slc18a-4

Overview
Nameslc18a-4 (AKN21539.1)
Smed IDSMED30019663
Length (bp)1812
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc18a-4 (SMED30019663) t-SNE clustered cells

Violin plots show distribution of expression levels for slc18a-4 (SMED30019663) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc18a-4 (SMED30019663) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc18a-4 (SMED30019663) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019663

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30019663SMESG000064025.1 SmedASXL_009647SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30019663SMESG000064025.1 dd_Smed_v4_16043_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019663SMESG000064025.1 dd_Smed_v4_16043_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30019663SMESG000064025.1 dd_Smed_v4_16043_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30019663SMESG000064025.1 dd_Smed_v4_16043_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30019663SMESG000064025.1 OX_Smed_1.0.21899ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
secretory cellSMED30019663SMESG000064025.1 KF134116smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
ventral region of the whole animalSMED30019663SMESG000064025.1 KF134116smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
parapharyngeal regionSMED30019663SMESG000064025.1 KF134116smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
serotonergic neuronSMED30019663SMESG000064025.1 KF134116smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
dopaminergic neuronSMED30019663SMESG000064025.1 KF134116smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
octopaminergic neuronSMED30019663SMESG000064025.1 KF134116smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc18a-4 vs. Ensembl Human
Match: SLC18A2 (solute carrier family 18 member A2 [Source:HGNC Symbol;Acc:HGNC:10935])

HSP 1 Score: 471.855 bits (1213), Expect = 4.805e-161
Identity = 253/511 (49.51%), Postives = 350/511 (68.49%), Query Frame = 3
Query:  150 DSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIG---------------------RKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMM--NGELKSEYQTTGDPKK--ISDNSEPSND 1604
            +S++ + ++L IVF+AL+LDNMLLTV+VPIIP YL+ + +     +N T  I+  +P  T  I                      R    +       +   S + + C  E K+     L  EN+++GL+FASK  +QL+TNP +G +TNRIGY IP+F GF ++F+ST+ FA + SY  L IARSLQG+GS+CSSV+GMGMLA+ Y DD ERG   G AL GLAMGVL+GP FG ++Y++  K+ PF +L +L L+DG +Q+ VL+PS ++PE QKG  L TLL+DPYILIAA SI F N+GIA LEP+LP+W+  TM + + + G+ FLP S+SYL+GTN+FG +  K+GRWL  ++GM+I+G+ ++CIPFA  I  LI P+FG+GFAIGMVDSSMMPIMGYLVD+RHVSVYGSVYAIADVAFC+G+AIGPS    + KA+GF W++ I  II +++ P   FLR+PP KEE  +++M  N  +K++  T  + +   I ++ E  +D
Sbjct:   14 ESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHE----KNATE-IQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKD-----LLNENVQVGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLCALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKMAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD 514          
BLAST of slc18a-4 vs. Ensembl Human
Match: SLC18A1 (solute carrier family 18 member A1 [Source:HGNC Symbol;Acc:HGNC:10934])

HSP 1 Score: 417.927 bits (1073), Expect = 9.811e-140
Identity = 236/491 (48.07%), Postives = 329/491 (67.01%), Query Frame = 3
Query:  207 DNMLLTVIVPIIPDYLWQLDNRDI-----INQNCTVLIKYQKPDWTDII---GRKHVAYDEFEGPEII----EKSVINNTCVEEL---KNRTIQ---HLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEE-----SQSLMMNGELKSEYQTTGD-PKKISDNSEPSND 1604
            DNML TV+VPI+P +L+ ++ +++     +    +       P ++ I        VA +E     I       S I     E +   KN  +Q    L  E  ++G++FASK V+QLL NP VGP+TNRIGY IPMF GF+++F+ST+ FA + +Y LLF+AR+LQG+GS+ SSV+G+GMLA+ Y DD ERG+A G AL GLA+G+L+G  FG +MY++  KS PF IL  LAL+DG +Q+ +L+PS + PE  KG  L  LL+DPYIL+AA SI F N+G+A LEP+LP+W+  TM + + + GL FLP S+SYL+GTN+FG +  K+GRWL ++IGM+++G  L+C+P A  I  LI P+ G+G AIGMVDSSMMPIMG+LVD+RH SVYGSVYAIADVAFC+GFAIGPS    +VKA+GF W++ I+ +I ++Y P   +LR+PP KEE     SQ   M   + +  + T + P     + EP ++
Sbjct:   34 DNMLFTVVVPIVPTFLYDMEFKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPATEAISAHKNNCLQGTGFLEEEITRVGVLFASKAVMQLLVNPFVGPLTNRIGYHIPMFAGFVIMFLSTVMFAFSGTYTLLFVARTLQGIGSSFSSVAGLGMLASVYTDDHERGRAMGTALGGLALGLLVGAPFGSVMYEFVGKSAPFLILAFLALLDGALQLCILQPSKVSPESAKGTPLFMLLKDPYILVAAGSICFANMGVAILEPTLPIWMMQTMCSPKWQLGLAFLPASVSYLIGTNLFGVLANKMGRWLCSLIGMLVVGTSLLCVPLAHNIFGLIGPNAGLGLAIGMVDSSMMPIMGHLVDLRHTSVYGSVYAIADVAFCMGFAIGPSTGGAIVKAIGFPWLMVITGVINIVYAPLCYYLRSPPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHE 524          
BLAST of slc18a-4 vs. Ensembl Human
Match: SLC18A1 (solute carrier family 18 member A1 [Source:HGNC Symbol;Acc:HGNC:10934])

HSP 1 Score: 417.927 bits (1073), Expect = 9.811e-140
Identity = 236/491 (48.07%), Postives = 329/491 (67.01%), Query Frame = 3
Query:  207 DNMLLTVIVPIIPDYLWQLDNRDI-----INQNCTVLIKYQKPDWTDII---GRKHVAYDEFEGPEII----EKSVINNTCVEEL---KNRTIQ---HLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEE-----SQSLMMNGELKSEYQTTGD-PKKISDNSEPSND 1604
            DNML TV+VPI+P +L+ ++ +++     +    +       P ++ I        VA +E     I       S I     E +   KN  +Q    L  E  ++G++FASK V+QLL NP VGP+TNRIGY IPMF GF+++F+ST+ FA + +Y LLF+AR+LQG+GS+ SSV+G+GMLA+ Y DD ERG+A G AL GLA+G+L+G  FG +MY++  KS PF IL  LAL+DG +Q+ +L+PS + PE  KG  L  LL+DPYIL+AA SI F N+G+A LEP+LP+W+  TM + + + GL FLP S+SYL+GTN+FG +  K+GRWL ++IGM+++G  L+C+P A  I  LI P+ G+G AIGMVDSSMMPIMG+LVD+RH SVYGSVYAIADVAFC+GFAIGPS    +VKA+GF W++ I+ +I ++Y P   +LR+PP KEE     SQ   M   + +  + T + P     + EP ++
Sbjct:   34 DNMLFTVVVPIVPTFLYDMEFKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPATEAISAHKNNCLQGTGFLEEEITRVGVLFASKAVMQLLVNPFVGPLTNRIGYHIPMFAGFVIMFLSTVMFAFSGTYTLLFVARTLQGIGSSFSSVAGLGMLASVYTDDHERGRAMGTALGGLALGLLVGAPFGSVMYEFVGKSAPFLILAFLALLDGALQLCILQPSKVSPESAKGTPLFMLLKDPYILVAAGSICFANMGVAILEPTLPIWMMQTMCSPKWQLGLAFLPASVSYLIGTNLFGVLANKMGRWLCSLIGMLVVGTSLLCVPLAHNIFGLIGPNAGLGLAIGMVDSSMMPIMGHLVDLRHTSVYGSVYAIADVAFCMGFAIGPSTGGAIVKAIGFPWLMVITGVINIVYAPLCYYLRSPPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHE 524          
BLAST of slc18a-4 vs. Ensembl Human
Match: SLC18A1 (solute carrier family 18 member A1 [Source:HGNC Symbol;Acc:HGNC:10934])

HSP 1 Score: 370.933 bits (951), Expect = 6.552e-122
Identity = 222/491 (45.21%), Postives = 307/491 (62.53%), Query Frame = 3
Query:  207 DNMLLTVIVPIIPDYLWQLDNRDI-----INQNCTVLIKYQKPDWTDII---GRKHVAYDEFEGPEII----EKSVINNTCVEEL---KNRTIQ---HLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEE-----SQSLMMNGELKSEYQTTGD-PKKISDNSEPSND 1604
            DNML TV+VPI+P +L+ ++ +++     +    +       P ++ I        VA +E     I       S I     E +   KN  +Q    L  E  ++G++FASK V+QLL NP VGP+TNRIGY IPMF GF+++F+ST+ FA + +Y LLF+AR+LQG+GS+ SSV+G+GMLA+ Y DD ERG+A G AL GLA+G+L+G  FG +MY++  KS PF IL  LAL+DG +Q+ +L+PS + PE  KG  L  LL+DPYIL+AA                                GL FLP S+SYL+GTN+FG +  K+GRWL ++IGM+++G  L+C+P A  I  LI P+ G+G AIGMVDSSMMPIMG+LVD+RH SVYGSVYAIADVAFC+GFAIGPS    +VKA+GF W++ I+ +I ++Y P   +LR+PP KEE     SQ   M   + +  + T + P     + EP ++
Sbjct:   34 DNMLFTVVVPIVPTFLYDMEFKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPATEAISAHKNNCLQGTGFLEEEITRVGVLFASKAVMQLLVNPFVGPLTNRIGYHIPMFAGFVIMFLSTVMFAFSGTYTLLFVARTLQGIGSSFSSVAGLGMLASVYTDDHERGRAMGTALGGLALGLLVGAPFGSVMYEFVGKSAPFLILAFLALLDGALQLCILQPSKVSPESAKGTPLFMLLKDPYILVAA--------------------------------GLAFLPASVSYLIGTNLFGVLANKMGRWLCSLIGMLVVGTSLLCVPLAHNIFGLIGPNAGLGLAIGMVDSSMMPIMGHLVDLRHTSVYGSVYAIADVAFCMGFAIGPSTGGAIVKAIGFPWLMVITGVINIVYAPLCYYLRSPPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHE 492          
BLAST of slc18a-4 vs. Ensembl Human
Match: SLC18A1 (solute carrier family 18 member A1 [Source:HGNC Symbol;Acc:HGNC:10934])

HSP 1 Score: 370.933 bits (951), Expect = 6.552e-122
Identity = 222/491 (45.21%), Postives = 307/491 (62.53%), Query Frame = 3
Query:  207 DNMLLTVIVPIIPDYLWQLDNRDI-----INQNCTVLIKYQKPDWTDII---GRKHVAYDEFEGPEII----EKSVINNTCVEEL---KNRTIQ---HLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEE-----SQSLMMNGELKSEYQTTGD-PKKISDNSEPSND 1604
            DNML TV+VPI+P +L+ ++ +++     +    +       P ++ I        VA +E     I       S I     E +   KN  +Q    L  E  ++G++FASK V+QLL NP VGP+TNRIGY IPMF GF+++F+ST+ FA + +Y LLF+AR+LQG+GS+ SSV+G+GMLA+ Y DD ERG+A G AL GLA+G+L+G  FG +MY++  KS PF IL  LAL+DG +Q+ +L+PS + PE  KG  L  LL+DPYIL+AA                                GL FLP S+SYL+GTN+FG +  K+GRWL ++IGM+++G  L+C+P A  I  LI P+ G+G AIGMVDSSMMPIMG+LVD+RH SVYGSVYAIADVAFC+GFAIGPS    +VKA+GF W++ I+ +I ++Y P   +LR+PP KEE     SQ   M   + +  + T + P     + EP ++
Sbjct:   34 DNMLFTVVVPIVPTFLYDMEFKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPATEAISAHKNNCLQGTGFLEEEITRVGVLFASKAVMQLLVNPFVGPLTNRIGYHIPMFAGFVIMFLSTVMFAFSGTYTLLFVARTLQGIGSSFSSVAGLGMLASVYTDDHERGRAMGTALGGLALGLLVGAPFGSVMYEFVGKSAPFLILAFLALLDGALQLCILQPSKVSPESAKGTPLFMLLKDPYILVAA--------------------------------GLAFLPASVSYLIGTNLFGVLANKMGRWLCSLIGMLVVGTSLLCVPLAHNIFGLIGPNAGLGLAIGMVDSSMMPIMGHLVDLRHTSVYGSVYAIADVAFCMGFAIGPSTGGAIVKAIGFPWLMVITGVINIVYAPLCYYLRSPPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHE 492          
BLAST of slc18a-4 vs. Ensembl Celegans
Match: cat-1 (pep chromosome:WBcel235:X:5705719:5710625:-1 gene:WBGene00000295.1 transcript:W01C8.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cat-1)

