLCRTAKSIPVKAIVNDAMCSVCETVIQYVDTLLEENSTIAEIEAVLE-KVCNFLPTSLQQQCDTIIETYGKTIVQMIVDDASPEEICTAIGLCTSVKTVEMVELIK 538          

HSP 3 Score: 113.235 bits (282), Expect = 3.993e-22
Identity = 115/541 (21.26%), Postives = 237/541 (43.81%), Query Frame = 2
Query:  143 AFDFD-CLKGPTYWCATYQNAEKCDRITECFMGQGDQKNKVDISHHKNGDYCDACMKFVQSVEAHIPKISE-QEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQN-DDVCTKCKQVFQFLESMFSKVSPD-EFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLC------------------------SSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHS-----------IKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHL-KSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIF-QSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMC-SMKKVSGIE 1639
            + D D C  GP++WC++  N+++C+    C          VD    +   +C+  +  V+S+  +     E ++F++ A ++I +    K   +C   V+ +   I   ++ME  P+ +C L+ +C   N  +      ++   N + +CT CK+ F+ +++  +  S + E + +I+  +C  L   ++  CK L+  ++ ++   +    D D IC    LC                        +++N+        C+T +  +  L +D A  +  EI + +K+ VC+ L    K  C   V +    F   L + L P+  C +   C + S           +K P A  K    C +CE  ++   S +S       +K  ++ K+C  L ++I  QC   V+ Y+D +I ++++ ++ + IC AI  C+       K+  N     C  C   +  +   + + +    I+  L+ ++C     S + QC  +++ +   I+  ++ +   +++C  +G+C S+K V  +E
Sbjct:    7 SLDADHCTLGPSFWCSSIANSKQCNAFDHCVSSTWKNNEIVDKDTDEVCQFCETVVGEVKSMLLNKKAQDEVRQFLDSACSVIPSAELAK---ECASTVDKYLEEILGLIAMEMDPQMVCSLMGLCTGLNKENKPTPQLAVSPVNVEPLCTDCKKFFEDIKAYITSASTEKEIEEMIDDQLCTNLGG-LEDECKQLVKTFLPEILQALAGAYDPDIICDAFGLCLNSSLSGARTLFHRLKLQKTPLFSAAKNSNSAETCMLCETVVGEVQTLTRDAA--TQAEIEAFLKTEVCAHLGSV-KDACEITVDSYGSIFFEFLANELDPKTRCTSLGFCLAASNEVSPSHVFSPLKAP-ALVKASTTCVVCEFVMSEIDSLLSDNATEEDIKIALE-KVCKILPETIQDQCMDFVNMYSDLVINLLTHELNPEQICTAIGLCRTAKSIPVKAIVN--DAMCSVCETVIQYVDTLLEENSTIAEIEAVLE-KVCNFLPTSLQQQCDTIIETYGKTIVQMIVDDASPEEICTAIGLCTSVKTVEMVE 535          

HSP 4 Score: 68.9366 bits (167), Expect = 3.684e-8
Identity = 48/201 (23.88%), Postives = 93/201 (46.27%), Query Frame = 2
Query:  278 KNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSP-DEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENT-----------QITLGSWQC 844
            K    C  C   +  +++ +   + +E + +A   +C  L    Q  C   VN ++ L+   L+ E  PE+IC  + +C+   ++    I       ND +C+ C+ V Q+++++  + S   E + ++E  +CN LP+ +Q  C  +++ Y   +  +I      + IC  I LC+S  T           Q+ LG+ +C
Sbjct:  357 KASTTCVVCEFVMSEIDSLLSDNATEEDIKIALEKVCKILPETIQDQCMDFVNMYSDLVINLLTHELNPEQICTAIGLCRTAKSIPVKAIV------NDAMCSVCETVIQYVDTLLEENSTIAEIEAVLEK-VCNFLPTSLQQQCDTIIETYGKTIVQMIVDDASPEEICTAIGLCTSVKTVEMVELIKPQNQLALGTNEC 550          
BLAST of Proactivator polypeptide vs. Ensembl Cavefish
Match: psap (prosaposin [Source:ZFIN;Acc:ZDB-GENE-020108-1])

HSP 1 Score: 68.1662 bits (165), Expect = 1.964e-11
Identity = 110/533 (20.64%), Postives = 198/533 (37.15%), Query Frame = 2
Query:  158 CLKGPTYWCATYQNAEKCDRITECFMGQGDQKNKVDISHHKNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKS-QLDCKKEVNFFAPLIYRELSME-ATPEKICGLVQVCKNTNAMSFSKI---FNSI---------------------------KFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKS-ISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFS---ISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSE-KIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCS--MKKVSGIE 1639
            C  GP YWC   + A  C  +  C      Q+N  +    K+   CD C + +  V+  +   S +  +       C  +  ++   +CK+ V+ + P++   +  E   P  +CG + +C +    + +K+   FN I                           K ++DDVC  C +        F   + +E K    S   N L  ++++ C LL  G    +      +L    IC     C      + + +                +A  + P + SL  + V                            + L P                K +   +   +C +CE  +   +  I       +V   ++ K+C+ L S +++QC  L++ Y   +I ++    D K IC  +  CKG S   I   + A    G  CD C +AV  +   +   A +  I+  ++ ++C     E K QC QLV ++  +++  +L  LD D VC  +G C   +K++ G+E
Sbjct:   23 CAHGPPYWCKNVKTASLCGAVLHC------QQNVWNQPQMKSVP-CDLCKEVLVVVDQLLKDNSTEAEILGYMEKTCQLIPDENLAAECKELVDNYYPILMGIIKGELEDPSVVCGALGLCVSQEE-ALAKLQLQFNEIPKVDLNQRISPFLLNVPQLLYPQETDKKEEDDDVCEDCVK--------FIAAAQEEAKQ--NSTFVNSLIQQIEAQCDLLGPGLSDMVMIHYSCVLQPKDICSRAGFCDGTPKSVPMQTL---------------VAAKTIPAVKSLPATKVVEA-------------------------TPLKP---------------AKKMVRAREPPQCAICEYVMKELEDMIQDQTTEEEVMQAVE-KVCNILPSTLTAQCKDLIETYGQAIIELLVQEADPKTICTVLGLCKGASRAFIPVMEKADFQAGGFCDVCKMAVRYVDGILEQNATEAQIEEAVR-KVCNFLPDEFKTQCDQLVQQYEPLLIQLLLQTLDPDFVCMKLGACPEVLKQLLGME 480          

HSP 2 Score: 67.3958 bits (163), Expect = 3.699e-11
Identity = 62/282 (21.99%), Postives = 117/282 (41.49%), Query Frame = 2
Query: 1733 ICPRLGFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKP-TLCNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKNTPISPLT-VFANVCNLEDTDETNECLKHFRNLNSIVAAFHASRNIGEF-CKMTEMCKGSKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVWN 2566
            IC R GF      S+     P+   +A  T+ +       K+      K    ++++    +  +C IC +V+ EL  ++ +   ++ +   +E  VC    +    +C + I  Y   +I ++ +   P T+C  L LC   + + I   P+++ +       C +C+    ++  I  +N   + +      VCN    +   +C +  +    ++          +F C     C    K  +G +QCSWGP FWC + + A+ C   AV HC   VW+
Sbjct:  244 ICSRAGFCDGTPKSV-----PMQTLVAAKTIPAVKSLPATKVVEATPLKPAKKMVRAR---EPPQCAICEYVMKELEDMIQDQTTEEEVMQAVEK-VCNILPSTLTAQCKDLIETYGQAIIELLVQEADPKTICTVLGLCKGASRAFI---PVMEKADFQAGGFCDVCKMAVRYVDGILEQNATEAQIEEAVRKVCNFLPDEFKTQCDQLVQQYEPLLIQLLLQTLDPDFVCMKLGACPEVLKQLLGMEQCSWGPTFWCKNLETASRC--NAVAHCRRHVWS 511          

HSP 3 Score: 56.6102 bits (135), Expect = 9.353e-8
Identity = 47/184 (25.54%), Postives = 78/184 (42.39%), Query Frame = 2
Query:  293 CDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITLGSWQC 844
            C  C   ++ +E  I   + +E V  A   +CN L       CK  +  +   I   L  EA P+ IC ++ +CK  +  +F  +     FQ    C  CK   ++++ +  + + +         +CN LP E ++ C  L+  Y   L  L+   LD D +C  +  C     Q+ LG  QC
Sbjct:  301 CAICEYVMKELEDMIQDQTTEEEVMQAVEKVCNILPSTLTAQCKDLIETYGQAIIELLVQEADPKTICTVLGLCKGAS-RAFIPVMEKADFQAGGFCDVCKMAVRYVDGILEQNATEAQIEEAVRKVCNFLPDEFKTQCDQLVQQYEPLLIQLLLQTLDPDFVCMKLGACPEVLKQL-LGMEQC 482          

HSP 4 Score: 53.5286 bits (127), Expect = 9.263e-7
Identity = 100/484 (20.66%), Postives = 177/484 (36.57%), Query Frame = 2
Query:  581 CTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSE-VQSTCKLLLDGYVTQLYNLIKSLL-DGDRICPLIHLCSSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGF-------------SISQRKSAPNFKGIE------------------CDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSE-KIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCS---------MKKV---SGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL-GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINL 1891
            C  CK+V   ++ +    S +          C  +P E + + CK L+D Y   L  +IK  L D   +C  + LC S+     L   Q Q                                 N   K   N  +S     F+  +   L PQ+                  ++K   + D+CE  V   K   +  E   +  +F+ S I    + I +QC  L    +D ++   S  +  K IC     C G              +I   KS P  K +E                  C  C   + ++++ I D   +  +   ++ ++C I  S    QC+ L++ +   I+  ++ E D   +C V+G+C          M+K    +G  C+VC+  +  V  +   N ++  +   +  K+C  L    KT+C  L+  Y P++  L   TL+   +C +L  C  + ++ + +
Sbjct:   61 CDLCKEVLVVVDQLLKDNSTEAEILGYMEKTCQLIPDENLAAECKELVDNYYPILMGIIKGELEDPSVVCGALGLCVSQEE--ALAKLQLQ--------------------------------FNEIPKVDLNQRIS----PFLLNVPQLLYPQE------------------TDKKEEDDDVCEDCV---KFIAAAQEEAKQNSTFVNSLI----QQIEAQCDLLGPGLSDMVMIHYSCVLQPKDICSRAGFCDGTPKSVPMQTLVAAKTIPAVKSLPATKVVEATPLKPAKKMVRAREPPQCAICEYVMKELEDMIQDQTTEEEVMQAVE-KVCNILPSTLTAQCKDLIETYGQAIIELLVQEADPKTICTVLGLCKGASRAFIPVMEKADFQAGGFCDVCKMAVRYVDGILEQNATEAQIEEAV-RKVCNFLPDEFKTQCDQLVQQYEPLLIQLLLQTLDPDFVCMKLGACPEVLKQLLGM 479          
BLAST of Proactivator polypeptide vs. Ensembl Cavefish
Match: sftpba (prosaposin-like [Source:NCBI gene;Acc:103040133])