HSP 1 Score: 439.499 bits (1129), Expect = 3.246e-148
Identity = 247/540 (45.74%), Postives = 354/540 (65.56%), Query Frame = 3
Query:  114 ISYVFQQITGYFDSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRD----IINQNCTVLIKYQKPD---W---------TDI---------IGR--------------KHVAYDE--------FEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELKSEYQTTGDPKKISDNSE 1592
            +SY+   I+ Y   + ++ ++L+IV+IAL LDNMLLT +VPIIP+YL ++++ +    + + N    +K Q  D   W          DI         +GR              K+  Y++         + P +  +     T  EE +++    L++EN+ +GLMF SK ++QLL NP +GP+TNRIGY++PMF GF+++F ST+ FA  +SY  L++AR+LQG+GSAC+S SGMGMLA  Y DD+ERG A G AL GLA+GVL+GP +GGL+YQ++ K +PF +L  LAL DG +Q +VL+P I   + +G+S+K L +DPYI++AA +IT GNLGIA LEPSLPLW+  +  A  LE+G  FLP S+SYL+GTN+FGP+  +IGRWL++ IG+V+IG  L+ IP AT+++ LI+P   +GF+IGM+D+SM P+MGYLVDIRHV VYGS+YAIAD AFC  FA+GP  S  LVK++GF  M++I A+I  +Y P +  L+NPP   E      + EL+      GD +  ++N E
Sbjct:    1 MSYILDWISTY---RNNRKILLLIVYIALFLDNMLLTTVVPIIPEYLLRMEHPNETDILFSHNSQKRVKRQWEDDDSWDVPLKLGNNADIDWDENPIGPVGRSERRKESDRKNHNSKNREYNDRRKYMSPAAKKPPVETEEPAVRTISEEERHKL---LASENVHVGLMFGSKALVQLLVNPWIGPLTNRIGYTMPMFGGFVIMFCSTILFAFGDSYFTLWLARALQGVGSACTSTSGMGMLAQAYPDDLERGSAMGIALGGLALGVLVGPPYGGLLYQWSGKELPFVLLALLALFDGSIQFMVLQPKIDRGEPEGSSIKQLAKDPYIIVAAGAITIGNLGIAMLEPSLPLWMMESWGANSLERGAAFLPASISYLIGTNIFGPLAHRIGRWLSSFIGLVVIGFSLLSIPSATSVAGLIIPHALLGFSIGMIDASMFPLMGYLVDIRHVGVYGSIYAIADAAFCFAFALGPFFSGPLVKSLGFPTMMYIIAVISFLYAPLMFLLKNPPVLIEPTPQTQSVELRQ----NGDSRVTNENYE 530          
BLAST of slc18a-4 vs. Ensembl Celegans
Match: cat-1 (pep chromosome:WBcel235:X:5705719:5710585:-1 gene:WBGene00000295.1 transcript:W01C8.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cat-1)

HSP 1 Score: 410.609 bits (1054), Expect = 8.428e-138
Identity = 231/501 (46.11%), Postives = 334/501 (66.67%), Query Frame = 3
Query:  114 ISYVFQQITGYFDSKQHKTMVLIIVFIALVLDNMLLTVIVPIIP-DYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELKSEYQTTGDPKKISDNSEPSNDLSI 1613
            +SY+   I+ Y   + ++ ++L+IV+I    +        PI P     +    D  N N       +  ++ D   RK+++    + P   E+  +  T  EE +++    L++EN+ +GLMF SK ++QLL NP +GP+TNRIGY++PMF GF+++F ST+ FA  +SY  L++AR+LQG+GSAC+S SGMGMLA  Y DD+ERG A G AL GLA+GVL+GP +GGL+YQ++ K +PF +L  LAL DG +Q +VL+P I   + +G+S+K L +DPYI++AA +IT GNLGIA LEPSLPLW+  +  A  LE+G  FLP S+SYL+GTN+FGP+  +IGRWL++ IG+V+IG  L+ IP AT+++ LI+P   +GF+IGM+D+SM P+MGYLVDIRHV VYGS+YAIAD AFC  FA+GP  S  LVK++GF  M++I A+I  +Y P +  L+NPP   E      + EL+      GD +  ++N E    ++I
Sbjct:    1 MSYILDWISTY---RNNRKILLLIVYIDWDEN--------PIGPVGRSERRKESDRKNHNS------KNREYNDR--RKYMSPAAKKPPVETEEPAVR-TISEEERHKL---LASENVHVGLMFGSKALVQLLVNPWIGPLTNRIGYTMPMFGGFVIMFCSTILFAFGDSYFTLWLARALQGVGSACTSTSGMGMLAQAYPDDLERGSAMGIALGGLALGVLVGPPYGGLLYQWSGKELPFVLLALLALFDGSIQFMVLQPKIDRGEPEGSSIKQLAKDPYIIVAAGAITIGNLGIAMLEPSLPLWMMESWGANSLERGAAFLPASISYLIGTNIFGPLAHRIGRWLSSFIGLVVIGFSLLSIPSATSVAGLIIPHALLGFSIGMIDASMFPLMGYLVDIRHVGVYGSIYAIADAAFCFAFALGPFFSGPLVKSLGFPTMMYIIAVISFLYAPLMFLLKNPPVLIEPTPQTQSVELRQ----NGDSRVTNENYERIEGMNI 474          
BLAST of slc18a-4 vs. Ensembl Celegans
Match: unc-17 (Vesicular acetylcholine transporter unc-17 [Source:UniProtKB/Swiss-Prot;Acc:P34711])

HSP 1 Score: 269.626 bits (688), Expect = 9.649e-83
Identity = 176/526 (33.46%), Postives = 263/526 (50.00%), Query Frame = 3
Query:   60 NMKYINIDSDGNHKSVSRISYVFQQITGYFDSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNT-CVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLK-----TLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATR-LEQGLVFLPCSLSYLMGTNVFGPIGVKIGR------WLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELKSEYQTTGDPKKISDNSEPS 1598
            N+  IN DS+       +  ++ QQ          K  VL+IV IAL+LDNML  VIVPIIP YL     RDI N   T                       FEG       + N T  V E+  R   +   E +++G +FASK ++Q+  NP  G I +R+GY IPM  G   +F ST  FAL +SY +L  ARSLQG GSA +  SG+ M+A  + ++ ER  A G AL+ ++ G L+ P FG ++Y    K VPF IL  + L D     +V+ P  +  D  G  ++      L  DP+I   + ++   N+ +A LEP++  W+   M  T     G+++LP    +++G  V     VK+ R      W   M+G+ + GI    IP+ T++  L++P   + F I ++D+S++P++G+LVD RHVSVYGSVYAIAD+++ + +A GP ++  +V   GF  +  I     + Y P +  LR   K     +L   G+     Q          N +P 
Sbjct:    4 NVPVINRDSEILKADAKK--WLEQQ-------DNQKKCVLVIVSIALLLDNMLYMVIVPIIPKYL-----RDIHNYQVT-----------------------FEGYHNETSQLANGTYLVREVGGRI--NFLDEELELGWLFASKALLQIFVNPFSGYIIDRVGYEIPMILGLCTMFFSTAIFALGKSYGVLLFARSLQGFGSAFADTSGLAMIADRFTEENERSAALGIALAFISFGCLVAPPFGSVLYSLAGKPVPFLILSFVCLADAIAVFMVINPHRRGTDSHGEKVQGTPMWRLFMDPFIACCSGALIMANVSLAFLEPTITTWMSEMMPDTPGWLVGVIWLPPFFPHVLGVYV----TVKMLRAFPHHTWAIAMVGLAMEGIACFAIPYTTSVMQLVIPLSFVCFGIALIDTSLLPMLGHLVDTRHVSVYGSVYAIADISYSLAYAFGPIIAGWIVTNWGFTALNIIIFATNVTYAPVLFLLR---KVHSYDTLGAKGDTAEMTQLNSSAPAGGYNGKPE 483          
BLAST of slc18a-4 vs. Ensembl Celegans
Match: vpat-1 (Vesicular PolyAmine Transporter [Source:UniProtKB/TrEMBL;Acc:Q8MPU6])

HSP 1 Score: 65.4698 bits (158), Expect = 6.307e-11
Identity = 82/329 (24.92%), Postives = 142/329 (43.16%), Query Frame = 3
Query:  561 MFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAF--GFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS----IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRW--------LTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAI-GMVDSSM-MPIMGYLVD-------IRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFII 1478
            + FGFL    S  TF     +    + R L+ +G A    S   + A  +  +V    AF  G   +   +G   GP+ GG  Y      +PF +LG + L+   +   +++ +      PED+    +  +LR P I +   S+    + ++ L+P+L   +++  K T  E GL+FL C   Y +   VFG I  ++           + T++ M  IG   +   +      +I    G+  A+ G+  S++ +P     +D         +   YG V  I   AF  G  IGP+  S +V+ VGFRW   + A + +I +  ++
Sbjct:  307 ILFGFLNFLPSGNTF-----FWFSVLVRILEAVGDAAFVTSSFAIAAKSFPKNV----AFVVGILETFAGLGYTAGPVIGGFFYDIGGFQLPFLVLGIVLLVASVLAFFLIENTKDDESNPEDK---GMLEILRLPQIWLPIFSVVSCAISLSFLDPTLSNHLES-FKLTPTEIGLMFLLCGGFYTVMCPVFGAIMDRLHNGENLLLFGSIATLLSMFFIGPTPLLNGYVEKDLWVI----GISLAVLGLAASALYIPCFQMCLDEVKDKGFDDNFHTYGCVSGIFQAAFGFGSFIGPTFGSVVVERVGFRWTTTMIAFLHIILSTVVL 618          
BLAST of slc18a-4 vs. Ensembl Celegans
Match: vpat-1 (Vesicular PolyAmine Transporter [Source:UniProtKB/TrEMBL;Acc:Q8MPU6])

HSP 1 Score: 62.7734 bits (151), Expect = 3.449e-10
Identity = 80/327 (24.46%), Postives = 138/327 (42.20%), Query Frame = 3
Query:  561 MFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS----IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRW--------LTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAI-GMVDSSM-MPIMGYLVD-------IRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFII 1478
            + FGFL    S  TF     +    + R L+ +G A    S   + A  +  +V      G   +   +G   GP+ GG  Y      +PF +LG + L+   +   +++ +      PED+    +  +LR P I +   S+    + ++ L+P+L   +++  K T  E GL+FL C   Y +   VFG I  ++           + T++ M  IG      P         +   G+  A+ G+  S++ +P     +D         +   YG V  I   AF  G  IGP+  S +V+ VGFRW   + A + +I +  ++
Sbjct:  165 ILFGFLNFLPSGNTF-----FWFSVLVRILEAVGDAAFVTSSFAIAAKSFPKNV--AFVVGILETFAGLGYTAGPVIGGFFYDIGGFQLPFLVLGIVLLVASVLAFFLIENTKDDESNPEDK---GMLEILRLPQIWLPIFSVVSCAISLSFLDPTLSNHLES-FKLTPTEIGLMFLLCGGFYTVMCPVFGAIMDRLHNGENLLLFGSIATLLSMFFIG----PTPLLNGYVEKDLWVIGISLAVLGLAASALYIPCFQMCLDEVKDKGFDDNFHTYGCVSGIFQAAFGFGSFIGPTFGSVVVERVGFRWTTTMIAFLHIILSTVVL 476          
BLAST of slc18a-4 vs. Ensembl Fly
Match: Vmat (gene:FBgn0260964 transcript:FBtr0310062)

HSP 1 Score: 518.079 bits (1333), Expect = 4.396e-178
Identity = 258/462 (55.84%), Postives = 340/462 (73.59%), Query Frame = 3
Query:  156 KQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEI--IEKSVI----NNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLM 1523
            +    +VL+IV IAL+LDNMLLT +VPIIP++L+     DI + +  +    + P  +++           +G E   +E S I    N T   EL+ R    L  E +++GL+FASK  +QLL NPIVGP+T+RIGYSIPMF GF+++F+ST+ FA   SY +LF+AR+LQG+GS+CSSVSGMGMLA  + DD ERG A G AL GLA+GVLIGP FGG+MY++  KS PF IL +LAL DG +Q+ +L+PSI+  + +  SLK+L+ DPYILIAA +ITF N+GIA LEPSLPLW+   M ATR EQG+ FLP S+SYL+GTN+FGP+G KIGRW    +G++IIG CLI IP AT+I+HLI+P+ G+GFAIGMVDSSMMP +GYLVDIRH +VYGSVYA+ DVAFCVGFA+GP+LS  LVK++GF WM++  AI+C +Y P +  L+NPP  +E +SL+
Sbjct:  135 RGSNRLVLVIVAIALLLDNMLLTTVVPIIPEFLY-----DIRHPDAPLDSFPRTPLTSNVPPPPTPCPCNKDGSEAAPLEISTISPEENETYYRELEERH-NELVGETVEVGLLFASKAFVQLLVNPIVGPLTHRIGYSIPMFAGFVIMFLSTIIFAFGRSYLVLFVARALQGIGSSCSSVSGMGMLADRFTDDKERGNAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILAALALGDGLLQLFMLQPSIQKAETEPPSLKSLISDPYILIAAGAITFANMGIAMLEPSLPLWMVDNMGATRWEQGVAFLPASISYLIGTNLFGPLGHKIGRWFAACLGLIIIGGCLIFIPMATSITHLIIPNAGLGFAIGMVDSSMMPELGYLVDIRHSAVYGSVYALGDVAFCVGFAVGPALSGSLVKSIGFEWMLFGIAILCFMYAPLLTLLKNPPTSDEKKSLI 590          
BLAST of slc18a-4 vs. Ensembl Fly
Match: Vmat (gene:FBgn0260964 transcript:FBtr0091491)

HSP 1 Score: 518.079 bits (1333), Expect = 4.396e-178
Identity = 258/462 (55.84%), Postives = 340/462 (73.59%), Query Frame = 3
Query:  156 KQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEI--IEKSVI----NNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLM 1523
            +    +VL+IV IAL+LDNMLLT +VPIIP++L+     DI + +  +    + P  +++           +G E   +E S I    N T   EL+ R    L  E +++GL+FASK  +QLL NPIVGP+T+RIGYSIPMF GF+++F+ST+ FA   SY +LF+AR+LQG+GS+CSSVSGMGMLA  + DD ERG A G AL GLA+GVLIGP FGG+MY++  KS PF IL +LAL DG +Q+ +L+PSI+  + +  SLK+L+ DPYILIAA +ITF N+GIA LEPSLPLW+   M ATR EQG+ FLP S+SYL+GTN+FGP+G KIGRW    +G++IIG CLI IP AT+I+HLI+P+ G+GFAIGMVDSSMMP +GYLVDIRH +VYGSVYA+ DVAFCVGFA+GP+LS  LVK++GF WM++  AI+C +Y P +  L+NPP  +E +SL+
Sbjct:  135 RGSNRLVLVIVAIALLLDNMLLTTVVPIIPEFLY-----DIRHPDAPLDSFPRTPLTSNVPPPPTPCPCNKDGSEAAPLEISTISPEENETYYRELEERH-NELVGETVEVGLLFASKAFVQLLVNPIVGPLTHRIGYSIPMFAGFVIMFLSTIIFAFGRSYLVLFVARALQGIGSSCSSVSGMGMLADRFTDDKERGNAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILAALALGDGLLQLFMLQPSIQKAETEPPSLKSLISDPYILIAAGAITFANMGIAMLEPSLPLWMVDNMGATRWEQGVAFLPASISYLIGTNLFGPLGHKIGRWFAACLGLIIIGGCLIFIPMATSITHLIIPNAGLGFAIGMVDSSMMPELGYLVDIRHSAVYGSVYALGDVAFCVGFAVGPALSGSLVKSIGFEWMLFGIAILCFMYAPLLTLLKNPPTSDEKKSLI 590          
BLAST of slc18a-4 vs. Ensembl Fly
Match: Vmat (gene:FBgn0260964 transcript:FBtr0091493)

HSP 1 Score: 518.079 bits (1333), Expect = 4.396e-178
Identity = 258/462 (55.84%), Postives = 340/462 (73.59%), Query Frame = 3
Query:  156 KQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEI--IEKSVI----NNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLM 1523
            +    +VL+IV IAL+LDNMLLT +VPIIP++L+     DI + +  +    + P  +++           +G E   +E S I    N T   EL+ R    L  E +++GL+FASK  +QLL NPIVGP+T+RIGYSIPMF GF+++F+ST+ FA   SY +LF+AR+LQG+GS+CSSVSGMGMLA  + DD ERG A G AL GLA+GVLIGP FGG+MY++  KS PF IL +LAL DG +Q+ +L+PSI+  + +  SLK+L+ DPYILIAA +ITF N+GIA LEPSLPLW+   M ATR EQG+ FLP S+SYL+GTN+FGP+G KIGRW    +G++IIG CLI IP AT+I+HLI+P+ G+GFAIGMVDSSMMP +GYLVDIRH +VYGSVYA+ DVAFCVGFA+GP+LS  LVK++GF WM++  AI+C +Y P +  L+NPP  +E +SL+
Sbjct:  135 RGSNRLVLVIVAIALLLDNMLLTTVVPIIPEFLY-----DIRHPDAPLDSFPRTPLTSNVPPPPTPCPCNKDGSEAAPLEISTISPEENETYYRELEERH-NELVGETVEVGLLFASKAFVQLLVNPIVGPLTHRIGYSIPMFAGFVIMFLSTIIFAFGRSYLVLFVARALQGIGSSCSSVSGMGMLADRFTDDKERGNAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILAALALGDGLLQLFMLQPSIQKAETEPPSLKSLISDPYILIAAGAITFANMGIAMLEPSLPLWMVDNMGATRWEQGVAFLPASISYLIGTNLFGPLGHKIGRWFAACLGLIIIGGCLIFIPMATSITHLIIPNAGLGFAIGMVDSSMMPELGYLVDIRHSAVYGSVYALGDVAFCVGFAVGPALSGSLVKSIGFEWMLFGIAILCFMYAPLLTLLKNPPTSDEKKSLI 590          
BLAST of slc18a-4 vs. Ensembl Fly
Match: Vmat (gene:FBgn0260964 transcript:FBtr0091492)

HSP 1 Score: 515.768 bits (1327), Expect = 1.429e-176
Identity = 257/462 (55.63%), Postives = 338/462 (73.16%), Query Frame = 3
Query:  156 KQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEI--IEKSVI----NNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLM 1523
            +    +VL+IV IAL+LDNMLLT +VPIIP++L+     DI + +  +    + P  +++           +G E   +E S I    N T   EL+ R    L  E +++GL+FASK  +QLL NPIVGP+T+RIGYSIPMF GF+++F+ST+ FA   SY +LF+AR+LQG+GS+CSSVSGMGMLA  + DD ERG A G AL GLA+GVLIGP FGG+MY++  KS PF IL +LAL DG +Q+ +L+PSI+  + +  SLK+L+ DPYILIAA +ITF N+GIA LEPSLPLW+   M ATR EQG+ FLP S+SYL+GTN+FGP+G KIGRW    +G++IIG CLI IP AT+I+HLI+P+ G+GFAIGMVDSSMMP +GYLVDIRH +VYGSVYA+ DVAFCVGFA+GP+LS  LVK++GF WM++  AI+C +Y P +  L+NPP  +E +  M
Sbjct:  135 RGSNRLVLVIVAIALLLDNMLLTTVVPIIPEFLY-----DIRHPDAPLDSFPRTPLTSNVPPPPTPCPCNKDGSEAAPLEISTISPEENETYYRELEERH-NELVGETVEVGLLFASKAFVQLLVNPIVGPLTHRIGYSIPMFAGFVIMFLSTIIFAFGRSYLVLFVARALQGIGSSCSSVSGMGMLADRFTDDKERGNAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILAALALGDGLLQLFMLQPSIQKAETEPPSLKSLISDPYILIAAGAITFANMGIAMLEPSLPLWMVDNMGATRWEQGVAFLPASISYLIGTNLFGPLGHKIGRWFAACLGLIIIGGCLIFIPMATSITHLIIPNAGLGFAIGMVDSSMMPELGYLVDIRHSAVYGSVYALGDVAFCVGFAVGPALSGSLVKSIGFEWMLFGIAILCFMYAPLLTLLKNPPTSDEKKVRM 590          
BLAST of slc18a-4 vs. Ensembl Fly
Match: VAChT (gene:FBgn0270928 transcript:FBtr0083671)

HSP 1 Score: 281.567 bits (719), Expect = 1.195e-86
Identity = 171/483 (35.40%), Postives = 271/483 (56.11%), Query Frame = 3
Query:  159 QHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKT-------LLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGR------WLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRN----PPKKEESQSLMMNGELKSEYQT 1556
              + ++L+IV IAL+LDNML  VIVPIIPDYL ++ + D      T       P   +I G+    + +  G                           ++   G++FASK ++QL+ NP  G + ++IGY +PM  G  ++F ST  FA   SY +LF ARSLQG GSA +  +G+ M+A  + ++ ER +A G AL+ ++ G L+ P FGG +YQ+  K VPF IL  + L+DG M ++V+KP +K   ++   ++        LL DPYI + A ++T  N+ +A LEP++ LW++  M     + G+V+LP    +++G      I VK+ R      WL    G+ + G     IPF +    L++P   + F I ++D++++P +GYLVD+R+VSVYGS+YAIAD+++ + +A+GP ++ G+V+A+GF  + ++ A   L Y P +  LRN     P + E+  LM +   K EYQT
Sbjct:   29 NQRRLILVIVSIALLLDNMLYMVIVPIIPDYLREIGSFD---DGPT-----PPPLRDNITGKIIPVHHDHHG---------------------------QDSATGILFASKAIVQLMVNPFSGGLIDKIGYDLPMMIGLTIMFFSTAVFACGSSYSVLFFARSLQGAGSAFADTAGLAMIADRFTEENERSQALGIALAFISFGCLVAPPFGGALYQFAGKEVPFLILALVCLLDGLMLLLVMKP-VKEAMKQSKDVQDQVIPIWRLLMDPYIAVCAGALTMSNVALAFLEPTISLWMEDNMTTDNWKIGMVWLPAFFPHVLGVV----ITVKMARKYPQHQWLMAAGGLALEGFSCFIIPFCSGYKMLMLPICVICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADISYSIAYAVGPIIAGGVVEAIGFTALNFLIAFSNLAYVPVLRKLRNIYDFKPFENEANILMQDPPNK-EYQT 470          
BLAST of slc18a-4 vs. Ensembl Zebrafish
Match: slc18a2 (solute carrier family 18 member 2 [Source:ZFIN;Acc:ZDB-GENE-080514-1])

HSP 1 Score: 510.76 bits (1314), Expect = 1.166e-175
Identity = 256/507 (50.49%), Postives = 356/507 (70.22%), Query Frame = 3
Query:  126 FQQITGYFDSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRD---IINQNCTVL--------IKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMM--NGELKSE-YQTTGDPKKISDNSEPSN 1601
            F  +T   + +Q + ++L+IVFIAL+LDNMLLTV+VPIIP YL+ +D+     + N + T L        I     + T + G          GP  +  + ++     +      Q L+ EN+K+GL+FASK  +QL+TNP +GP+TNRIGY IPMF GF ++F+ST+ FA + SY LLF+ARSLQG+GS+CSSV+GMGMLA+ Y DD ERG A G AL GLAMGVL+GP FG +MY++  K+ PF IL  LA++DG +Q+ VL+PS ++PE QKG SL TL++DPYILIAA SI F N+ IA LEP+LP+W+  TM   + + G+ F+P S+SYL+GTN+F  +  K+GRWL ++IGM+++GI ++C+P A  I  LIVP+FG+GFAIGMVDSSMMPIMGYLVD+RHVSVYGSVYAIADVAFC+GFA+GPS    + +++GF W++ I  ++ +++ P   FLRNPP  EE  +++M  N  +K+  Y T G   ++ D+ +P +
Sbjct:   57 FSLLTWLREERQSRRLILLIVFIALLLDNMLLTVVVPIIPSYLYTVDDEAAQMVKNHSMTPLSPSSTFQSIVSLYDNTTRVTGFSPQM--STAGPMSLAPTFVSPQNQSDCPKADDQLLN-ENVKVGLLFASKATVQLITNPFIGPLTNRIGYQIPMFAGFCIMFVSTIMFAFSSSYTLLFLARSLQGVGSSCSSVAGMGMLASVYTDDEERGNAIGIALGGLAMGVLVGPPFGSVMYEFVGKTAPFLILAVLAVLDGALQLFVLQPSKVEPESQKGTSLITLMKDPYILIAAGSICFANMAIAMLEPALPIWMMETMCPRKWQLGIAFVPASISYLIGTNIFAVLAHKMGRWLCSLIGMLLVGISILCVPLAKDIYGLIVPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGFALGPSAGGAIARSIGFPWLMTIIGLVDIMFAPLCFFLRNPPANEEKMAILMDSNCSMKTRSYSTQGSSYQMGDDFDPES 560          
BLAST of slc18a-4 vs. Ensembl Zebrafish
Match: slc18a2 (solute carrier family 18 member 2 [Source:ZFIN;Acc:ZDB-GENE-080514-1])