HSP 1 Score: 66.6254 bits (161), Expect = 3.115e-11
Identity = 69/299 (23.08%), Postives = 118/299 (39.46%), Query Frame = 2
Query:  563 FQNDDVCTKCKQVFQFLESMFSKVSPDE-FKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENT----QITLGSWQCQTCLDVIVV----------LRKDLAGVSAPEIVSLIKS---NVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACH 1405
            F +DD C  C  + + L+ + S+    E  K L+E L C+ LP E+  TCK  +D  +      I S++    +C  + LC  +      ++ +   Q    L  I V             DL     P+  +L+ S   + C  L    +G C   V   V   +N L +  +P ++C    +C +  I  P + E  + +CD C       +  +       +  SF+ +   SH  ++  QC S    YA QL  ++   M       A+  C+   +   ++ P+  G  C   H
Sbjct:   37 FTDDDACQDCIHIIELLKDLISEGEFQEKIKGLLEKL-CDSLPGEIPKTCKEQVDKNLPLAITFISSIMIPGEVCAYLGLCDGQMRGQMKELIMNHMQKIVLLPDITVNSSIPCTLCTYVTDLLQCIIPKTQTLLISLLGDACQILPPLLRGQCTVLVKTYVKMLINFLLNFASPDKLCSVLRLCENLEI--PPSGEFFLSDCDSCLTLAVLTRLSLGTNATEPQAASFLHTVCQSHPDAL-PQCESFTQRYAGQLQGLLGKEM------AALQMCERARLCDDQAGPDAAGDPCTLGH 325          

HSP 2 Score: 62.003 bits (149), Expect = 1.029e-9
Identity = 63/278 (22.66%), Postives = 108/278 (38.85%), Query Frame = 2
Query:  296 DACMKFVQSVEAHIPKISEQEFVNLAGNLI---CNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKN----------TNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITLGSW----QCQTCLDVIVVLRKDLA-GVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHS 1075
            DAC   +  +E     ISE EF      L+   C++L G+    CK++V+   PL    +S    P ++C  + +C             N M    +   I   +   CT C  V   L+ +  K        L ++  C  LP  ++  C +L+  YV  L N + +    D++C ++ LC  EN +I          C +CL + V+ R  L    + P+  S + +   S  +   +  C S+           L   +   Q+C    +C   +
Sbjct:   41 DACQDCIHIIELLKDLISEGEFQEKIKGLLEKLCDSLPGEIPKTCKEQVDKNLPLAITFISSIMIPGEVCAYLGLCDGQMRGQMKELIMNHMQKIVLLPDITVNSSIPCTLCTYVTDLLQCIIPKTQTLLISLLGDA--CQILPPLLRGQCTVLVKTYVKMLINFLLNFASPDKLCSVLRLC--ENLEIPPSGEFFLSDCDSCLTLAVLTRLSLGTNATEPQAASFLHTVCQSHPDALPQ--CESFTQRYAGQLQGLLGKEMAALQMCERARLCDDQA 312          
BLAST of Proactivator polypeptide vs. Ensembl Cavefish
Match: sftpba (prosaposin-like [Source:NCBI gene;Acc:103040133])

HSP 1 Score: 65.4698 bits (158), Expect = 8.351e-11
Identity = 69/303 (22.77%), Postives = 118/303 (38.94%), Query Frame = 2
Query:  563 FQNDDVCTKCKQVFQFL-----ESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENT----QITLGSWQCQTCLDVIVV----------LRKDLAGVSAPEIVSLIKS---NVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACH 1405
            F +DD C  C  + + L     E  F +   ++ K L+E L C+ LP E+  TCK  +D  +      I S++    +C  + LC  +      ++ +   Q    L  I V             DL     P+  +L+ S   + C  L    +G C   V   V   +N L +  +P ++C    +C +  I  P + E  + +CD C       +  +       +  SF+ +   SH  ++  QC S    YA QL  ++   M       A+  C+   +   ++ P+  G  C   H
Sbjct:   37 FTDDDACQDCIHIIELLKDLISEGEFQEDVQEKIKGLLEKL-CDSLPGEIPKTCKEQVDKNLPLAITFISSIMIPGEVCAYLGLCDGQMRGQMKELIMNHMQKIVLLPDITVNSSIPCTLCTYVTDLLQCIIPKTQTLLISLLGDACQILPPLLRGQCTVLVKTYVKMLINFLLNFASPDKLCSVLRLCENLEI--PPSGEFFLSDCDSCLTLAVLTRLSLGTNATEPQAASFLHTVCQSHPDAL-PQCESFTQRYAGQLQGLLGKEM------AALQMCERARLCDDQAGPDAAGDPCTLGH 329          

HSP 2 Score: 60.077 bits (144), Expect = 4.996e-9
Identity = 64/282 (22.70%), Postives = 110/282 (39.01%), Query Frame = 2
Query:  296 DACMKFVQSVEAHIPKISEQEFVN-----LAGNL--ICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKN----------TNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITLGSW----QCQTCLDVIVVLRKDLA-GVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHS 1075
            DAC   +  +E     ISE EF       + G L  +C++L G+    CK++V+   PL    +S    P ++C  + +C             N M    +   I   +   CT C  V   L+ +  K        L ++  C  LP  ++  C +L+  YV  L N + +    D++C ++ LC  EN +I          C +CL + V+ R  L    + P+  S + +   S  +   +  C S+           L   +   Q+C    +C   +
Sbjct:   41 DACQDCIHIIELLKDLISEGEFQEDVQEKIKGLLEKLCDSLPGEIPKTCKEQVDKNLPLAITFISSIMIPGEVCAYLGLCDGQMRGQMKELIMNHMQKIVLLPDITVNSSIPCTLCTYVTDLLQCIIPKTQTLLISLLGDA--CQILPPLLRGQCTVLVKTYVKMLINFLLNFASPDKLCSVLRLC--ENLEIPPSGEFFLSDCDSCLTLAVLTRLSLGTNATEPQAASFLHTVCQSHPDALPQ--CESFTQRYAGQLQGLLGKEMAALQMCERARLCDDQA 316          
BLAST of Proactivator polypeptide vs. Ensembl Cavefish
Match: sftpba (prosaposin-like [Source:NCBI gene;Acc:103040133])

HSP 1 Score: 65.4698 bits (158), Expect = 8.351e-11
Identity = 69/303 (22.77%), Postives = 118/303 (38.94%), Query Frame = 2
Query:  563 FQNDDVCTKCKQVFQFL-----ESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENT----QITLGSWQCQTCLDVIVV----------LRKDLAGVSAPEIVSLIKS---NVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACH 1405
            F +DD C  C  + + L     E  F +   ++ K L+E L C+ LP E+  TCK  +D  +      I S++    +C  + LC  +      ++ +   Q    L  I V             DL     P+  +L+ S   + C  L    +G C   V   V   +N L +  +P ++C    +C +  I  P + E  + +CD C       +  +       +  SF+ +   SH  ++  QC S    YA QL  ++   M       A+  C+   +   ++ P+  G  C   H
Sbjct:   37 FTDDDACQDCIHIIELLKDLISEGEFQEDVQEKIKGLLEKL-CDSLPGEIPKTCKEQVDKNLPLAITFISSIMIPGEVCAYLGLCDGQMRGQMKELIMNHMQKIVLLPDITVNSSIPCTLCTYVTDLLQCIIPKTQTLLISLLGDACQILPPLLRGQCTVLVKTYVKMLINFLLNFASPDKLCSVLRLCENLEI--PPSGEFFLSDCDSCLTLAVLTRLSLGTNATEPQAASFLHTVCQSHPDAL-PQCESFTQRYAGQLQGLLGKEM------AALQMCERARLCDDQAGPDAAGDPCTLGH 329          

HSP 2 Score: 60.077 bits (144), Expect = 4.996e-9
Identity = 64/282 (22.70%), Postives = 110/282 (39.01%), Query Frame = 2
Query:  296 DACMKFVQSVEAHIPKISEQEFVN-----LAGNL--ICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKN----------TNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITLGSW----QCQTCLDVIVVLRKDLA-GVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHS 1075
            DAC   +  +E     ISE EF       + G L  +C++L G+    CK++V+   PL    +S    P ++C  + +C             N M    +   I   +   CT C  V   L+ +  K        L ++  C  LP  ++  C +L+  YV  L N + +    D++C ++ LC  EN +I          C +CL + V+ R  L    + P+  S + +   S  +   +  C S+           L   +   Q+C    +C   +
Sbjct:   41 DACQDCIHIIELLKDLISEGEFQEDVQEKIKGLLEKLCDSLPGEIPKTCKEQVDKNLPLAITFISSIMIPGEVCAYLGLCDGQMRGQMKELIMNHMQKIVLLPDITVNSSIPCTLCTYVTDLLQCIIPKTQTLLISLLGDA--CQILPPLLRGQCTVLVKTYVKMLINFLLNFASPDKLCSVLRLC--ENLEIPPSGEFFLSDCDSCLTLAVLTRLSLGTNATEPQAASFLHTVCQSHPDALPQ--CESFTQRYAGQLQGLLGKEMAALQMCERARLCDDQA 316          
BLAST of Proactivator polypeptide vs. Ensembl Cavefish
Match: psap (prosaposin [Source:ZFIN;Acc:ZDB-GENE-020108-1])