HSP 1 Score: 489.96 bits (1260), Expect = 1.972e-168
Identity = 241/471 (51.17%), Postives = 330/471 (70.06%), Query Frame = 3
Query:  114 ISYVFQQITGYFDSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRD---IINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQS 1517
            +S  F  +T   + +Q + ++L+IVFIAL+LDNMLLTV+VPIIP YL+ +D+     + N + T L           +         F GP  +  + ++     +      Q L+ EN+K+GL+FASK  +QL+TNP +GP+TNRIGY IPMF GF ++F+ST+ FA + SY LLF+ARSLQG+GS+CSSV+GMGMLA+ Y DD ERG A G AL GLAMGVL+GP FG +MY++  K+ PF IL  LA++DG  +I +     +   QKG SL TL++DPYILIAA SI F N+ IA LEP+LP+W+  TM   + + G+ F+P S+SYL+GTN+F  +  K+GRWL ++IGM+++GI ++C+P A  I  LIVP+FG+GFAIGMVDSSMMPIMGYLVD+RHVSVYGSVYAIADVAFC+GFA+GPS    + +++GF W++ I  ++ +++ P   FLRNPP  EE  +
Sbjct:    1 MSLDFSLLTWLREERQSRRLILLIVFIALLLDNMLLTVVVPIIPSYLYTVDDEAAQMVKNHSMTPLSPSSTFQSIVSLYDNTTRVTGFTGPMSLAPTFVSPQNQSDCPKADDQLLN-ENVKVGLLFASKATVQLITNPFIGPLTNRIGYQIPMFAGFCIMFVSTIMFAFSSSYTLLFLARSLQGVGSSCSSVAGMGMLASVYTDDEERGNAIGIALGGLAMGVLVGPPFGSVMYEFVGKTAPFLILAVLAVLDGGERINICSLKSQDSSQKGTSLITLMKDPYILIAAGSICFANMAIAMLEPALPIWMMETMCPRKWQLGIAFVPASISYLIGTNIFAVLAHKMGRWLCSLIGMLLVGISILCVPLAKDIYGLIVPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGFALGPSAGGAIARSIGFPWLMTIIGLVDIMFAPLCFFLRNPPANEEKMA 470          
BLAST of slc18a-4 vs. Ensembl Zebrafish
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:571483])

HSP 1 Score: 459.914 bits (1182), Expect = 3.044e-156
Identity = 242/513 (47.17%), Postives = 334/513 (65.11%), Query Frame = 3
Query:  153 SKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIIN----------QNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNG---ELKSEYQTTGD---PKKISDNSEPSNDLSIPIDKTVLSQ 1640
            ++    +VL +V +AL+LDNMLLTV+VPIIP +L+  +++   N           N ++L  Y    +   +      +         E   +N++  +         L  EN+K+GL+FASK ++QLL NP VGP+TNRIGY IPMF GF+++F+ST+ FA + +Y LLF ARSLQG+GS+ S+V+G+GMLA+ Y DD ERG A G AL GLAMGVLIG  FG +MY++ SKS PF +L  LA+ DG +Q+ +L+PS I P   +G  L  LL+DPYILI+A S+ F N+G+A LEP+LP+W+  TM A + + G+ FLP S+SYL+GTN+FG +  K+GRWL +M+GM I+GI L+C+PFA  +  LI P+ G+GFA+GMVD+SM  IMGYLVDIRHVSVYGSVYAIADVA CVGFA+GPS    LV+ +GF  ++ I  II ++Y P   FL+NP   EE    + +     +KS Y T+G    P    D+ E + +  I   K  +  
Sbjct:   15 TRGSPRLVLAVVCVALLLDNMLLTVVVPIIPAFLYATEHQAQKNPPTTPFEAHPTNTSLLSLYNTTTYNTSVSLNFTNFSSASSTN--ENLGVNSSSADYGCKEDSDFLEGENVKVGLLFASKAMVQLLVNPFVGPLTNRIGYHIPMFAGFVIMFVSTIMFAFSGTYTLLFFARSLQGIGSSFSTVAGLGMLASVYTDDSERGIAMGIALGGLAMGVLIGAPFGSIMYEFVSKSSPFLVLAFLAMFDGALQLCILQPSKISPTSMEGTPLFILLKDPYILISAGSLCFANMGVAVLEPTLPIWMMQTMCAPKWQLGVAFLPASVSYLIGTNLFGILANKMGRWLCSMVGMFIVGISLLCVPFAKNLYGLIGPNGGLGFAVGMVDTSMFAIMGYLVDIRHVSVYGSVYAIADVALCVGFAVGPSTGGALVRTIGFPNLMVIIGIINILYAPLCFFLKNPANWEEKMVRLKHECPLHMKS-YNTSGYREFPLSEDDSEEDTENACINSHKESMDH 524          
BLAST of slc18a-4 vs. Ensembl Zebrafish
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:571483])

HSP 1 Score: 441.81 bits (1135), Expect = 6.711e-149
Identity = 238/505 (47.13%), Postives = 328/505 (64.95%), Query Frame = 3
Query:  150 DSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIG-RKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELK---SEYQTTGD---PKKISDNSEPSNDLSIPIDKTVLSQ 1640
             S  H T+ L+++F+ L++      + VPIIP +L+  +++   N   T    +  P  T ++       Y+          S  ++T  E L       L  EN+K+GL+FASK ++QLL NP VGP+TNRIGY IPMF GF+++F+ST+ FA + +Y LLF ARSLQG+GS+ S+V+G+GMLA+ Y DD ERG A G AL GLAMGVLIG  FG +MY++ SKS PF +L  LA+ DG +Q+ +L+PS I P   +G  L  LL+DPYILI+A S+ F N+G+A LEP+LP+W+  TM A + + G+ FLP S+SYL+GTN+FG +  K+GRWL +M+GM I+GI L+C+PFA  +  LI P+ G+GFA+GMVD+SM  IMGYLVDIRHVSVYGSVYAIADVA CVGFA+GPS    LV+ +GF  ++ I  II ++Y P   FL+NP   EE  ++ +N E       Y T+G    P    D+ E + +  I   K  +  
Sbjct:   41 KSANHSTL-LMMIFLKLLILMSTFILPVPIIPAFLYATEHQAQKNPPTTPFEAH--PTNTSLLSLYNTTTYNTSVSLNFTNFSSASSTN-ENLGVNNSDFLEGENVKVGLLFASKAMVQLLVNPFVGPLTNRIGYHIPMFAGFVIMFVSTIMFAFSGTYTLLFFARSLQGIGSSFSTVAGLGMLASVYTDDSERGIAMGIALGGLAMGVLIGAPFGSIMYEFVSKSSPFLVLAFLAMFDGALQLCILQPSKISPTSMEGTPLFILLKDPYILISAGSLCFANMGVAVLEPTLPIWMMQTMCAPKWQLGVAFLPASVSYLIGTNLFGILANKMGRWLCSMVGMFIVGISLLCVPFAKNLYGLIGPNGGLGFAVGMVDTSMFAIMGYLVDIRHVSVYGSVYAIADVALCVGFAVGPSTGGALVRTIGFPNLMVIIGIINILYAPLCFFLKNPANWEEKMAI-VNQECPLHMKSYNTSGYREFPLSEDDSEEDTENACINSHKESMDH 540          
BLAST of slc18a-4 vs. Ensembl Zebrafish
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:571483])

HSP 1 Score: 438.728 bits (1127), Expect = 5.874e-148
Identity = 231/505 (45.74%), Postives = 324/505 (64.16%), Query Frame = 3
Query:  177 LIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIIN----------QNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELK---SEYQTTGD---PKKISDNSEPSNDLSIPIDKTVLSQ 1640
            ++++F+ L++      + VPIIP +L+  +++   N           N ++L  Y    +   +      +         E   +N++  +         L  EN+K+GL+FASK ++QLL NP VGP+TNRIGY IPMF GF+++F+ST+ FA + +Y LLF ARSLQG+GS+ S+V+G+GMLA+ Y DD ERG A G AL GLAMGVLIG  FG +MY++ SKS PF +L  LA+ DG +Q+ +L+PS I P   +G  L  LL+DPYILI+A S+ F N+G+A LEP+LP+W+  TM A + + G+ FLP S+SYL+GTN+FG +  K+GRWL +M+GM I+GI L+C+PFA  +  LI P+ G+GFA+GMVD+SM  IMGYLVDIRHVSVYGSVYAIADVA CVGFA+GPS    LV+ +GF  ++ I  II ++Y P   FL+NP   EE  ++ +N E       Y T+G    P    D+ E + +  I   K  +  
Sbjct:   22 IMMIFLKLLILMSTFILPVPIIPAFLYATEHQAQKNPPTTPFEAHPTNTSLLSLYNTTTYNTSVSLNFTNFSSASSTN--ENLGVNSSSADYGCKEDSDFLEGENVKVGLLFASKAMVQLLVNPFVGPLTNRIGYHIPMFAGFVIMFVSTIMFAFSGTYTLLFFARSLQGIGSSFSTVAGLGMLASVYTDDSERGIAMGIALGGLAMGVLIGAPFGSIMYEFVSKSSPFLVLAFLAMFDGALQLCILQPSKISPTSMEGTPLFILLKDPYILISAGSLCFANMGVAVLEPTLPIWMMQTMCAPKWQLGVAFLPASVSYLIGTNLFGILANKMGRWLCSMVGMFIVGISLLCVPFAKNLYGLIGPNGGLGFAVGMVDTSMFAIMGYLVDIRHVSVYGSVYAIADVALCVGFAVGPSTGGALVRTIGFPNLMVIIGIINILYAPLCFFLKNPANWEEKMAI-VNQECPLHMKSYNTSGYREFPLSEDDSEEDTENACINSHKESMDH 523          
BLAST of slc18a-4 vs. Ensembl Xenopus
Match: gtf2e1.2 (general transcription factor IIE, polypeptide 1, alpha 56kDa, gene 2 [Source:Xenbase;Acc:XB-GENE-6001963])

HSP 1 Score: 396.356 bits (1017), Expect = 1.029e-131
Identity = 212/479 (44.26%), Postives = 316/479 (65.97%), Query Frame = 3
Query:  207 DNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQH-LSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNG---ELKSEYQTTGDPKKI-SDNSEPSNDLSIPIDK 1625
            DNML TV+VPIIP +L++   +++ N + T          T++    H     +    +   S+ ++      K    +H L +EN+++GL+FASK ++QLL NP+VG ITNR G+  P+F GF++LF+ST+ FA + SY LLF+ARS+QG+GS+ SSV+G+G+LA+ Y+DD ERG+A G AL+GLA+GVL G  FG +MY++  +S PF +L +LAL+DG +Q+ +L+PS   P          LLRDPYIL+AAA +   N+ +  LEP+LP+W+  TM +   + G+ FLP S++YL+ TN+FG +  K+GRWL +M+GM+++G  L+C+P A  I  LI P+  +G A+GMVDSS+MPIMGYLVD+RH SVYG +YAI D A C+GFA+GPSL+  +   +GF W++ I  II ++++P  I LRNPP KEE  +++      + K+    T  P  I SD+S+   + ++   K
Sbjct:   34 DNMLFTVVVPIIPSFLYE---KELKNASVTT---------TEL----HSPISAYNSSVLFNASLHDSPTNSSNKCEKKKHTLHSENVQVGLLFASKAIVQLLVNPLVGLITNRFGFDAPLFAGFVILFLSTLMFAFSGSYALLFVARSIQGIGSSFSSVAGLGLLASVYMDDFERGQAMGIALTGLAVGVLAGAPFGSVMYEFVGRSSPFLVLAALALLDGALQLCILRPSKFSPTTAAPTPYHELLRDPYILVAAACLWIANMAVGMLEPTLPIWMMETMCSPDWQLGIAFLPASVAYLICTNLFGILSHKMGRWLCSMLGMIVVGGGLLCVPLARNIYGLIGPNAAIGIALGMVDSSIMPIMGYLVDLRHTSVYGGIYAICDTALCLGFAVGPSLAGVIASNIGFSWLMVIIGIINILFSPLCILLRNPPAKEEKVAILTQECAMQTKTYMTQTNGPDLILSDHSDDEYNSTVSRKK 496          
BLAST of slc18a-4 vs. Ensembl Xenopus
Match: ddx42 (DEAD-box helicase 42 [Source:Xenbase;Acc:XB-GENE-972670])