HSP 1 Score: 53.1434 bits (126), Expect = 9.774e-7
Identity = 92/483 (19.05%), Postives = 169/483 (34.99%), Query Frame = 2
Query:  158 CLKGPTYWCATYQNAEKCDRITECFMGQGDQKNKVDISHHKNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKS-QLDCKKEVNFFAPLIYRELSME-ATPEKICGLVQVCKNTNAMSFSKI---FNSI---------------------------KFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKS-ISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSE 1507
            C  GP YWC   + A  C  +  C      Q+N  +    K+   CD C + +  V+  +   S +  +       C  +  ++   +CK+ V+ + P++   +  E   P  +CG + +C +    + +K+   FN I                           K ++DDVC  C +        F   + +E K    S   N L  ++++ C LL  G    +      +L    IC     C      + + +                +A  + P + SL  + V                            + L P                K +   +   +C +CE  +   +  I       +V   ++ K+C+ L S +++QC  L++ Y   +I ++    D K IC  +  CKG S    K+     G  CD C +AV  +   +   A +  I+  ++ ++C     E
Sbjct:   23 CAHGPPYWCKNVKTASLCGAVLHC------QQNVWNQPQMKSVP-CDLCKEVLVVVDQLLKDNSTEAEILGYMEKTCQLIPDENLAAECKELVDNYYPILMGIIKGELEDPSVVCGALGLCVSQEE-ALAKLQLQFNEIPKVDLNQRISPFLLNVPQLLYPQETDKKEEDDDVCEDCVK--------FIAAAQEEAKQ--NSTFVNSLIQQIEAQCDLLGPGLSDMVMIHYSCVLQPKDICSRAGFCDGTPKSVPMQTL---------------VAAKTIPAVKSLPATKVVE-------------------------ATPLKP---------------AKKMVRAREPPQCAICEYVMKELEDMIQDQTTEEEVMQAVE-KVCNILPSTLTAQCKDLIETYGQAIIELLVQEADPKTICTVLGLCKGASPVMEKADFQAGGF-CDVCKMAVRYVDGILEQNATEAQIEEAVR-KVCNFLPDE 429          
BLAST of Proactivator polypeptide vs. Ensembl Nematostella
Match: EDO31455 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXX5])

HSP 1 Score: 119.013 bits (297), Expect = 3.177e-28
Identity = 109/407 (26.78%), Postives = 183/407 (44.96%), Query Frame = 2
Query: 1085 PIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHM-DSKAICIAINAC-------KGFSISQRKSAPNFKGI------ECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIILNFVLSEL-DVDKVCKVMGMCSMKKVSGI-----------------------------ECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL-GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCS-----LISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKPTLCNELRLCNS 2152
            P+ S K   EC  C+  V    +  S P   N++ S IK   C+ L   +S+C SLV+ Y   +I +I + + +   +C  I  C       K   +      P  K +      EC  C  AV  + +++S+PA +  I   L  ++C  F +EK  C+ +V+ F   I+  ++S L D  K+C  +G+C+  KV  +                             EC +CE VM E+  +   N +QQ +   +E K+C  L   +K++C   +  Y P +  +    ++ K++C  L LC+     +  ++   L++ SN       C+IC  V++ L   L N    + I NFLE  VC +  ++   EC   +++Y S V+ II      TLC E+ LC++
Sbjct:   17 PVVSPKD--ECTTCKELVKTIYTMASDPTAQNQILSLIKDA-CTFLGPEASECKSLVETYGKAIIQLILSQLSNPDQVCKEIGLCTSKTEMLKKIVMRHLHKTPITKPVLRSPKDECITCQEAVNTVYKFVSNPAIEDEIVALLS-KVCSEFGAEKATCEAVVNTFGKQIVQTLVSLLSDGKKLCTEIGLCTANKVKAMLVQAAASHKVMFTPKKHVLKATYPVKTSTECVLCEFVMKELDDMLSKNSTQQEIIQAVE-KVCSILPSTIKSKCDQFVQEYGPALIEILEQEVSPKLVCTTLGLCANREHRIAMRRSHKLVIGSN-----ETCEICTTVMTYLKAFLNNNATDEEIVNFLEK-VCNYLPSQIASECNAIVSEYGSTVLQIIANTDPTTLCKEIGLCSA 412          

HSP 2 Score: 85.1149 bits (209), Expect = 3.051e-17
Identity = 101/395 (25.57%), Postives = 174/395 (44.05%), Query Frame = 2
Query:  575 DVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLL-DGDRICPLIHLCSSEN----------------TQITLGSW--QCQTCLDVIVVLRKDLAGVS-APEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTP-QQICGNHHVCTSHSIK---------------------KPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKS-ISSQCSSLVDAYADQLITMISNHMDSKAICIAINAC--KGFSISQRKSAPNFKGIE--CDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSE-KIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCS 1615
            D CT CK++ + + +M S  +       +    C  L  E  S CK L++ Y   +  LI S L + D++C  I LC+S+                 T+  L S   +C TC + +  + K ++  +   EIV+L+ S VCS+    EK  C + V+      V  L S L+  +++C    +CT++ +K                     K     K   EC LCE  +      +SK     ++   ++ K+CS L S I S+C   V  Y   LI ++   +  K +C  +  C  +   I+ R+S     G    C+ C   +T +K ++++ A    I NFL+ ++C    S+   +C  +V E+   +L  +++  D   +CK +G+CS
Sbjct:   23 DECTTCKELVKTIYTMASDPTAQNQILSLIKDACTFLGPEA-SECKSLVETYGKAIIQLILSQLSNPDQVCKEIGLCTSKTEMLKKIVMRHLHKTPITKPVLRSPKDECITCQEAVNTVYKFVSNPAIEDEIVALL-SKVCSEFGA-EKATCEAVVNTFGKQIVQTLVSLLSDGKKLCTEIGLCTANKVKAMLVQAAASHKVMFTPKKHVLKATYPVKTSTECVLCEFVMKELDDMLSKNSTQQEIIQAVE-KVCSILPSTIKSKCDQFVQEYGPALIEILEQEVSPKLVCTTLGLCANREHRIAMRRSHKLVIGSNETCEICTTVMTYLKAFLNNNATDEEIVNFLE-KVCNYLPSQIASECNAIVSEYGSTVLQ-IIANTDPTTLCKEIGLCS 411          

HSP 3 Score: 83.5741 bits (205), Expect = 1.009e-16
Identity = 92/396 (23.23%), Postives = 172/396 (43.43%), Query Frame = 2
Query:  839 QCQTCLDVIVVLRKDLAGVSAP-EIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLT-PQQICGNHHVCTS-----------HSIKKPIASEKGVI-----ECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLI-TMISNHMDSKAICIAINACKGFSISQ--------------------RKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSE-KIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMC-------SMKKV------SGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL-GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCS 1864
            +C TC +++  +    +  +A  +I+SLIK + C+ L   E   C S V       +  + S L+ P Q+C    +CTS           H  K PI   K V+     EC  C+  V     F+S P   +++ + + SK+CS   +  + C ++V+ +  Q++ T++S   D K +C  I  C    +                      + + P     EC  C   + ++ + +S  + +  I   ++ ++C I  S  K +C Q V E+   ++  +  E+    VC  +G+C       +M++       S   CE+C  VM  +     +N + + + NF+E K+C  L   + +EC +++  Y   +  +  +T +   +C E+ LCS
Sbjct:   24 ECTTCKELVKTIYTMASDPTAQNQILSLIK-DACTFLGP-EASECKSLVETYGKAIIQLILSQLSNPDQVCKEIGLCTSKTEMLKKIVMRHLHKTPIT--KPVLRSPKDECITCQEAVNTVYKFVSNPAIEDEIVALL-SKVCSEFGAEKATCEAVVNTFGKQIVQTLVSLLSDGKKLCTEIGLCTANKVKAMLVQAAASHKVMFTPKKHVLKATYPVKTSTECVLCEFVMKELDDMLSKNSTQQEIIQAVE-KVCSILPSTIKSKCDQFVQEYGPALIEILEQEVSPKLVCTTLGLCANREHRIAMRRSHKLVIGSNETCEICTTVMTYLKAFLNNNATDEEIVNFLE-KVCNYLPSQIASECNAIVSEYGSTVLQIIANT-DPTTLCKEIGLCS 411          

HSP 4 Score: 65.4698 bits (158), Expect = 4.916e-11
Identity = 60/239 (25.10%), Postives = 105/239 (43.93%), Query Frame = 2
Query: 1637 ECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRLGFVKTECTSLIDTYLPVIFSLARSTL-NSKVICAELKLCSLISQ--KKINL-------LMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAKKQECINDINQYYSLVINIITEFLK--PTLCNELRLCNSTTTSIIMSQP-------------LVKMSRAI-LSSNCQLCEKFYFHLQKIFLKNT 2275
            EC  C+ ++  +  +A    +Q  + + I++  C  LG   +EC SL++TY   I  L  S L N   +C E+ LC+  ++  KKI +       + K  +     +C  C   V+ +   ++NP I+  I   L + VC  FGA+K  C   +N +   ++  +   L     LC E+ LC +     ++ Q              ++K +  +  S+ C LCE     L  +  KN+
Sbjct:   24 ECTTCKELVKTIYTMASDPTAQNQILSLIKDA-CTFLGPEASECKSLVETYGKAIIQLILSQLSNPDQVCKEIGLCTSKTEMLKKIVMRHLHKTPITKPVLRSPKDECITCQEAVNTVYKFVSNPAIEDEIVALL-SKVCSEFGAEKATCEAVVNTFGKQIVQTLVSLLSDGKKLCTEIGLCTANKVKAMLVQAAASHKVMFTPKKHVLKATYPVKTSTECVLCEFVMKELDDMLSKNS 260          