HSP 1 Score: 376.711 bits (966), Expect = 2.801e-124
Identity = 203/481 (42.20%), Postives = 298/481 (61.95%), Query Frame = 3
Query:  105 VSRISYVFQQITGYFDSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLD----NRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQ---HLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLM 1523
            ++R S   Q +   ++S+     +L++V + + +D +L T+I PI P  L+ ++    NR   N +     +Y   ++  I    H+  D  +GP      +IN T     K    +    L+ EN+++GL+ A K  +QLL NPIVG +  RIGY  PMFFGF+++ +ST+ FA A SY LL +AR  QG+GS+ + V  +G LA  + DDVERGKA G A+SG+A+GVL GP FG  MY++  KS PF  + +LAL+DG +Q+ +L+P+     D      K LL DPYIL+AA  +   NL    LE +LP+ +  TM A R + GL FLPC ++Y +  NVF  +  KIGRWL  M+GM+I+GI +IC+P A  I +LI PS  +G   GM+++S+MP+M +LVD+RH S YG +YAI+D+A C+G+A+GP     + KAVGF+W++ I  II L++ P  I LRNPP KEE++ L+
Sbjct:    1 MARCSPCCQWLKKTWESRAP---ILLVVAVVMFVDCILFTIIAPIAPALLYHIEYGRGNRTFKNSSG----QYPVSNYDSIFNLSHLE-DSRKGP--YHDQIINITESPGDKKNCYEGKDFLNEENVRVGLLLAIKAFLQLLFNPIVGKLVTRIGYDAPMFFGFVIVVVSTLLFAFANSYALLCVARGFQGIGSSFTMVPALGTLAQVFPDDVERGKAMGLAMSGVAIGVLAGPPFGSAMYEFVGKSAPFLAIAALALLDGVLQLCILRPTRFSTVDVPATPYKNLLMDPYILVAAVGLCICNLTFGMLETTLPIRMMETMCAPRYQLGLCFLPCIVAYFICLNVFAELAQKIGRWLCIMLGMLILGISVICMPLALNIYYLIGPSAALGIGFGMMETSVMPLMAHLVDLRHTSNYGGIYAISDIALCIGYALGPLCGGAIAKAVGFKWLMIILGIINLVFAPLFILLRNPPGKEETKPLL 471          
BLAST of slc18a-4 vs. Ensembl Xenopus
Match: ddx42 (DEAD-box helicase 42 [Source:Xenbase;Acc:XB-GENE-972670])

HSP 1 Score: 371.703 bits (953), Expect = 6.837e-122
Identity = 204/507 (40.24%), Postives = 306/507 (60.36%), Query Frame = 3
Query:   96 HKSVSRISYVFQQITGYFDSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLD----NRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQ---HLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELKSEYQTTGDPKKISDNSE 1592
            H +++R S   Q +   ++S+     +L++V + + +D +L T+I PI P  L+ ++    NR   N +     +Y   ++  I    H+  D  +GP      +IN T     K    +    L+ EN+++GL+ A K  +QLL NPIVG +  RIGY  PMFFGF+++ +ST+ FA A SY LL +AR  QG+GS+ + V  +G LA  + DDVERGKA G A+SG+A+GVL GP FG  MY++  KS PF ++ +LAL+DG +Q  VLKP+   P        + LL DPYI++AA  +   N     +EP++P+ +  TM +   + GL FLPC L+Y +  N+F     KIGRWL  MIGM+ +GI ++C+P A  I  LI P  G+G   G+ ++SM P+M +LVDIRH S YG++YAI+D+A C+G+A+GPS    + KA+GF W++ I  II L+Y P  I LRNPP KEE+  ++   E + + ++   P K++D+ E
Sbjct:   21 HNTMARCSPCCQWLKKTWESRAP---ILLVVAVVMFVDCILFTIIAPIAPALLYHIEYGRGNRTFKNSSG----QYPVSNYDSIFNLSHLE-DSRKGPY--HDQIINITESPGDKKNCYEGKDFLNEENVRVGLLLAIKAFLQLLFNPIVGKLVTRIGYDAPMFFGFVIVVVSTLLFAFANSYALLCVARGFQGIGSSFTMVPALGTLAQVFPDDVERGKAMGLAMSGVAIGVLAGPPFGSAMYEFVGKSSPFLVIAALALLDGALQCCVLKPTKFSPLSVPETPYRVLLTDPYIVVAAVGLCICNFSFGIMEPTIPIRMMETMCSPPYQLGLAFLPCMLAYFICLNLFAGFAHKIGRWLCIMIGMMALGISVLCLPLARNIFGLIAPQAGVGIGFGLFETSMFPMMAHLVDIRHTSNYGAIYAISDIALCIGYALGPSCGGAIAKAIGFTWLMVILGIINLVYAPLFILLRNPPGKEETMPVLSQEETQEQEESKPLPTKVADSHE 517          
BLAST of slc18a-4 vs. Ensembl Xenopus
Match: ddx42 (DEAD-box helicase 42 [Source:Xenbase;Acc:XB-GENE-972670])

HSP 1 Score: 367.851 bits (943), Expect = 1.292e-121
Identity = 194/438 (44.29%), Postives = 277/438 (63.24%), Query Frame = 3
Query:  219 LTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRT-----IQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQ 1514
            +++  PI P  L+   + +  N+N TVL+                  +   G  +   S+INNT  E   N+T       +L+ EN+ +GL+ A K ++QLLTNPIVG I NR GY  P+F G +++F+ST+ FA A+SY  L +AR LQG+GS+ ++V  +GMLA  + DD ERGKA G ALSG+A+GVL GP FG  MY++  KS PF  + +LAL+DG +Q+ +L+P+     D      K LL DPYIL+AA  +   NL    LE +LP+ +  TM A R + GL FLPC ++Y +  NVF  +  KIGRWL  M+GM+I+GI +IC+P A  I +LI PS  +G   GM+++S+MP+M +LVD+RH S YG +YAI+D+A C+G+A+GP     + KAVGF+W++ I  II L++ P  I LRNPP KEE++
Sbjct:    6 ISLAAPIAPALLY---DTEYGNRNTTVLL------------------NNSSGSSLYRDSIINNT--ESAGNQTQCYEEKDYLNEENVLVGLLLAIKALLQLLTNPIVGKIINRTGYDAPLFCGTIIMFLSTLMFAFADSYAFLCVARGLQGIGSSFTAVPALGMLAHVFPDDAERGKAMGIALSGVAIGVLAGPPFGSAMYEFVGKSAPFLAIAALALLDGVLQLCILRPTRFSTVDVPATPYKNLLMDPYILVAAVGLCICNLTFGMLETTLPIRMMETMCAPRYQLGLCFLPCIVAYFICLNVFAELAQKIGRWLCIMLGMLILGISVICMPLALNIYYLIGPSAALGIGFGMMETSVMPLMAHLVDLRHTSNYGGIYAISDIALCIGYALGPLCGGAIAKAVGFKWLMIILGIINLVFAPLFILLRNPPGKEETK 420          
BLAST of slc18a-4 vs. Ensembl Xenopus
Match: ddx42 (DEAD-box helicase 42 [Source:Xenbase;Acc:XB-GENE-972670])

HSP 1 Score: 369.777 bits (948), Expect = 1.420e-121
Identity = 200/503 (39.76%), Postives = 302/503 (60.04%), Query Frame = 3
Query:  105 VSRISYVFQQITGYFDSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLD----NRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQ---HLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELKSEYQTTGDPKKISDNSE 1592
            ++R S   Q +   ++S+     +L++V + + +D +L T+I PI P  L+ ++    NR   N +     +Y   ++  I    H+  D  +GP      +IN T     K    +    L+ EN+++GL+ A K  +QLL NPIVG +  RIGY  PMFFGF+++ +ST+ FA A SY LL +AR  QG+GS+ + V  +G LA  + DDVERGKA G A+SG+A+GVL GP FG  MY++  KS PF ++ +LAL+DG  +I+ +     PE       + LL DPYI++AA  +   N     +EP++P+ +  TM +   + GL FLPC L+Y +  N+F     KIGRWL  MIGM+ +GI ++C+P A  I  LI P  G+G   G+ ++SM P+M +LVDIRH S YG++YAI+D+A C+G+A+GPS    + KA+GF W++ I  II L+Y P  I LRNPP KEE+  ++   E + + ++   P K++D+ E
Sbjct:    1 MARCSPCCQWLKKTWESRAP---ILLVVAVVMFVDCILFTIIAPIAPALLYHIEYGRGNRTFKNSSG----QYPVSNYDSIFNLSHLE-DSRKGP--YHDQIINITESPGDKKNCYEGKDFLNEENVRVGLLLAIKAFLQLLFNPIVGKLVTRIGYDAPMFFGFVIVVVSTLLFAFANSYALLCVARGFQGIGSSFTMVPALGTLAQVFPDDVERGKAMGLAMSGVAIGVLAGPPFGSAMYEFVGKSSPFLVIAALALLDGGKKILHV-----PE----TPYRVLLTDPYIVVAAVGLCICNFSFGIMEPTIPIRMMETMCSPPYQLGLAFLPCMLAYFICLNLFAGFAHKIGRWLCIMIGMMALGISVLCLPLARNIFGLIAPQAGVGIGFGLFETSMFPMMAHLVDIRHTSNYGAIYAISDIALCIGYALGPSCGGAIAKAIGFTWLMVILGIINLVYAPLFILLRNPPGKEETMPVLSQEETQEQEESKPLPTKVADSHE 484          
BLAST of slc18a-4 vs. Ensembl Mouse
Match: Slc18a2 (solute carrier family 18 (vesicular monoamine), member 2 [Source:MGI Symbol;Acc:MGI:106677])

HSP 1 Score: 478.019 bits (1229), Expect = 1.927e-163
Identity = 257/514 (50.00%), Postives = 347/514 (67.51%), Query Frame = 3
Query:  150 DSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRK-HVAYDEFEGPEIIEKSVINN-----------------------TCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMM--NGELKSEYQTTGD--PKKISDNSEPSND 1604
            DS+  + ++L IVF+AL+LDNMLLTV+VPIIP YL+      I ++  T  I+  +P  T       H  +  +    +   +                            C  E K+     L  EN+++GL+FASK  +QLLTNP +G +TNRIGY IPMF GF ++FIST+ FA + SY  L IARSLQG+GS+CSSV+GMGMLA+ Y DD ERG A G AL GLAMGVL+GP FG ++Y++  K+ PF +L +L L+DG +Q+ VL+PS ++PE QKG  L TLL+DPYILIAA SI F N+GIA LEP+LP+W+  TM + + + G+ FLP S+SYL+GTN+FG +  K+GRWL  ++GM+++GI ++CIPFA  I  LI P+FG+GFAIGMVDSSMMPIMGYLVD+RHVSVYGSVYAIADVAFC+G+AIGPS    + KA+GF W++ I  II +++ P   FLR+PP KEE  +++M  N  +K++  T  +  P  + D+ E  +D
Sbjct:   14 DSRHSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYS-----IKHEKNTTEIQTARPALTASTSESFHSIFSYYNNSTVFTGNATGGLPGGESPKATTTQHTVTNTTVPPDCPSEDKD-----LLNENVQVGLLFASKATVQLLTNPFIGLLTNRIGYPIPMFAGFCIMFISTVMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNAMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLCALLGMIVVGISILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDIVFAPLCFFLRSPPAKEEKMAILMDHNCPIKTKMYTQNNVQPYPVGDDEESESD 517          
BLAST of slc18a-4 vs. Ensembl Mouse
Match: Slc18a1 (solute carrier family 18 (vesicular monoamine), member 1 [Source:MGI Symbol;Acc:MGI:106684])

HSP 1 Score: 424.861 bits (1091), Expect = 1.219e-142
Identity = 253/511 (49.51%), Postives = 348/511 (68.10%), Query Frame = 3
Query:  150 DSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVL----IKYQKP-------------DWTDIIGRKHVAY-----DEFEGPEIIEK-SVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELKSEYQ--TTGDPKKISDNSEPSND 1604
            + +Q + +VL++VF+AL+LDNMLLTV+VPI+P +L+  + +DI   N ++L    +  Q+              D T +   +HV +     +    P + E  SV  N C++      I+ L  EN++IG++FASK ++QLL NP VGP+TNRIGY IPMF GF+++F+ST+ FA + +Y LLF+AR+LQG+GS+ SSV+G+GMLA+ Y D+ ERG+A G AL GLA+G+L+G  FG +MY++  KS PF IL  LAL+DG +Q  +L PS + PE   G  L TLL+DPYIL+AA SI   N+G+A LEP+LP+W+  TM +   + GL FLP S++YL+GTN+FG +  K+GRWL +++GMV +GI L+C+P A  I  LI P+ G+GFAIGMVDSS+MPIMGYLVD+RH SVYGSVYAIADVAFCVGFAIGPS    +V  +GF W++ I   I +IY P   FL+NPP KEE  ++ +N E  +E Q  T   P K     E S+D
Sbjct:   15 EGRQSRKLVLVVVFVALLLDNMLLTVVVPIVPTFLYATEFKDI---NSSLLRGPSVSSQQALTSPAFSTTFSFFDNTTMTVEEHVPFRVAWINGTIPPPVTEAGSVPKNNCLQ-----GIEFLEEENVRIGILFASKALMQLLVNPFVGPLTNRIGYHIPMFVGFMIMFLSTLMFAFSGTYALLFVARTLQGIGSSFSSVAGLGMLASVYTDNYERGRAMGIALGGLALGLLVGAPFGSVMYEFVGKSSPFLILAFLALLDGALQFCILWPSKVSPESAMGTPLLTLLKDPYILVAAGSICLANMGVAILEPTLPIWMMQTMCSPEWQLGLAFLPASVAYLIGTNLFGVLANKMGRWLCSLVGMVAVGISLLCVPLAHNIFGLIGPNAGLGFAIGMVDSSLMPIMGYLVDLRHTSVYGSVYAIADVAFCVGFAIGPSTGGVIVPVIGFPWLMVIIGTINIIYAPLCCFLQNPPAKEEELAI-LNQECPTETQMYTIQRPTKEFPLGENSDD 516          
BLAST of slc18a-4 vs. Ensembl Mouse
Match: Slc18a3 (solute carrier family 18 (vesicular monoamine), member 3 [Source:MGI Symbol;Acc:MGI:1101061])