HSP 5 Score: 60.077 bits (144), Expect = 2.801e-9
Identity = 54/234 (23.08%), Postives = 102/234 (43.59%), Query Frame = 2
Query:  278 KNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITLGSWQCQTCLDV-IVVLRKDLAGVSAPEIVSLIKSNV-CSKLNFFEKGICN 973
            K    C  C   ++ ++  + K S Q+ +  A   +C+ L    +  C + V  + P +   L  E +P+ +C  + +C N       +  + +   +++ C  C  V  +L++  +  + DE        +CN LPS++ S C  ++  Y + +  +I +  D   +C  I LCS+ N  +       +  L   IV  R DL  + AP   +  ++ V C  ++F EK   N
Sbjct:  237 KTSTECVLCEFVMKELDDMLSKNSTQQEIIQAVEKVCSILPSTIKSKCDQFVQEYGPALIEILEQEVSPKLVCTTLGLCANREHRIAMRRSHKLVIGSNETCEICTTVMTYLKAFLNNNATDEEIVNFLEKVCNYLPSQIASECNAIVSEYGSTVLQIIAN-TDPTTLCKEIGLCSA-NQHVMKAKILSKHILKAKIVAKRDDLCYLGAPYWCADRRNAVNCEAVHFCEKHAWN 468          
BLAST of Proactivator polypeptide vs. Ensembl Nematostella
Match: EDO39178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAT7])

HSP 1 Score: 72.0182 bits (175), Expect = 2.739e-13
Identity = 79/321 (24.61%), Postives = 131/321 (40.81%), Query Frame = 2
Query: 1391 CDACHLAVTKIKEYISDPARKTSIKNFLKMRICP----IFQSEKIQCQQLVDEFF-------DIILN-----------------FVLSEL-----------DVDKVCKVMGMC------------------SMKKVSGIE-CEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRLGFVKTECTSLIDTYLPVIFS-LARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKPT-LCNELRLCNSTTTSII 2170
            C  C   V K+K+ + D + +  +K  L   IC      F  E   C+++VD +F       DIIL                   VL  L           D  +VC  +G+C                  S+  V   E C +CE  +D++  +   N  Q  +   +E+      G     C +L+D Y P+I S L +   NSK +C  L LCS  + + +         DD+ +C +C FV+ E+  LL     Q+ IE  L   VC       +  C   + +Y  ++++++ E + P  +C+ + LCNS   +++
Sbjct:   60 CAICEAVVGKVKDALDDKSMEGKVKAILD-EICDKDGGFFAGE---CKKVVDTYFTMIISQLDIILQNPKQVCTTLGLCSAEAEEVLKRLLWQALEGGDQQDSKQVCTELGLCIAGNRKAMMDNLIQHVLRSLPSVHNSEVCSICELAVDKIRDVIGDNSIQAEIKGVLEDACVKEGGAYAGVCKALVDQYFPIIISHLDKLVQNSKQVCTALGLCS--ADRWV-----CPRPDDAPQCVLCEFVMKEIKQLLAKDTTQQGIEKAL-MMVCSIMPETIRNNCDKFVTEYTPIIMSLLLEEVDPAKVCSMIGLCNSPAAALV 368          

HSP 2 Score: 69.707 bits (169), Expect = 1.684e-12
Identity = 78/364 (21.43%), Postives = 147/364 (40.38%), Query Frame = 2
Query:  551 NSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDR-ICPLIHLCSSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHMD-----SKAICIAINACKG--FSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIF-QSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCS 1615
            NS+   N D C  C+ V   ++      S +     I   IC++        CK ++D Y T + + +  +L   + +C  + LCS+E  ++            +  +L + L G    +        VC++L     G   + + NL+   +  L S         N  VC+                  +CE+ V   +  I       ++K  ++        + +  C +LVD Y      +I +H+D     SK +C A+  C    +   +   AP     +C  C   + +IK+ ++    +  I+  L M +C I  ++ +  C + V E+  II++ +L E+D  KVC ++G+C+
Sbjct:   50 NSVWKYNQDTCAICEAVVGKVKDALDDKSMEGKVKAILDEICDKDGGFFAGECKKVVDTYFTMIISQLDIILQNPKQVCTTLGLCSAEAEEV------------LKRLLWQALEGGDQQD-----SKQVCTELGLCIAGNRKAMMDNLIQHVLRSLPSV-------HNSEVCS------------------ICELAVDKIRDVIGDNSIQAEIKGVLEDACVKEGGAYAGVCKALVDQY----FPIIISHLDKLVQNSKQVCTALGLCSADRWVCPRPDDAP-----QCVLCEFVMKEIKQLLAKDTTQQGIEKAL-MMVCSIMPETIRNNCDKFVTEYTPIIMSLLLEEVDPAKVCSMIGLCN 361          

HSP 3 Score: 65.4698 bits (158), Expect = 4.013e-11
Identity = 80/396 (20.20%), Postives = 154/396 (38.89%), Query Frame = 2
Query:  158 CLKGPTYWCATYQNAEKCDRITECFMGQGDQKNKVDISHHKNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELS-MEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTL-TPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHL-KSISSQCSSLVDAYADQLITMISNHMDSKAICIAINAC 1336
            C+ GP YWC + ++A++CD +  C       KN V      N D C  C   V  V+  +   S +  V    + IC+   G    +CKK V+ +  +I  +L  +   P+++C  + +C         ++                  +Q LE    + S           +C +L   +    K ++D       NLI+ +L   R  P +H     N+++      C  C   +  +R  +   S    +  +  + C K      G+C + V    P  ++ L   +   +Q+C    +C++     P   +    +C LCE  +   K  ++K      ++  +   +CS + ++I + C   V  Y   +++++   +D   +C  I  C
Sbjct:   25 CVYGPAYWCRSLEHAQECDAVEHC-------KNSV---WKYNQDTCAICEAVVGKVKDALDDKSMEGKVKAILDEICDKDGGFFAGECKKVVDTYFTMIISQLDIILQNPKQVCTTLGLCSAEAEEVLKRLL-----------------WQALEGGDQQDSKQ---------VCTELGLCIAGNRKAMMD-------NLIQHVL---RSLPSVH-----NSEV------CSICELAVDKIRDVIGDNSIQAEIKGVLEDACVKEGGAYAGVCKALVDQYFPIIISHLDKLVQNSKQVCTALGLCSADRWVCPRPDDAP--QCVLCEFVMKEIKQLLAKDTTQQGIEKAL-MMVCSIMPETIRNNCDKFVTEYTPIIMSLLLEEVDPAKVCSMIGLC 360          
BLAST of Proactivator polypeptide vs. Ensembl Nematostella
Match: EDO38309 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDD7])

HSP 1 Score: 65.0846 bits (157), Expect = 4.631e-11
Identity = 48/177 (27.12%), Postives = 88/177 (49.72%), Query Frame = 2
Query: 1640 CEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL-GFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINL--LMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVC---PHFGAKKQECINDINQYYSLVINIITEFLKPTLCNELRLCNS 2152
            C +CE VM E+ ++   N +++ +   + NK+C  + G +++EC + +  Y P I  +       +++C ELKLCS      + +  L+K  +  +   C +C  VV ++ + L +    K IE+ L + +C   P    KKQ C   I  Y   +I+   +    T+C +L +C+S
Sbjct:  199 CVMCEFVMRELSKMLNENSTKEEIETAL-NKLCSYMPGSIQSECKTFVQEYTPFIIEILSKEFKPELVCRELKLCSAGGATYLAVAKLLKPRLTANKG-CDVCQTVVKDVQSALKDDVTVKGIEDML-SMICDYIPEVEIKKQ-CSVAIQHYVPELIDFFIKQDPKTICKDLDMCSS 371          

HSP 2 Score: 58.9214 bits (141), Expect = 4.628e-9
Identity = 65/309 (21.04%), Postives = 133/309 (43.04%), Query Frame = 2
Query: 1613 SMKKVSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRL-GFVKTECTSLIDTYLPVIF-SLARSTLNSKVICAELKLCSLISQKKI----------------NLLMKSNIN-------------DDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHF-GAKKQECINDINQYYSLVINIITEFLKPTL-CNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKNTPISPLT-VFANVCN-LEDTDETNECLKHFRNLNSIVAAFHASRNIGEFCKMTEMC 2434
            S+K+ +   C+ C+ V+ ++ + A     Q  +   + +K C  L   +  +C  ++   +  +F SL     +   +C +LKLCS  S+++I                +LLM   +                S  C +C FV+ EL  +L     ++ IE  L N +C +  G+ + EC   + +Y   +I I+++  KP L C EL+LC++   + +    L+K  R   +  C +C+     +Q     +  +  +  + + +C+ + + +   +C    ++    +  F   ++    CK  +MC
Sbjct:   64 SIKEKNSFPCDTCKEVIGKIKKFAEDESLQDKIIQTM-DKACSLLPSELSAKCKEVMGEAIKKLFASLDSIVKDPAALCKKLKLCSAQSKEEILKAVIKHLLSKDQQVSSLLMPGPVMMVPSRKPVHKLMIKTSETCVMCEFVMRELSKMLNENSTKEEIETAL-NKLCSYMPGSIQSECKTFVQEYTPFIIEILSKEFKPELVCRELKLCSAGGATYLAVAKLLK-PRLTANKGCDVCQTVVKDVQSALKDDVTVKGIEDMLSMICDYIPEVEIKKQCSVAIQHYVPELIDFFIKQDPKTICKDLDMC 369          

HSP 3 Score: 54.299 bits (129), Expect = 1.221e-7
Identity = 71/349 (20.34%), Postives = 135/349 (38.68%), Query Frame = 2
Query:  158 CLKGPTYWCATYQNAEKCDRITECFMGQGDQKNKVDISHHKNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYREL-SMEATPEKICGLVQVC------------------KNTNAMSF-----------SKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENT-----------QITL--GSWQCQTCL-DVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFE-KGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTS 1069
            C  GP+YWC     A +CD +  C   +   KN +     KN   CD C + +  ++      S Q+ +    +  C+ L  +    CK+ +      ++  L S+   P  +C  +++C                  K+    S             K  + +  +  + C  C+ V + L  M ++ S  E      + +C+ +P  +QS CK  +  Y   +  ++      + +C  + LCS+              ++T   G   CQT + DV   L+ D+      +++S+I    C  +   E K  C+  + + VP  ++       P+ IC +  +C+S
Sbjct:   33 CTWGPSYWCQGMAQAVECDAVKHC--QEKVWKNSI---KEKNSFPCDTCKEVIGKIKKFAEDESLQDKIIQTMDKACSLLPSELSAKCKEVMGEAIKKLFASLDSIVKDPAALCKKLKLCSAQSKEEILKAVIKHLLSKDQQVSSLLMPGPVMMVPSRKPVHKLMIKTSETCVMCEFVMRELSKMLNENSTKEEIETALNKLCSYMPGSIQSECKTFVQEYTPFIIEILSKEFKPELVCRELKLCSAGGATYLAVAKLLKPRLTANKGCDVCQTVVKDVQSALKDDVTVKGIEDMLSMI----CDYIPEVEIKKQCSVAIQHYVPELID-FFIKQDPKTICKDLDMCSS 371          

HSP 4 Score: 53.1434 bits (126), Expect = 3.319e-7
Identity = 46/183 (25.14%), Postives = 89/183 (48.63%), Query Frame = 2
Query:  278 KNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNA--MSFSKIFNSIKFQNDDVCTKCKQVFQFLESMF-SKVSPDEFKFLIESLICNQLPS-EVQSTCKLLLDGYVTQLYN-LIKSLLDGDRICPLIHLCSSE 811
            K  + C  C   ++ +   + + S +E +  A N +C+ + G  Q +CK  V  + P I   LS E  PE +C  +++C    A  ++ +K+    +   +  C  C+ V + ++S     V+    + ++ S+IC+ +P  E++  C + +  YV +L +  IK   D   IC  + +CSS+
Sbjct:  194 KTSETCVMCEFVMRELSKMLNENSTKEEIETALNKLCSYMPGSIQSECKTFVQEYTPFIIEILSKEFKPELVCRELKLCSAGGATYLAVAKLLKP-RLTANKGCDVCQTVVKDVQSALKDDVTVKGIEDML-SMICDYIPEVEIKKQCSVAIQHYVPELIDFFIKQ--DPKTICKDLDMCSSK 372          

HSP 5 Score: 48.9062 bits (115), Expect = 6.161e-6
Identity = 19/40 (47.50%), Postives = 24/40 (60.00%), Query Frame = 2
Query: 2447 KHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVWN 2566
            K  +G K+C+WGP +WC     A  C   AVKHC+ KVW 
Sbjct:   25 KFLLGSKKCTWGPSYWCQGMAQAVEC--DAVKHCQEKVWK 62          
BLAST of Proactivator polypeptide vs. Ensembl Medaka
Match: psap (prosaposin [Source:NCBI gene;Acc:101163196])

HSP 1 Score: 101.293 bits (251), Expect = 9.010e-22
Identity = 102/487 (20.94%), Postives = 192/487 (39.43%), Query Frame = 2
Query: 1370 PNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKI--QCQQLVDEFFDIILNFVLSEL-DVDKVCKVMGMCSMKKVSGIECEVCERVM----------------------------------------DEVIQ-----LAFSNHSQQVVSNFIENKI------CPRLG-FVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLI-------------------SQKKINLLMKSNINDDSAK----------CKICHFVVSELLTLLTNPDIQKSIENFLEN--HVCPHFGAKKQECINDINQYYSLVINIITEFLKP-TLCNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKNTPISPLT-VFANVCNLEDTDETNECLKHFRNLNSIVAAFHASRNIGEF-CKMTEMCKGSKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVW 2563
            P  K + CD C   +  +++ + D A +  I  +L+ + C +   + +  QC+++VD ++ +++  +  EL D   VC  MG+C  ++ S  + +V E++                                         DEV Q     L  +    +  S+FI + I      C  LG  +   C   +  Y PV+     S +  K ICA    CS +                   S   + L   + +   +AK          C IC FV+ ++  +LT+   ++ +   ++   ++ P   +   +C + I  Y   +I ++ + + P T+C  L LCN  + + +++   +   R      C++C+    ++  I  KN   + +      VC+        EC +       ++          +F C     C  +++  +G++QC+WGPGFWC + + A  C   AV HC   VW
Sbjct:   54 PQMKSVPCDMCKEVLMVVEQLLKDNATEADILKYLE-KACQLIPDQGLTEQCKEMVDSYYPVLIGIITGELEDAGVVCAAMGLCKSQQASLAKLQVKEQLTSNDIPQVDLSHQAAPFLLNIPGLLYPQNLKEKQEVPQQGGDEVCQDCIKFLTDAQAEAKANSSFINSLIQNIEGQCDLLGPGLSDMCKQYVGQYGPVVVQQLMS-MQPKQICAMAGFCSEVKKSVPMMTLQAAKTIPAAKSIPALELFPATKVEAAAAKRLVRVKESPQCAICEFVMKQVEAMLTDETTEEEVIQAVQKVCYLVPS--SLTAQCKDLIETYGEAIIELLVQEVDPKTVCTMLALCNDASRAYVVA---LDQPRFKTGGYCEVCKMAVGYIDGILEKNATEAEIEEAVKKVCSFLPDAYKTECDQLVEQYEPVLVQLLLQMLDPDFVCTKVGACPEAERKLLGREQCTWGPGFWCKNMETANMC--NAVAHCRRHVW 531          

HSP 2 Score: 68.9366 bits (167), Expect = 1.496e-11
Identity = 102/477 (21.38%), Postives = 191/477 (40.04%), Query Frame = 2
Query:  491 ICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMF--SKVSPDEFKFLIESLICNQLPSE-VQSTCKLLLDGYVTQLYNLIKSLL-DGDRICPLIHLCSSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVS----LIKSNVCSKLNFFEKG----------------------------------------------ICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCT---------SHSIKKPIASEKGVIECDL---CEIGVTGAKSFISKPEN---------MNKVKSFIKS------------KICSHLKS-ISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKS--APNFK-GIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIF-QSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMC--SMKKVSGIE 1639
            +CG V  C+         ++N  + ++   C  CK+V   +E +   +    D  K+L ++  C  +P + +   CK ++D Y   L  +I   L D   +C  + LC S+  Q +L   Q +  L    + + DL+  +AP +++    L   N+  K    ++G                                              +C  YV    P  V +L S + P+QIC     C+         +    K I + K +   +L    ++    AK  +   E+         M +V++ +              K+C  + S +++QC  L++ Y + +I ++   +D K +C  +  C   S +   +   P FK G  C+ C +AV  I   +   A +  I+  +K ++C     + K +C QLV+++  +++  +L  LD D VC  +G C  + +K+ G E
Sbjct:   39 LCGAVAHCQQN-------VWNKPQMKSVP-CDMCKEVLMVVEQLLKDNATEADILKYLEKA--CQLIPDQGLTEQCKEMVDSYYPVLIGIITGELEDAGVVCAAMGLCKSQ--QASLAKLQVKEQLTSNDIPQVDLSHQAAPFLLNIPGLLYPQNLKEKQEVPQQGGDEVCQDCIKFLTDAQAEAKANSSFINSLIQNIEGQCDLLGPGLSDMCKQYVGQYGPVVVQQLMS-MQPKQICAMAGFCSEVKKSVPMMTLQAAKTIPAAKSIPALELFPATKVEAAAAKRLVRVKESPQCAICEFVMKQVEAMLTDETTEEEVIQAVQKVCYLVPSSLTAQCKDLIETYGEAIIELLVQEVDPKTVCTMLALCNDASRAYVVALDQPRFKTGGYCEVCKMAVGYIDGILEKNATEAEIEEAVK-KVCSFLPDAYKTECDQLVEQYEPVLVQLLLQMLDPDFVCTKVGACPEAERKLLGRE 501          
BLAST of Proactivator polypeptide vs. Ensembl Medaka
Match: sftpbb (prosaposin-like [Source:NCBI gene;Acc:101161410])

HSP 1 Score: 71.2478 bits (173), Expect = 9.988e-13
Identity = 72/289 (24.91%), Postives = 124/289 (42.91%), Query Frame = 2
Query: 1727 NKICPRLGFVK-TECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKK-------INLLMKSNINDDSAK---------CKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKP-TLCNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFY-FHLQKIFLKNTPISPLTVFANVCNLEDTDETNECLKHFRNLNSIVAAFHASR-NIGEFCKMTEMCKGSKKHHV-GKKQCSWGPGFWCISRQHAAGCG 2527
            + +C RL   + ++C S + TYLP +     S LN    C    LC+    ++       +N    SN    SA          C +C  V+ +L T+L     + +I   +E  VC    A  KQ+C + +N+Y + +   +     P T+C  L LC      +   QP+ ++   +L S+C+ C      H   + L  T         +VC++   +   +C    R   S +     ++ +I   C+  ++C+  KK  + G   C+WGP +WC +R+ A  CG
Sbjct:   45 HAVCRRLPERQASDCQSQVKTYLPKVLQQKPSHLNPSETCVVFGLCAPQKDEELQEPPPSVNSEALSNSAPASATETQKISGPVCALCLMVIRKLETMLPKNISEDAILKIMEE-VCDLVPASYKQQCDDFVNKYGADIAEFLFSSAAPHTICMVLHLC------LFKEQPVPEV---LLPSDCESCRTLAALHRVHLGLNATGAQTSAFLQSVCSIH-PNAIPKCDAFTRAYGSQLHRVLGNQMDISHTCERADLCQTMKKLDLLGSNPCTWGPSYWCQNRETAQKCG 322          

HSP 2 Score: 52.7582 bits (125), Expect = 9.957e-7
Identity = 60/290 (20.69%), Postives = 107/290 (36.90%), Query Frame = 2
Query:  548 FNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLC--------------------------SSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACK 1339
            F + + Q+ D+C +C Q+ +   +M S        +     +C +LP    S C+  +  Y+ ++     S L+    C +  LC                          S+  TQ   G   C  CL VI  L   L    + + +  I   VC  +    K  C+ +V+         L S+  P  IC   H+C     ++P+       +C+ C       +  +       +  +F++S +CS   +   +C +   AY  QL  ++ N MD    C   + C+
Sbjct:    6 FITQELQSLDLCGECSQIIRTSTNMISGSDTKVTVYEALHAVCRRLPERQASDCQSQVKTYLPKVLQQKPSHLNPSETCVVFGLCAPQKDEELQEPPPSVNSEALSNSAPASATETQKISGPV-CALCLMVIRKLETMLPKNISEDAILKIMEEVCDLVPASYKQQCDDFVNKYGADIAEFLFSSAAPHTICMVLHLCLFK--EQPVPEVLLPSDCESCRTLAALHRVHLGLNATGAQTSAFLQS-VCSIHPNAIPKCDAFTRAYGSQLHRVLGNQMDISHTCERADLCQ 291          