HSP 1 Score: 298.13 bits (762), Expect = 1.929e-93
Identity = 155/436 (35.55%), Postives = 262/436 (60.09%), Query Frame = 3
Query:  150 DSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKN--RTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQK-----GASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIG--RWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWM 1430
            + ++ + +VL+IV +AL+LDNML  VIVPI+PDY+  +      +++ T++ +  +P           AY        +  +  + T     ++  R      +E++KIG++FASK ++QLL NP+ GP  +R+ Y +P+  G  V+F ST+ FA AE Y  LF ARSLQGLGSA +  SG+ M+A  Y ++ ER +A G AL+ ++ G L+ P FGG++Y++  K VPF +L +++L D  + + V KP       +     G  +  L+ DPYI + A ++T  N+ +A LEP++  W+K TM A+  E G+V+LP  + +++G  +   +  +    +WL   +G+ +IG+    +P   + + L+V   G+ F I +VD++++P + +LVD+RHVSVYGSVYAIAD+++ V +A+GP ++  +V ++GF  +
Sbjct:   27 EPQRQRRLVLVIVCVALLLDNMLYMVIVPIVPDYIAHMRGG---SESPTLISEVWEPTLPPPTLANASAY--------LANTSASPTAAGSARSILRPRYPTESEDVKIGVLFASKAILQLLVNPLSGPFIDRMSYDVPLLIGLGVMFASTVMFAFAEDYATLFAARSLQGLGSAFADTSGIAMIADKYPEEPERSRALGVALAFISFGSLVAPPFGGILYEFAGKRVPFLVLAAVSLFDALLLLAVAKPFSAAARARANLPVGTPIHRLMLDPYIAVVAGALTTCNIPLAFLEPTIATWMKHTMAASEWEMGMVWLPAFVPHVLGVYLTVRLAARYPHLQWLYGALGLAVIGVSSCVVPACRSFAPLVVSLCGLCFGIALVDTALLPTLAFLVDVRHVSVYGSVYAIADISYSVAYALGPIVAGHIVHSLGFEQL 451          
BLAST of slc18a-4 vs. Ensembl Mouse
Match: Slc18b1 (solute carrier family 18, subfamily B, member 1 [Source:MGI Symbol;Acc:MGI:1923556])

HSP 1 Score: 63.1586 bits (152), Expect = 4.341e-10
Identity = 82/354 (23.16%), Postives = 146/354 (41.24%), Query Frame = 3
Query:  432 RTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESY-------HLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVK---IGRWLTTMIGMVIIGICLIC--IPFATTISHLIVPSFGM---GFAIGMVDSSMMPIMGYLVDIRH-------VSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRW 1427
            +  +     N  IG++F    + +LL + + G     IG       G  V    T+ F + +          + F+ R +  +G   +  +   +LA  + ++V          SGL  G++ GP  GGL+YQ     VPF  LG + L+   + + +L    +  D    S   L+  P + + A  I   +     L+P+L L++      +    GLVFL  SLSY + + +FG +  K   + +WL     ++  G  ++   +P     S L +    +   G + GM   S++P    ++   +       +S  G V  +    + VG  +GP L   L + +GF W
Sbjct:   60 KEAEKKGASNTMIGMIFGCYALFELLASLVFGKYLVHIGAKFMFIAGMFVSGGVTILFGVLDQLPEGPIFIAMCFLVRIVDAIGFGAAITASSSILAKAFPNNVATVMGSLEVFSGL--GLVAGPPLGGLLYQSFGYEVPFIFLGCIVLLMIPLNLYILPSYAQESDPGKQSFWKLVTLPKMGLLAFVIISLSSCFGFLDPTLSLFVMEKFSLSTGYVGLVFLGLSLSYAISSPLFGLLSDKMPTLRKWLLVFGNLITAGCYMLLGPVPLLHIKSQLWLLVLVLVVNGISAGM---SIIPTFPEMLSCAYANGFEDSISTLGLVSGLFGAMWSVGAFMGPILGGFLCEKIGFEW 408          
BLAST of slc18a-4 vs. Ensembl Mouse
Match: Slc18b1 (solute carrier family 18, subfamily B, member 1 [Source:MGI Symbol;Acc:MGI:1923556])

HSP 1 Score: 61.6178 bits (148), Expect = 1.434e-9
Identity = 83/354 (23.45%), Postives = 149/354 (42.09%), Query Frame = 3
Query:  432 RTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESY-------HLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVK---IGRWLTTMIGMVIIGICLIC--IPFATTISHLIVPSFGM---GFAIGMVDSSMMPIMGYLVDIRH-------VSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRW 1427
            +  +     N  IG++F    + +LL + + G     IG       G  V    T+ F + +          + F+ R +  +G   +  +   +LA  + ++V          SGL  G++ GP  GGL+YQ     VPF  LG + L+   + + +L PS + +  K +  K +      L+A   I+  +     L+P+L L++      +    GLVFL  SLSY + + +FG +  K   + +WL     ++  G  ++   +P     S L +    +   G + GM   S++P    ++   +       +S  G V  +    + VG  +GP L   L + +GF W
Sbjct:   60 KEAEKKGASNTMIGMIFGCYALFELLASLVFGKYLVHIGAKFMFIAGMFVSGGVTILFGVLDQLPEGPIFIAMCFLVRIVDAIGFGAAITASSSILAKAFPNNVATVMGSLEVFSGL--GLVAGPPLGGLLYQSFGYEVPFIFLGCIVLLMIPLNLYIL-PSYESDPGKQSFWKLVTLPKMGLLAFVIISLSSC-FGFLDPTLSLFVMEKFSLSTGYVGLVFLGLSLSYAISSPLFGLLSDKMPTLRKWLLVFGNLITAGCYMLLGPVPLLHIKSQLWLLVLVLVVNGISAGM---SIIPTFPEMLSCAYANGFEDSISTLGLVSGLFGAMWSVGAFMGPILGGFLCEKIGFEW 406          
BLAST of slc18a-4 vs. UniProt/SwissProt
Match: sp|Q27963|VMAT2_BOVIN (Synaptic vesicular amine transporter OS=Bos taurus OX=9913 GN=SLC18A2 PE=1 SV=1)

HSP 1 Score: 479.559 bits (1233), Expect = 2.452e-163
Identity = 254/509 (49.90%), Postives = 352/509 (69.16%), Query Frame = 3
Query:  150 DSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWT-DIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLST------------------ENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMM--NGELKSEY--QTTGDPKKISDNSEPSND 1604
            +S+  + ++L IVF+AL+LDNMLLTV+VPIIP YL+ +++     +   + I+  KP  T    G     +  ++   ++  +  ++     +   T QH++T                  EN+++GL+FASK  +QLLTNP +G +TNRIGY IPMF GF ++FIST+ FA + +Y  L IARSLQG+GS+CSSV+GMGMLA+ Y DD ERG A G AL GLAMGVL+GP FG ++Y++  K+ PF +L +L L+DG +Q+ VL+PS ++PE QKG  L TLLRDPYILIAA SI F N+GIA LEP+LP+W+  TM + + + G+ FLP S+SYL+GTNVFG +  K+GRWL  ++GM+I+G+ ++CIP A  I  LI P+FG+GFAIGMVDSSMMPIMGYLVD+RHVSVYGSVYAIADVAFC+G+AIGPS    + KA+GF W++ I  II +++ P   FLR+PP KEE  +++M  N  +K++   Q +     I ++ E  +D
Sbjct:   14 ESRHSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIEH-----EKDALEIQTAKPGLTASAPGSFQNIFSYYDNSTMVTGNSTDHLQGALVHEATTQHMATNSSSASSDCPSEDKDLLNENVQVGLLFASKATVQLLTNPFIGLLTNRIGYPIPMFTGFCIMFISTVMFAFSRTYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNAMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLRDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSHKWQLGVAFLPASVSYLIGTNVFGILAHKMGRWLCALLGMIIVGMSILCIPLAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKMAILMDHNCPIKTKMYTQNSSQSHPIGEDEESESD 517          
BLAST of slc18a-4 vs. UniProt/SwissProt
Match: sp|Q01827|VMAT2_RAT (Synaptic vesicular amine transporter OS=Rattus norvegicus OX=10116 GN=Slc18a2 PE=1 SV=2)

HSP 1 Score: 478.789 bits (1231), Expect = 5.833e-163
Identity = 262/511 (51.27%), Postives = 348/511 (68.10%), Query Frame = 3
Query:  150 DSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQ---------------------NCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMM--NGELKSEYQTTGDPKK--ISDNSEPSND 1604
            DS+  + ++L IVF+AL+LDNMLLTV+VPIIP YL+ + +     +                     N TVLI       T   G+ H A          + +V N T   +  +   + L  EN+++GL+FASK  +QLLTNP +G +TNRIGY IPMF GF ++FIST+ FA + SY  L IARSLQG+GS+CSSV+GMGMLA+ Y DD ERGK  G AL GLAMGVL+GP FG ++Y++  K+ PF +L +L L+DG +Q+ VL+PS ++PE QKG  L TLL+DPYILIAA SI F N+GIA LEP+LP+W+  TM + + + G+ FLP S+SYL+GTN+FG +  K+GRWL  ++GMVI+GI ++CIPFA  I  LI P+FG+GFAIGMVDSSMMPIMGYLVD+RHVSVYGSVYAIADVAFC+G+AIGPS    + KA+GF W++ I  II + + P   FLR+PP KEE  +++M  N  +K +  T  + +   I D+ E  +D
Sbjct:   14 DSRHSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNSTEIQTTRPELVVSTSESIFSYYNNSTVLIT-GNATGTLPGGQSHKATST-------QHTVANTTVPSDCPSED-RDLLNENVQVGLLFASKATVQLLTNPFIGLLTNRIGYPIPMFAGFCIMFISTVMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGKPMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLCALLGMVIVGISILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDIAFAPLCFFLRSPPAKEEKMAILMDHNCPIKRKMYTQNNVQSYPIGDDEESESD 515          
BLAST of slc18a-4 vs. UniProt/SwissProt
Match: sp|Q8BRU6|VMAT2_MOUSE (Synaptic vesicular amine transporter OS=Mus musculus OX=10090 GN=Slc18a2 PE=1 SV=1)

HSP 1 Score: 478.019 bits (1229), Expect = 1.348e-162
Identity = 257/514 (50.00%), Postives = 347/514 (67.51%), Query Frame = 3
Query:  150 DSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRK-HVAYDEFEGPEIIEKSVINN-----------------------TCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMM--NGELKSEYQTTGD--PKKISDNSEPSND 1604
            DS+  + ++L IVF+AL+LDNMLLTV+VPIIP YL+      I ++  T  I+  +P  T       H  +  +    +   +                            C  E K+     L  EN+++GL+FASK  +QLLTNP +G +TNRIGY IPMF GF ++FIST+ FA + SY  L IARSLQG+GS+CSSV+GMGMLA+ Y DD ERG A G AL GLAMGVL+GP FG ++Y++  K+ PF +L +L L+DG +Q+ VL+PS ++PE QKG  L TLL+DPYILIAA SI F N+GIA LEP+LP+W+  TM + + + G+ FLP S+SYL+GTN+FG +  K+GRWL  ++GM+++GI ++CIPFA  I  LI P+FG+GFAIGMVDSSMMPIMGYLVD+RHVSVYGSVYAIADVAFC+G+AIGPS    + KA+GF W++ I  II +++ P   FLR+PP KEE  +++M  N  +K++  T  +  P  + D+ E  +D
Sbjct:   14 DSRHSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYS-----IKHEKNTTEIQTARPALTASTSESFHSIFSYYNNSTVFTGNATGGLPGGESPKATTTQHTVTNTTVPPDCPSEDKD-----LLNENVQVGLLFASKATVQLLTNPFIGLLTNRIGYPIPMFAGFCIMFISTVMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNAMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLCALLGMIVVGISILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDIVFAPLCFFLRSPPAKEEKMAILMDHNCPIKTKMYTQNNVQPYPVGDDEESESD 517          
BLAST of slc18a-4 vs. UniProt/SwissProt
Match: sp|Q05940|VMAT2_HUMAN (Synaptic vesicular amine transporter OS=Homo sapiens OX=9606 GN=SLC18A2 PE=1 SV=2)