HSP 3 Score: 51.9878 bits (123), Expect = 1.663e-6
Identity = 50/237 (21.10%), Postives = 97/237 (40.93%), Query Frame = 2
Query:  287 DYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCK--------------NTNAMSFSKIFNSIKFQ--NDDVCTKCKQVFQFLESMFSK-VSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQI--TLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCS 940
            D C  C + +++    I     +  V  A + +C  L  +   DC+ +V  + P + ++      P + C +  +C               N+ A+S S   ++ + Q  +  VC  C  V + LE+M  K +S D    ++E  +C+ +P+  +  C   ++ Y   +   + S      IC ++HLC  +   +   L    C++C  +  + R  L   +     S    +VCS
Sbjct:   15 DLCGECSQIIRTSTNMISGSDTKVTVYEALHAVCRRLPERQASDCQSQVKTYLPKVLQQKPSHLNPSETCVVFGLCAPQKDEELQEPPPSVNSEALSNSAPASATETQKISGPVCALCLMVIRKLETMLPKNISEDAILKIMEE-VCDLVPASYKQQCDDFVNKYGADIAEFLFSSAAPHTICMVLHLCLFKEQPVPEVLLPSDCESCRTLAALHRVHLGLNATGAQTSAFLQSVCS 250          
BLAST of Proactivator polypeptide vs. Ensembl Medaka
Match: sftpbb (prosaposin-like [Source:NCBI gene;Acc:101161410])

HSP 1 Score: 71.2478 bits (173), Expect = 1.258e-12
Identity = 72/289 (24.91%), Postives = 124/289 (42.91%), Query Frame = 2
Query: 1727 NKICPRLGFVK-TECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKK-------INLLMKSNINDDSAK---------CKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAK-KQECINDINQYYSLVINIITEFLKP-TLCNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFY-FHLQKIFLKNTPISPLTVFANVCNLEDTDETNECLKHFRNLNSIVAAFHASR-NIGEFCKMTEMCKGSKKHHV-GKKQCSWGPGFWCISRQHAAGCG 2527
            + +C RL   + ++C S + TYLP +     S LN    C    LC+    ++       +N    SN    SA          C +C  V+ +L T+L     + +I   +E  VC    A  KQ+C + +N+Y + +   +     P T+C  L LC      +   QP+ ++   +L S+C+ C      H   + L  T         +VC++   +   +C    R   S +     ++ +I   C+  ++C+  KK  + G   C+WGP +WC +R+ A  CG
Sbjct:   69 HAVCRRLPERQASDCQSQVKTYLPKVLQQKPSHLNPSETCVVFGLCAPQKDEELQEPPPSVNSEALSNSAPASATETQKISGPVCALCLMVIRKLETMLPKNISEDAILKIMEE-VCDLVPASYKQQCDDFVNKYGADIAEFLFSSAAPHTICMVLHLC------LFKEQPVPEV---LLPSDCESCRTLAALHRVHLGLNATGAQTSAFLQSVCSIH-PNAIPKCDAFTRAYGSQLHRVLGNQMDISHTCERADLCQTMKKLDLLGSNPCTWGPSYWCQNRETAQKCG 346          

HSP 2 Score: 53.1434 bits (126), Expect = 8.426e-7
Identity = 60/290 (20.69%), Postives = 107/290 (36.90%), Query Frame = 2
Query:  548 FNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLC--------------------------SSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACK 1339
            F + + Q+ D+C +C Q+ +   +M S        +     +C +LP    S C+  +  Y+ ++     S L+    C +  LC                          S+  TQ   G   C  CL VI  L   L    + + +  I   VC  +    K  C+ +V+         L S+  P  IC   H+C     ++P+       +C+ C       +  +       +  +F++S +CS   +   +C +   AY  QL  ++ N MD    C   + C+
Sbjct:   30 FITQELQSLDLCGECSQIIRTSTNMISGSDTKVTVYEALHAVCRRLPERQASDCQSQVKTYLPKVLQQKPSHLNPSETCVVFGLCAPQKDEELQEPPPSVNSEALSNSAPASATETQKISGP-VCALCLMVIRKLETMLPKNISEDAILKIMEEVCDLVPASYKQQCDDFVNKYGADIAEFLFSSAAPHTICMVLHLCLFK--EQPVPEVLLPSDCESCRTLAALHRVHLGLNATGAQTSAFLQS-VCSIHPNAIPKCDAFTRAYGSQLHRVLGNQMDISHTCERADLCQ 315          

HSP 3 Score: 51.9878 bits (123), Expect = 1.587e-6
Identity = 50/237 (21.10%), Postives = 97/237 (40.93%), Query Frame = 2
Query:  287 DYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCK--------------NTNAMSFSKIFNSIKFQ--NDDVCTKCKQVFQFLESMFSK-VSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQI--TLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCS 940
            D C  C + +++    I     +  V  A + +C  L  +   DC+ +V  + P + ++      P + C +  +C               N+ A+S S   ++ + Q  +  VC  C  V + LE+M  K +S D    ++E  +C+ +P+  +  C   ++ Y   +   + S      IC ++HLC  +   +   L    C++C  +  + R  L   +     S    +VCS
Sbjct:   39 DLCGECSQIIRTSTNMISGSDTKVTVYEALHAVCRRLPERQASDCQSQVKTYLPKVLQQKPSHLNPSETCVVFGLCAPQKDEELQEPPPSVNSEALSNSAPASATETQKISGPVCALCLMVIRKLETMLPKNISEDAILKIMEE-VCDLVPASYKQQCDDFVNKYGADIAEFLFSSAAPHTICMVLHLCLFKEQPVPEVLLPSDCESCRTLAALHRVHLGLNATGAQTSAFLQSVCS 274          
BLAST of Proactivator polypeptide vs. Planmine SMEST
Match: SMESG000042333.1 (SMESG000042333.1)

HSP 1 Score: 1673.68 bits (4333), Expect = 0.000e+0
Identity = 819/826 (99.15%), Postives = 824/826 (99.76%), Query Frame = 2
Query:  101 MRFLIFGFLISVCYAFDFDCLKGPTYWCATYQNAEKCDRITECFMGQGDQKNKVDISHHKNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCSMKKVSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRLGFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAKKQECINDINQYYSLVINIITEFLKPTLCNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKNTPISPLTVFANVCNLEDTDETNECLKHFRNLNSIVAAFHASRNIGEFCKMTEMCKGSKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVWNQMPN 2578
            MRFLIFGFLISVCYAFDFDCLKGPTYWCATYQNAEKCDRITECFMGQGDQKNKVDISHHKNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAP+IYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENT+ITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLI+SNVCSKLNFFEKGICNSYVSNLVPTFVNELHS LTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIILNF+LSELDVDKVCKVMGMCSMKKVSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRLGFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAKKQECINDINQYYSLVINIITEFLKPTLCNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKNTPISPLTVFANVCNLEDTDETNECLKHFRNLNSIVAAFHASRNIGEFCKMT+MCK SKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVWNQMPN
Sbjct:    1 MRFLIFGFLISVCYAFDFDCLKGPTYWCATYQNAEKCDRITECFMGQGDQKNKVDISHHKNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPIIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTRITLGSWQCQTCLDVIVVLRKDLAGVSAPEIVSLIQSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSILTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHMDSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIILNFILSELDVDKVCKVMGMCSMKKVSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRLGFVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAKKQECINDINQYYSLVINIITEFLKPTLCNELRLCNSTTTSIIMSQPLVKMSRAILSSNCQLCEKFYFHLQKIFLKNTPISPLTVFANVCNLEDTDETNECLKHFRNLNSIVAAFHASRNIGEFCKMTKMCKRSKKHHVGKKQCSWGPGFWCISRQHAAGCGPGAVKHCEMKVWNQMPN 826          
BLAST of Proactivator polypeptide vs. Planmine SMEST
Match: SMESG000019975.1 (SMESG000019975.1)

HSP 1 Score: 59.6918 bits (143), Expect = 2.026e-9
Identity = 54/208 (25.96%), Postives = 98/208 (47.12%), Query Frame = 2
Query: 1565 LSELDVDKVCKVMGMCSMKKVSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRLGFV-KTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMKSNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGA-KKQECINDINQYYSLVINIITEF-LKPTLCNELRLCNSTTTSIIMSQ 2179
            +SE+++    K+  M + ++     C+VC++++ +VI    SNHS+ VV   +E K+C  L FV K  C  ++D +   I       L +  IC  + LCS       +L   S   + S  C IC  ++ E+   +    + + I+  LE  VC  F    + +C   +++Y   ++ +I E      +C+ L+LC +     I S+
Sbjct:   56 ISEIEIHAQIKI-KMTNSEENKSFGCDVCKKLIQQVIDAIGSNHSKDVVRKELE-KVCDGLPFVWKPVCKDIVDKFADTIVDEIVKNLPADKICQNIGLCS-------SLAAISPPREKSVLCWICSQIIEEIFKQIGERRVAEEIKRALEG-VCNIFPVIYRHQCNEFVDRYAVEIVKLILEGKAGGVICSALQLCETRNYPTIKSK 253          

HSP 2 Score: 53.5286 bits (127), Expect = 2.600e-7
Identity = 45/178 (25.28%), Postives = 75/178 (42.13%), Query Frame = 2
Query:  293 CDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLKGKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIFNSIKFQNDDVCTKCKQVFQFLESMFSKVS----PDEFKFLIESLICNQLPSEVQSTCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSEN 814
            CD C K +Q V   I     ++ V      +C+ L    +  CK  V+ FA  I  E+      +KIC  + +C +  A+S  +       +   +C  C Q+   +E +F ++      +E K  +E  +CN  P   +  C   +D Y  ++  LI     G  IC  + LC + N
Sbjct:   80 CDVCKKLIQQVIDAIGSNHSKDVVRKELEKVCDGLPFVWKPVCKDIVDKFADTIVDEIVKNLPADKICQNIGLCSSLAAISPPR-------EKSVLCWICSQI---IEEIFKQIGERRVAEEIKRALEG-VCNIFPVIYRHQCNEFVDRYAVEIVKLILEGKAGGVICSALQLCETRN 246          