HSP 1 Score: 471.855 bits (1213), Expect = 2.307e-160
Identity = 253/511 (49.51%), Postives = 350/511 (68.49%), Query Frame = 3
Query:  150 DSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIG---------------------RKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMM--NGELKSEYQTTGDPKK--ISDNSEPSND 1604
            +S++ + ++L IVF+AL+LDNMLLTV+VPIIP YL+ + +     +N T  I+  +P  T  I                      R    +       +   S + + C  E K+     L  EN+++GL+FASK  +QL+TNP +G +TNRIGY IP+F GF ++F+ST+ FA + SY  L IARSLQG+GS+CSSV+GMGMLA+ Y DD ERG   G AL GLAMGVL+GP FG ++Y++  K+ PF +L +L L+DG +Q+ VL+PS ++PE QKG  L TLL+DPYILIAA SI F N+GIA LEP+LP+W+  TM + + + G+ FLP S+SYL+GTN+FG +  K+GRWL  ++GM+I+G+ ++CIPFA  I  LI P+FG+GFAIGMVDSSMMPIMGYLVD+RHVSVYGSVYAIADVAFC+G+AIGPS    + KA+GF W++ I  II +++ P   FLR+PP KEE  +++M  N  +K++  T  + +   I ++ E  +D
Sbjct:   14 ESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHE----KNATE-IQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKD-----LLNENVQVGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLCALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKMAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD 514          
BLAST of slc18a-4 vs. UniProt/SwissProt
Match: sp|Q01818|VMAT1_RAT (Chromaffin granule amine transporter OS=Rattus norvegicus OX=10116 GN=Slc18a1 PE=2 SV=1)

HSP 1 Score: 426.017 bits (1094), Expect = 2.709e-142
Identity = 250/510 (49.02%), Postives = 345/510 (67.65%), Query Frame = 3
Query:  150 DSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRD----------IINQNCTVLIKYQKP----DWTDIIGRKHVAYD------EFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELKSEYQ--TTGDPKKISDNSEPSNDLS 1610
            + +Q + +VL++VF+AL+LDNMLLTV+VPI+P +L+  + +D          + +Q       +       D T     +HV +           P     SV  N C++      I+ L  EN++IG++FASK ++QLL NP VGP+TNRIGY IPMF GF+++F+ST+ FA + +Y LLF+AR+LQG+GS+ SSV+G+GMLA+ Y D+ ERG+A G AL GLA+G+L+G  FG +MY++  KS PF IL  LAL+DG +Q+ +L PS + PE   G SL TLL+DPYIL+AA SI   N+G+A LEP+LP+W+  TM +   + GL FLP S++YL+GTN+FG +  K+GRWL +++GMV +GI L+C+P A  I  LI P+ G+GFAIGMVDSS+MPIMGYLVD+RH SVYGSVYAIADVAFCVGFAIGPS    +V+ +GF W++ I   I +IY P   FL+NPP KEE +++ ++ E  +E Q  T   P K     E S+D S
Sbjct:   15 EGRQSRKLVLVVVFVALLLDNMLLTVVVPIVPTFLYATEFKDSNSSLHRGPSVSSQQALTSPAFSTIFSFFDNTTTTVEEHVPFRVTWTNGTIPPPVTEASSVPKNNCLQ-----GIEFLEEENVRIGILFASKALMQLLVNPFVGPLTNRIGYHIPMFVGFMIMFLSTLMFAFSGTYALLFVARTLQGIGSSFSSVAGLGMLASVYTDNYERGRAMGIALGGLALGLLVGAPFGSVMYEFVGKSSPFLILAFLALLDGALQLCILWPSKVSPESAMGTSLLTLLKDPYILVAAGSICLANMGVAILEPTLPIWMMQTMCSPEWQLGLAFLPASVAYLIGTNLFGVLANKMGRWLCSLVGMVAVGISLLCVPLAHNIFGLIGPNAGLGFAIGMVDSSLMPIMGYLVDLRHTSVYGSVYAIADVAFCVGFAIGPSTGGVIVQVIGFPWLMVIIGTINIIYAPLCCFLQNPPAKEEKRAI-LSQECPTETQMYTFQKPTKAFPLGENSDDPS 518          
BLAST of slc18a-4 vs. TrEMBL
Match: A0A0H3YJ83 (Slc18a-4 OS=Schmidtea mediterranea OX=79327 GN=slc18a-4 PE=2 SV=1)

HSP 1 Score: 1083.94 bits (2802), Expect = 0.000e+0
Identity = 533/533 (100.00%), Postives = 533/533 (100.00%), Query Frame = 3
Query:   63 MKYINIDSDGNHKSVSRISYVFQQITGYFDSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELKSEYQTTGDPKKISDNSEPSNDLSIPIDKTVLSQGYGYGDD 1661
            MKYINIDSDGNHKSVSRISYVFQQITGYFDSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELKSEYQTTGDPKKISDNSEPSNDLSIPIDKTVLSQGYGYGDD
Sbjct:    1 MKYINIDSDGNHKSVSRISYVFQQITGYFDSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELKSEYQTTGDPKKISDNSEPSNDLSIPIDKTVLSQGYGYGDD 533          
BLAST of slc18a-4 vs. TrEMBL
Match: S5W2Q8 (Vmat OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1082.78 bits (2799), Expect = 0.000e+0
Identity = 532/533 (99.81%), Postives = 532/533 (99.81%), Query Frame = 3
Query:   63 MKYINIDSDGNHKSVSRISYVFQQITGYFDSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELKSEYQTTGDPKKISDNSEPSNDLSIPIDKTVLSQGYGYGDD 1661
            MKYINIDSDGNHKSVSRISYVFQQITGYFDSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIG KIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELKSEYQTTGDPKKISDNSEPSNDLSIPIDKTVLSQGYGYGDD
Sbjct:    1 MKYINIDSDGNHKSVSRISYVFQQITGYFDSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGAKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELKSEYQTTGDPKKISDNSEPSNDLSIPIDKTVLSQGYGYGDD 533          
BLAST of slc18a-4 vs. TrEMBL
Match: V5SMF7 (Vesicular monoamine transporter OS=Schmidtea mediterranea OX=79327 GN=vmat PE=2 SV=1)

HSP 1 Score: 617.461 bits (1591), Expect = 0.000e+0
Identity = 317/516 (61.43%), Postives = 401/516 (77.71%), Query Frame = 3
Query:   78 IDSDGNHKSVSRISYVFQQI-TGYFDSK---QHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNT--CVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELKSEYQTTGDPKKISDNSEPSNDL 1607
            ID +G  ++       FQ+I   +FD     + +T+VL+IVF+AL+LDN+LLTVIVPI+P+YLW +++ + I   C    K    DWT +IGRKH       G EI+  +  N++  C+EELK+ ++ ++S+E++ IGLMFASKPV+QL+ NP+VGPITNR+GY++PMF GF+VLFIST+ FA AESY LLF ARS QG+GSACSSVSGMGMLAT+Y DD ERG+AFGFALSGLAMGVLIGP FGG+MY+YT K VPF ILG+L  +DG +Q++VLKPSIKPE Q GASLK+LL DPYI++AAA IT GN+GIA LEPSLP+WIK+TMKA+RLEQGLVFLP SLSYL+GTNVFG IG KIGRWL TMIGM++I I L+ IP A  I  LIVP   +GFAIGMVDSS++PIMGYLVDIRHVSVYG+VYAIADVAFCVGFA GP++S  ++KA+GF+WM+ ++AI+C ++TP I+FLRNPP K    +  +  +   EYQ      KI DNS  +N++
Sbjct:    5 IDENGERQT----DNCFQKIGRKFFDFNFKVKQRTLVLMIVFVALLLDNVLLTVIVPIMPEYLWTINHNEKIKLFCPGE-KVTNKDWTSMIGRKHF------GSEILTSTRENDSISCIEELKSNSLSNISSESIAIGLMFASKPVVQLIVNPLVGPITNRMGYTVPMFTGFVVLFISTIVFAFAESYKLLFFARSFQGIGSACSSVSGMGMLATFYPDDKERGEAFGFALSGLAMGVLIGPSFGGIMYEYTDKQVPFIILGALVFLDGVLQMIVLKPSIKPEPQLGASLKSLLMDPYIVLAAACITIGNMGIAVLEPSLPIWIKSTMKASRLEQGLVFLPFSLSYLLGTNVFGYIGHKIGRWLGTMIGMLLISIFLLIIPLAVDIGSLIVPGTIIGFAIGMVDSSILPIMGYLVDIRHVSVYGTVYAIADVAFCVGFATGPAISGAIIKAIGFQWMLTVAAIVCFLFTPLIVFLRNPPAKVHDSATFIKEQCPVEYQK----NKIIDNSNLANNI 505          
BLAST of slc18a-4 vs. TrEMBL
Match: A0A0H3YFC2 (Slc18a-7 OS=Schmidtea mediterranea OX=79327 GN=slc18a-7 PE=2 SV=1)

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 311/512 (60.74%), Postives = 399/512 (77.93%), Query Frame = 3
Query:   78 IDSDGNHKSVSRISYVFQQITGYFDSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNT--CVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELKSEYQTTGDPKKISDNSEPSNDL 1607
            ID +G  ++ +    + ++   +    + +T+VL+IVF+AL+LDN+LLTVIVPI+P+YLW +++ + I   C    K    DWT +IGRKH       G EI+  +  N++  C+EELK+ ++ ++S+E++ IGLMFASKPV+QL+ NP+VGPITNR+GY++PMF GF+VLFIST+ FA AESY LLF ARS QG+GSACSSVSGMGMLAT+Y DD ERG+AFGFALSGLAMGVLIGP FGG+MY+YT K VPF ILG+L  +DG +Q++VLKPSIKPE Q GASLK+LL DPYI++AAA IT GN+GIA LEPSLP+WIK+TMKA+RLEQGLVFLP SLSYL+GTNVFG IG KIGRWL TMIGM++I I L+ IP A  I  LIVP   +GFAIGMVDSS++PIMGYLVDIRHVSVYG+VYAIADVAFCVGFA GP++S  ++KA+GF+WM+ ++AI+C ++TP I+FLRNPP K    +  +  +   +YQ      KI DNS  +N++
Sbjct:    5 IDENGERQTDNCFQKIGRKFFDFNFKVKQRTLVLMIVFVALLLDNVLLTVIVPIMPEYLWTINHNEKIKLFCPGE-KVTNKDWTSMIGRKHF------GSEILTSTRENDSISCIEELKSNSLSNISSESIAIGLMFASKPVVQLIVNPLVGPITNRMGYTVPMFTGFVVLFISTIVFAFAESYKLLFFARSFQGIGSACSSVSGMGMLATFYPDDKERGEAFGFALSGLAMGVLIGPSFGGIMYEYTDKQVPFIILGALVFLDGVLQMIVLKPSIKPEPQLGASLKSLLMDPYIVLAAACITIGNMGIAVLEPSLPIWIKSTMKASRLEQGLVFLPFSLSYLLGTNVFGYIGHKIGRWLGTMIGMLLISIFLLIIPLAVDIGSLIVPGTIIGFAIGMVDSSILPIMGYLVDIRHVSVYGTVYAIADVAFCVGFATGPAISGAIIKAIGFQWMLTVAAIVCFLFTPLIVFLRNPPAKVHDSATFIKEQCPVDYQK----NKIIDNSNLANNI 505          
BLAST of slc18a-4 vs. TrEMBL
Match: A0A267E7U6 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020917g1 PE=4 SV=1)

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 288/560 (51.43%), Postives = 373/560 (66.61%), Query Frame = 3
Query:   63 MKYINIDSDGNHKSVS---RISYVFQQITGYFDSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDI--------INQNCTVLIKY---------QKPDWTDIIGRK------------------------------------------HVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELKSEYQT 1556
            M Y       + K +S   R  Y F  +TG  +S++   ++L+IVFIAL LDNMLLT +VPIIPD+LW + +RD         + +N T+  ++         Q   W     RK                                          HV Y      +I       + C  E  N   + L   N+ +GLMFA+K V+QL+ NP VGP+TNRIGYSIPMF GF+++FIST+ FA  ESY +LF+AR++QG+GSACSSVSG+GMLAT Y DD ERG+A   AL GLAMGVL+GP FGGLMYQ+ SK   F +L  LAL+DG +Q++VLKP ++ E Q+GA LK LLRDPYIL+AA SITFGN+GIA LEPSLP+W+K TM+A + EQG+ FLPCS+SYL+GTN+FG +  +IGRWL+  +GMVI+G+CLI IPFA ++ HL+VP+FG+GFAIGMVDSSMMP+MGYLVD+RHVSVYGSVYAIAD+AFC+GFA+GP+LS  +VK +GFRWM+W  AII  IY P   FLR+PP + E + L+M G+  ++YQT
Sbjct:    1 MGYREFQDGSDEKKLSWLGRAQYAFDNLTGMRNSRK---LILLIVFIALFLDNMLLTTVVPIIPDFLWYIRHRDYNYTAECIQLAKNETIAARHSHLFNNSTDQFAQWVAEAARKGHQSVAGEFGSGGGGRGPGEGGGFHRFYGRMPVLHADRYFVEHVKYIRLNDSKI-------HDCFVEADNWRHEQLVEMNIHVGLMFAAKSVMQLMVNPFVGPLTNRIGYSIPMFSGFVIMFISTIIFAFGESYGVLFVARAIQGIGSACSSVSGLGMLATQYPDDKERGQAMSLALGGLAMGVLVGPPFGGLMYQFVSKEAAFLLLAGLALLDGVLQLLVLKPGVRREAQEGAPLKNLLRDPYILLAAGSITFGNMGIAMLEPSLPIWMKDTMRAQKWEQGVAFLPCSISYLIGTNLFGALAFRIGRWLSAGLGMVIMGVCLIIIPFANSLGHLVVPNFGLGFAIGMVDSSMMPLMGYLVDLRHVSVYGSVYAIADIAFCLGFAVGPALSGSIVKMMGFRWMMWSIAIIAFIYAPLHYFLRDPPARMEDRGLVMGGQKPAQYQT 550          
BLAST of slc18a-4 vs. Ensembl Cavefish
Match: slc18a2 (synaptic vesicular amine transporter [Source:NCBI gene;Acc:103032219])