HSP 3 Score: 51.2174 bits (121), Expect = 1.583e-6
Identity = 37/168 (22.02%), Postives = 75/168 (44.64%), Query Frame = 2
Query: 1379 KGIECDACHLAVTKIKEYISDPARKTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKVMGMCSM------KKVSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRLGFV-KTECTSLIDTYLPVIFSLARSTLNSKVICAELKLC 1861
            K   CD C   + ++ + I     K  ++  L+     +    K  C+ +VD+F D I++ ++  L  DK+C+ +G+CS        +   + C +C ++++E+ +        + +   +E  +C     + + +C   +D Y   I  L        VIC+ L+LC
Sbjct:   76 KSFGCDVCKKLIQQVIDAIGSNHSKDVVRKELEKVCDGLPFVWKPVCKDIVDKFADTIVDEIVKNLPADKICQNIGLCSSLAAISPPREKSVLCWICSQIIEEIFKQIGERRVAEEIKRALEG-VCNIFPVIYRHQCNEFVDRYAVEIVKLILEGKAGGVICSALQLC 242          

HSP 4 Score: 49.6766 bits (117), Expect = 4.994e-6
Identity = 42/170 (24.71%), Postives = 73/170 (42.94%), Query Frame = 2
Query:  833 SWQCQTCLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPTFVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAKSFISKPENMNKVKSFIKSKICSHLKSI-SSQCSSLVDAYADQLITMISNHMDSKAICIAINACK 1339
            S+ C  C  +I  +   +    + ++V      VC  L F  K +C   V     T V+E+   L   +IC N  +C+S +   P   EK V+ C +C   +      I +     ++K  ++  +C+    I   QC+  VD YA +++ +I        IC A+  C+
Sbjct:   77 SFGCDVCKKLIQQVIDAIGSNHSKDVVRKELEKVCDGLPFVWKPVCKDIVDKFADTIVDEIVKNLPADKICQNIGLCSSLAAISP-PREKSVL-CWICSQIIEEIFKQIGERRVAEEIKRALEG-VCNIFPVIYRHQCNEFVDRYAVEIVKLILEGKAGGVICSALQLCE 243          
The following BLAST results are available for this feature:
BLAST of Proactivator polypeptide vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
PSAP6.098e-1821.85prosaposin [Source:HGNC Symbol;Acc:HGNC:9498][more]
PSAP7.104e-1721.16prosaposin [Source:HGNC Symbol;Acc:HGNC:9498][more]
PSAPL19.807e-1321.32prosaposin like 1 (gene/pseudogene) [Source:HGNC S... [more]
PSAP3.293e-624.22prosaposin [Source:HGNC Symbol;Acc:HGNC:9498][more]
back to top
BLAST of Proactivator polypeptide vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
spp-104.863e-721.94SaPosin-like Protein family [Source:UniProtKB/TrE... [more]
spp-106.739e-621.16SaPosin-like Protein family [Source:UniProtKB/TrE... [more]
back to top
BLAST of Proactivator polypeptide vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Sap-r5.539e-2021.73gene:FBgn0000416 transcript:FBtr0085713[more]
Sap-r2.006e-1921.17gene:FBgn0000416 transcript:FBtr0085714[more]
back to top
BLAST of Proactivator polypeptide vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
psap1.731e-1720.99prosaposin [Source:ZFIN;Acc:ZDB-GENE-020108-1][more]
psap6.517e-1720.95prosaposin [Source:ZFIN;Acc:ZDB-GENE-020108-1][more]
sftpba3.631e-724.14surfactant protein Ba [Source:ZFIN;Acc:ZDB-GENE-09... [more]
back to top
BLAST of Proactivator polypeptide vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psap4.473e-1621.39prosaposin (variant Gaucher disease and variant me... [more]
psap1.129e-1523.35prosaposin (variant Gaucher disease and variant me... [more]
psap1.757e-1523.35prosaposin (variant Gaucher disease and variant me... [more]
psap4.207e-1422.98prosaposin (variant Gaucher disease and variant me... [more]
psap6.246e-1422.18prosaposin (variant Gaucher disease and variant me... [more]
back to top
BLAST of Proactivator polypeptide vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Psapl17.105e-1320.65prosaposin-like 1 [Source:MGI Symbol;Acc:MGI:19241... [more]
Psap3.223e-820.05prosaposin [Source:MGI Symbol;Acc:MGI:97783][more]
Psap5.249e-819.83prosaposin [Source:MGI Symbol;Acc:MGI:97783][more]
Psap5.320e-819.83prosaposin [Source:MGI Symbol;Acc:MGI:97783][more]
Psap8.981e-819.73prosaposin [Source:MGI Symbol;Acc:MGI:97783][more]
back to top
BLAST of Proactivator polypeptide vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P07602|SAP_HUMAN2.928e-1721.85Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV... [more]
sp|P26779|SAP_BOVIN2.497e-1520.74Prosaposin OS=Bos taurus OX=9913 GN=PSAP PE=1 SV=3[more]
sp|O13035|SAP_CHICK2.608e-1221.81Prosaposin OS=Gallus gallus OX=9031 GN=PSAP PE=1 S... [more]
sp|Q6NUJ1|SAPL1_HUMAN4.710e-1221.32Proactivator polypeptide-like 1 OS=Homo sapiens OX... [more]
sp|Q8C1C1|SAPL1_MOUSE6.291e-1220.65Proactivator polypeptide-like 1 OS=Mus musculus OX... [more]
back to top
BLAST of Proactivator polypeptide vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2R5L7001.574e-4423.22Putative prosaposin OS=Ornithodoros turicata OX=34... [more]
K1QNB64.958e-4421.88Proactivator polypeptide OS=Crassostrea gigas OX=2... [more]
A0A2G8K9Z36.777e-4423.52Uncharacterized protein OS=Stichopus japonicus OX=... [more]
A0A2T7PW465.433e-4122.00Uncharacterized protein OS=Pomacea canaliculata OX... [more]
R7VKI21.282e-4024.74Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of Proactivator polypeptide vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psap1.964e-1120.64prosaposin [Source:ZFIN;Acc:ZDB-GENE-020108-1][more]
sftpba3.115e-1123.08prosaposin-like [Source:NCBI gene;Acc:103040133][more]
sftpba8.351e-1122.77prosaposin-like [Source:NCBI gene;Acc:103040133][more]
sftpba8.351e-1122.77prosaposin-like [Source:NCBI gene;Acc:103040133][more]
psap9.774e-719.05prosaposin [Source:ZFIN;Acc:ZDB-GENE-020108-1][more]
back to top
BLAST of Proactivator polypeptide vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Proactivator polypeptide vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Proactivator polypeptide vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO314553.177e-2826.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391782.739e-1324.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383094.631e-1127.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Proactivator polypeptide vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
psap9.010e-2220.94prosaposin [Source:NCBI gene;Acc:101163196][more]
sftpbb9.988e-1324.91prosaposin-like [Source:NCBI gene;Acc:101161410][more]
sftpbb1.258e-1224.91prosaposin-like [Source:NCBI gene;Acc:101161410][more]
back to top
BLAST of Proactivator polypeptide vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000042333.10.000e+099.15SMESG000042333.1[more]
SMESG000019975.12.026e-925.96SMESG000019975.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019668 ID=SMED30019668|Name=Proactivator polypeptide|organism=Schmidtea mediterranea sexual|type=transcript|length=2787bp
CGAGGGACCGTTGTTTAAAATGATTTGTGATTAAAAAGGTCATATAAATA
CGATCGGAAAGATTTCAAATATCAAATATTAATACTATATTCTGTTCAAA
ATGAGATTCTTGATATTCGGGTTTCTCATTTCAGTTTGTTATGCTTTTGA
TTTTGATTGTTTGAAAGGGCCCACTTATTGGTGCGCAACTTATCAAAATG
CTGAAAAATGTGACCGAATAACTGAATGTTTTATGGGACAAGGAGATCAG
AAAAATAAAGTTGACATTTCTCATCACAAAAATGGGGACTATTGCGATGC
TTGCATGAAATTTGTACAAAGTGTTGAAGCGCATATTCCGAAAATATCAG
AACAGGAATTTGTTAATCTGGCTGGTAATTTAATCTGTAATAATCTTAAA
GGCAAATCACAATTGGACTGTAAAAAGGAAGTGAATTTTTTCGCGCCTTT
AATTTACCGGGAATTATCAATGGAAGCTACTCCTGAAAAAATATGTGGAT
TGGTACAAGTATGTAAAAATACAAACGCCATGTCCTTTTCAAAGATATTC
AACTCAATTAAATTTCAAAATGATGATGTGTGCACAAAATGCAAGCAAGT
ATTCCAATTTTTGGAATCAATGTTTTCAAAGGTATCACCGGACGAATTTA
AATTTCTCATAGAGAGTCTAATATGCAATCAATTACCATCAGAAGTCCAA
TCGACATGCAAACTTTTGCTCGATGGTTATGTCACTCAATTGTATAATTT
AATCAAATCGCTTCTCGATGGTGATCGAATCTGTCCATTAATCCATCTTT
GCTCATCAGAAAACACACAGATAACTCTAGGGTCATGGCAATGCCAAACT
TGCCTGGATGTCATTGTCGTTTTAAGAAAGGATTTGGCTGGTGTTTCTGC
ACCAGAAATTGTTTCGTTGATTAAAAGTAATGTGTGCTCGAAACTGAATT
TCTTTGAAAAAGGTATTTGCAACAGCTACGTATCAAACTTGGTACCGACT
TTCGTGAATGAGTTGCATTCGACATTGACACCGCAACAGATATGCGGCAA
TCACCATGTCTGCACCAGCCATAGCATCAAGAAGCCCATTGCATCTGAGA
AAGGTGTCATCGAGTGTGACCTATGCGAGATCGGGGTCACTGGCGCGAAA
TCATTTATTTCGAAACCAGAAAATATGAACAAAGTGAAATCGTTTATTAA
ATCAAAGATTTGCTCACATTTAAAGTCAATAAGTTCCCAATGTTCAAGCC
TTGTTGATGCATATGCTGACCAGTTGATAACCATGATATCAAATCACATG
GATTCGAAGGCCATTTGTATCGCTATCAATGCATGCAAAGGATTCAGTAT
TAGTCAACGGAAATCTGCACCGAATTTTAAAGGCATTGAGTGTGATGCAT
GCCATCTTGCTGTAACAAAAATAAAGGAATATATTTCTGATCCTGCGAGA
AAAACTTCGATCAAGAATTTTCTAAAAATGAGAATTTGTCCTATTTTTCA
ATCAGAAAAAATTCAGTGCCAACAATTGGTGGATGAGTTTTTCGATATAA
TTTTGAATTTCGTTTTGAGTGAGCTCGACGTTGACAAAGTGTGCAAAGTA
ATGGGCATGTGCTCAATGAAAAAAGTGTCCGGTATCGAATGTGAAGTCTG
TGAACGAGTAATGGATGAAGTAATTCAATTGGCATTCTCTAATCACTCTC
AACAAGTCGTTTCTAATTTCATCGAGAATAAAATCTGTCCTCGTTTGGGT
TTTGTTAAAACTGAATGCACCTCCTTAATCGATACCTATTTGCCTGTGAT
ATTCTCTCTTGCTCGTTCCACTTTGAATAGCAAAGTAATATGCGCTGAAC
TCAAGCTTTGTAGTCTTATTTCACAGAAAAAAATAAATTTACTAATGAAA
AGTAATATCAATGATGATTCCGCTAAATGTAAAATTTGCCATTTTGTTGT
ATCTGAACTGCTAACACTGCTTACAAATCCCGACATTCAAAAATCAATCG
AAAATTTCCTTGAAAACCATGTTTGTCCACATTTTGGAGCTAAAAAACAG
GAATGCATAAATGACATCAATCAATATTATTCTCTCGTTATCAACATCAT
TACCGAATTTCTGAAACCGACATTATGCAATGAACTGAGATTGTGTAACT
CTACTACAACGTCTATTATTATGAGCCAACCACTTGTGAAAATGTCTAGG
GCAATCCTATCATCTAATTGTCAGCTTTGCGAAAAGTTTTACTTTCACCT
GCAAAAGATTTTTTTAAAAAATACTCCCATCTCTCCTTTAACCGTATTTG
CTAATGTGTGTAACCTAGAGGATACAGATGAAACAAATGAATGCCTAAAA
CACTTTCGAAATCTCAATTCTATAGTTGCTGCTTTCCATGCATCAAGAAA
TATTGGAGAATTTTGTAAAATGACTGAAATGTGTAAGGGTTCAAAAAAGC
ACCACGTTGGTAAAAAACAATGCAGCTGGGGACCTGGATTTTGGTGTATA
AGCAGACAACATGCAGCCGGCTGTGGGCCCGGAGCTGTGAAACACTGTGA
AATGAAAGTTTGGAACCAGATGCCAAATTTTTAATTTGAAACTTATTACT
ATTACATTGAATTCCATTTTATAAAAGTGATCCGAATTCTGATCCTTTTT
GCTTTTACTTTTATACTGATTTTTTAAACGTTAATTGATTTTAAGAAAAT
ATTTTTATATCTGCTCATTTGCAGTTAGTTATCTATGTTAACATAAAAAT
AATTTTTAAATAAAACTTTAATAAAGTTCAAAAAAAA
back to top

protein sequence of SMED30019668-orf-1

>SMED30019668-orf-1 ID=SMED30019668-orf-1|Name=SMED30019668-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=828bp
MRFLIFGFLISVCYAFDFDCLKGPTYWCATYQNAEKCDRITECFMGQGDQ
KNKVDISHHKNGDYCDACMKFVQSVEAHIPKISEQEFVNLAGNLICNNLK
GKSQLDCKKEVNFFAPLIYRELSMEATPEKICGLVQVCKNTNAMSFSKIF
NSIKFQNDDVCTKCKQVFQFLESMFSKVSPDEFKFLIESLICNQLPSEVQ
STCKLLLDGYVTQLYNLIKSLLDGDRICPLIHLCSSENTQITLGSWQCQT
CLDVIVVLRKDLAGVSAPEIVSLIKSNVCSKLNFFEKGICNSYVSNLVPT
FVNELHSTLTPQQICGNHHVCTSHSIKKPIASEKGVIECDLCEIGVTGAK
SFISKPENMNKVKSFIKSKICSHLKSISSQCSSLVDAYADQLITMISNHM
DSKAICIAINACKGFSISQRKSAPNFKGIECDACHLAVTKIKEYISDPAR
KTSIKNFLKMRICPIFQSEKIQCQQLVDEFFDIILNFVLSELDVDKVCKV
MGMCSMKKVSGIECEVCERVMDEVIQLAFSNHSQQVVSNFIENKICPRLG
FVKTECTSLIDTYLPVIFSLARSTLNSKVICAELKLCSLISQKKINLLMK
SNINDDSAKCKICHFVVSELLTLLTNPDIQKSIENFLENHVCPHFGAKKQ
ECINDINQYYSLVINIITEFLKPTLCNELRLCNSTTTSIIMSQPLVKMSR
AILSSNCQLCEKFYFHLQKIFLKNTPISPLTVFANVCNLEDTDETNECLK
HFRNLNSIVAAFHASRNIGEFCKMTEMCKGSKKHHVGKKQCSWGPGFWCI
SRQHAAGCGPGAVKHCEMKVWNQMPNF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR008373Saposin
IPR008139SaposinB_dom
IPR003119SAP_A
IPR007856SapB_1
IPR011001Saposin-like
IPR008138SapB_2
Vocabulary: cellular component
TermDefinition
GO:0005764lysosome
Vocabulary: biological process
TermDefinition
GO:0006665sphingolipid metabolic process
GO:0006629lipid metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008373SaposinPRINTSPR01797SAPOSINcoord: 13..37
score: 26.86
coord: 128..146
score: 19.55
coord: 339..359
score: 19.05
coord: 388..406
score: 18.05
coord: 428..450
score: 22.36
coord: 482..505
score: 25.6
IPR003119Saposin A-type domainSMARTSM00162sapA_2coord: 787..822
e-value: 2.1E-7
score: 40.6
IPR003119Saposin A-type domainPFAMPF02199SapAcoord: 789..822
e-value: 1.4E-11
score: 44.5
coord: 19..43
e-value: 1.7E-6
score: 28.2
IPR003119Saposin A-type domainPROSITEPS51110SAP_Acoord: 13..53
score: 8.25
IPR003119Saposin A-type domainPROSITEPS51110SAP_Acoord: 784..826
score: 11.558
IPR008139Saposin B type domainSMARTSM00741sapb_4coord: 337..412
e-value: 2.5E-14
score: 63.6
coord: 512..587
e-value: 1.6E-11
score: 54.3
coord: 63..138
e-value: 1.3E-5
score: 34.7
coord: 246..321
e-value: 7.9E-6
score: 35.4
coord: 159..234
e-value: 1.4E-5
score: 34.5
coord: 608..682
e-value: 9.3E-6
score: 35.1
coord: 429..504
e-value: 5.9E-9
score: 45.8
IPR008139Saposin B type domainPROSITEPS50015SAP_Bcoord: 244..325
score: 13.246
IPR008139Saposin B type domainPROSITEPS50015SAP_Bcoord: 335..416
score: 14.291
IPR008139Saposin B type domainPROSITEPS50015SAP_Bcoord: 427..508
score: 13.932
IPR008139Saposin B type domainPROSITEPS50015SAP_Bcoord: 606..686
score: 10.391
IPR008139Saposin B type domainPROSITEPS50015SAP_Bcoord: 157..238
score: 15.212
IPR008139Saposin B type domainPROSITEPS50015SAP_Bcoord: 61..142
score: 14.603
IPR008139Saposin B type domainPROSITEPS50015SAP_Bcoord: 510..591
score: 14.166
IPR008138Saposin B type, region 2PFAMPF03489SapB_2coord: 554..587
e-value: 1.8E-7
score: 31.1
coord: 380..412
e-value: 9.7E-9
score: 35.2
coord: 472..504
e-value: 7.4E-6
score: 26.0
coord: 107..138
e-value: 3.2E-4
score: 20.7
NoneNo IPR availableGENE3DG3DSA:1.10.225.10coord: 155..241
e-value: 2.0E-12
score: 49.4
coord: 61..145
e-value: 2.5E-9
score: 39.5
coord: 243..328
e-value: 4.2E-8
score: 35.6
NoneNo IPR availableGENE3DG3DSA:1.10.225.10coord: 511..588
e-value: 3.5E-14
score: 55.2
NoneNo IPR availableGENE3DG3DSA:1.10.225.10coord: 604..685
e-value: 2.7E-12
score: 49.0
coord: 335..414
e-value: 1.7E-14
score: 56.1
coord: 427..506
e-value: 6.0E-14
score: 54.3
NoneNo IPR availablePANTHERPTHR11480:SF3BCDNA.GH08312coord: 19..262
NoneNo IPR availablePANTHERPTHR11480SAPOSIN-RELATEDcoord: 245..419
coord: 427..595
NoneNo IPR availablePANTHERPTHR11480:SF3BCDNA.GH08312coord: 604..780
coord: 245..419
coord: 427..595
NoneNo IPR availablePANTHERPTHR11480SAPOSIN-RELATEDcoord: 604..780
coord: 19..262
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..15
score: 0.902
IPR007856Saposin-like type B, region 1PFAMPF05184SapB_1coord: 609..639
e-value: 1.7E-5
score: 24.7
coord: 430..459
e-value: 1.6E-4
score: 21.6
IPR011001Saposin-likeSUPERFAMILYSSF47862Saposincoord: 472..549
IPR011001Saposin-likeSUPERFAMILYSSF47862Saposincoord: 157..236
IPR011001Saposin-likeSUPERFAMILYSSF47862Saposincoord: 649..728
IPR011001Saposin-likeSUPERFAMILYSSF47862Saposincoord: 61..140
IPR011001Saposin-likeSUPERFAMILYSSF47862Saposincoord: 377..459
IPR011001Saposin-likeSUPERFAMILYSSF47862Saposincoord: 287..374
IPR011001Saposin-likeSUPERFAMILYSSF47862Saposincoord: 552..643