HSP 1 Score: 509.22 bits (1310), Expect = 7.514e-176
Identity = 250/498 (50.20%), Postives = 348/498 (69.88%), Query Frame = 3
Query:  150 DSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDN--RDIINQNCTVLIKYQKPDWT--------DIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELK---SEYQTTGDPKKISDNSEPSN 1601
            + +Q + ++L+IVFIAL+LDNMLLTV+VPIIP YL+ +D+   + + +N +       P  T        D   R      +F  P +   + + +        +    L  EN+K+GL+FASK  +QL+TNP +GP+TNRIGY IPMF GF ++F+ST+ FA + SY LLF+ARS+QG+GS+CSSV+GMGMLA+ Y DD ERG A G AL GLAMGVL+GP FG +MY++  K+ PF IL  LA++DG +Q+ VL+PS ++PE QKG SL TL++DPYILIAA SI F N+ IA LEP+LP+W+  TM A + + G+ FLP S+SYL+GTN+F  +  K+GRWL  +IGM+++GI ++C+PFA  I  LI+P+FG+GFAIGMVDSSMMPIMGYLVD+RH+SVYGSVYAIADVAFC+GFA GPS    + +++GF W++ I  I+ +++ P   FLR+PP  EE  +++M+         Y T G   ++ D+ +P +
Sbjct:   18 EGRQSRRLILLIVFIALLLDNMLLTVVVPIIPSYLYTVDDAASNAVRKNSS-----SSPSGTFQTIVSLYDNTTRLTNISPQFNTPTMPPTTTVTSAPNASNCPKADDQLLNENVKVGLLFASKATVQLITNPFIGPLTNRIGYQIPMFAGFCIMFLSTIMFAFSSSYTLLFLARSMQGVGSSCSSVAGMGMLASVYTDDEERGNAIGIALGGLAMGVLVGPPFGSVMYEFVGKTAPFLILAVLAVLDGALQLFVLQPSKVEPESQKGTSLMTLMKDPYILIAAGSICFANMAIAMLEPALPIWMMETMCARKWQLGVAFLPASVSYLIGTNIFAVLANKMGRWLCALIGMLLVGISILCVPFAKDIYGLILPNFGVGFAIGMVDSSMMPIMGYLVDLRHISVYGSVYAIADVAFCMGFAFGPSAGGAIARSIGFPWLMTIIGIVDILFAPLCFFLRSPPANEEKMAILMDSNCSMRTRSYSTQGSSYQMGDDMDPDS 510          
BLAST of slc18a-4 vs. Ensembl Cavefish
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:103028146])

HSP 1 Score: 451.825 bits (1161), Expect = 1.968e-153
Identity = 239/481 (49.69%), Postives = 332/481 (69.02%), Query Frame = 3
Query:  207 DNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKY--QKPDWTDIIG-RKHVAYDEFEGPEIIEKSVINNTCVEELK-NRT-----IQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELK---SEYQTTGDPKK--ISDNSEPSND 1604
            DNMLLTV+VPI+P +L+ +++   +  + + L     ++P ++ I+    + AY   E P  +      +     LK N++      + L  EN+++GL+FASK ++QLL NP VGP+TNRIGY IPMF GF+++F+ST+ FA + +Y LLF ARSLQG+GS+ SSV+G+GMLA+ Y DD ERG A G AL GLAMGVLIG  FG +MY++  KS PF IL  LAL DG +Q+ +L+PS I P   +G  L TLL+DPYILI+A S+ F N+G+A LEP+LP+W+  TM + + + G+ FLP S+SYL+GTN+FG +  K+GRWL +MIGM I+GI LIC+P A+ I  LI P+ G+GFAIGMVDSSMM IMGYLVDIRH SVYGSVYAIADVA C+GFAIGPS    +V+ +GF +++ +  I+ ++Y P   FL+NP  +EE  ++ +N E       Y T  + ++  +SD+SE   +
Sbjct:   31 DNMLLTVVVPIVPTFLYTVEHPKSVLSSTSSLPSSSTEQPAFSSILSLYDNTAYTLTESPSNLSDPSTPSPPETGLKGNKSDCKDDTEFLDEENVRVGLLFASKALVQLLVNPFVGPLTNRIGYHIPMFAGFIIMFVSTIMFAFSGTYALLFFARSLQGIGSSFSSVAGLGMLASVYTDDEERGIAMGIALGGLAMGVLIGAPFGSVMYEFVGKSSPFLILAFLALFDGALQLCILQPSKISPGSVEGTPLLTLLKDPYILISAGSLCFANMGVAILEPTLPIWMMQTMCSQKWQLGVAFLPASVSYLIGTNLFGLLANKMGRWLCSMIGMFIVGISLICVPLASNIYGLIGPNGGLGFAIGMVDSSMMAIMGYLVDIRHSSVYGSVYAIADVALCMGFAIGPSTGGAIVRVIGFPYLMVMIGIVNILYAPLCYFLKNPAVREEKMAI-INQECPMAVKSYNTQRECREFPLSDDSEEDTE 510          
BLAST of slc18a-4 vs. Ensembl Cavefish
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:103028146])

HSP 1 Score: 434.876 bits (1117), Expect = 8.594e-147
Identity = 237/486 (48.77%), Postives = 327/486 (67.28%), Query Frame = 3
Query:  207 DNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKY--QKPDWTDIIG-RKHVAYDEFEGPEIIEKSVINNTCVEELK-NRT-----IQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVL-----FISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELK---SEYQTTGDPKK--ISDNSEPSND 1604
            DNMLLTV+VPI+P +L+ +++   +  + + L     ++P ++ I+    + AY   E P  +      +     LK N++      + L  EN+++GL+FASK ++QLL NP VGP+TNRIGY IPMF    V+     FI  + FA + +Y LLF ARSLQG+GS+ SSV+G+GMLA+ Y DD ERG A G AL GLAMGVLIG  FG +MY++  KS PF IL  LAL DG +Q+ +L+PS I P   +G  L TLL+DPYILI+A S+ F N+G+A LEP+LP+W+  TM + + + G+ FLP S+SYL+GTN+FG +  K+GRWL +MIGM I+GI LIC+P A+ I  LI P+ G+GFAIGMVDSSMM IMGYLVDIRH SVYGSVYAIADVA C+GFAIGPS    +V+ +GF +++ +  I+ ++Y P   FL+NP  +EE  ++ +N E       Y T  + ++  +SD+SE   +
Sbjct:   34 DNMLLTVVVPIVPTFLYTVEHPKSVLSSTSSLPSSSTEQPAFSSILSLYDNTAYTLTESPSNLSDPSTPSPPETGLKGNKSDCKDDTEFLDEENVRVGLLFASKALVQLLVNPFVGPLTNRIGYHIPMFILATVIMIMFAFIYNILFAFSGTYALLFFARSLQGIGSSFSSVAGLGMLASVYTDDEERGIAMGIALGGLAMGVLIGAPFGSVMYEFVGKSSPFLILAFLALFDGALQLCILQPSKISPGSVEGTPLLTLLKDPYILISAGSLCFANMGVAILEPTLPIWMMQTMCSQKWQLGVAFLPASVSYLIGTNLFGLLANKMGRWLCSMIGMFIVGISLICVPLASNIYGLIGPNGGLGFAIGMVDSSMMAIMGYLVDIRHSSVYGSVYAIADVALCMGFAIGPSTGGAIVRVIGFPYLMVMIGIVNILYAPLCYFLKNPAVREEKMAI-INQECPMAVKSYNTQRECREFPLSDDSEEDTE 518          
BLAST of slc18a-4 vs. Ensembl Cavefish
Match: slc18a3a (solute carrier family 18 member A3 [Source:NCBI gene;Acc:103044616])

HSP 1 Score: 290.426 bits (742), Expect = 1.062e-90
Identity = 162/506 (32.02%), Postives = 274/506 (54.15%), Query Frame = 3
Query:  138 TGYFDSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKP--SIKPEDQK-GASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIG--RWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRN----PPKKEESQSLMMNGELKSEYQTTGDPKKISDNSEPSNDLSIPIDKT 1628
            T   D ++ + ++L+IV +AL+LDNML  VIVPI+P                            D + R     ++     +   +  ++      +N  +Q        +G++FASK ++QL+ NP+ G   +R+GY IP+  G  ++F+ST  FA AE+Y  +F+ARS+QGLGSA +  +G+ M+A  Y ++ ER +A G AL+ ++ G L  P FGG++YQ+  K VPF  L  + L DG + + VLKP  S   E+   G  +  L+ DPYI + A ++T  N+ +A LEP++  W++ TM +++ + GL +LP    +++G  +   +  +    +W    +GMVIIG     +P       LI+P  G+ F I +VD++++P + +LVD+RHVSVYGSVYAIAD+++CV +A+GP ++  +V  +GF  +     +  ++Y P ++ LRN     P   E   L+  G          + ++   +   ++   +P+D+ 
Sbjct:   29 TAIQDPERQRRIILVIVCVALLLDNMLYMVIVPIVP----------------------------DYLARLESQSEQSHHVVLSNSTNSSSQTNFPAENLDLQ--------VGVLFASKAILQLIVNPLTGTFIDRVGYDIPLLIGLSIMFVSTCIFAFAENYATMFVARSMQGLGSAFADTAGIAMIADTYTEEAERSRALGIALAFISFGSLAAPPFGGVLYQFAGKRVPFIALACVCLADGILCLTVLKPFSSRTRENMPVGPPIYKLMIDPYIAVVAGALTTCNIPLAFLEPTIANWMEETMDSSQWQIGLTWLPAFFPHVLGVYITVKLAAQYPHLQWFYGALGMVIIGASSCTVPACKNFEQLIIPLCGICFGIALVDTALLPTLAFLVDVRHVSVYGSVYAIADISYCVAYAMGPIVAGKIVHDLGFVQLNLGMGLANVLYAPALLLLRNVCMMKPSHSERNMLLEEGATGLYDTIRMEERQARKHGYSTSGNCLPVDEN 498          
BLAST of slc18a-4 vs. Ensembl Cavefish
Match: slc18a3b (solute carrier family 18 member 3b [Source:NCBI gene;Acc:394082])

HSP 1 Score: 287.73 bits (735), Expect = 4.251e-90
Identity = 162/469 (34.54%), Postives = 258/469 (55.01%), Query Frame = 3
Query:  150 DSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVD-DVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKP----SIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIG--RWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRN----PPKKEESQSLM 1523
            D K+ +T++L+IV +AL+LDNML  VIVPIIP                                      D   G   + K+ ++                   +KIG++FASK ++QL  NP+ GP  +R+GY +P+  G +V+F+ST  FA AE+Y  LF ARSLQGLGSA +  SG+ M+A  Y D + ER +A G AL+ ++ G L+ P FGG++Y+   K VPF +L  + L DG + + V+KP      +     G  L  L+ DPYI + A ++T  N+ +A LEP++  W++ TM AT+ + GL +LP    +++G  +   +  +    +W    +GM+IIG     +P   + S L++P  G+ F I +VD++++P M +LVD+R+ SVYGSVYAIAD+++ V +A+GP  +  +V  +GF  +     +  ++Y P ++ LR+     P + E + L+
Sbjct:   18 DPKRQRTVILVIVCVALLLDNMLYMVIVPIIP--------------------------------------DYLAGASPVSKTNLD-------------------VKIGVLFASKAILQLAVNPLSGPFIDRVGYDLPLLIGLMVMFMSTCVFAFAETYATLFAARSLQGLGSAFADTSGIAMIADRYGDEETERSRALGLALAFISFGSLVAPPFGGILYELAGKRVPFLVLACVCLADGCLLLAVVKPFSNQGARQNQPAGVPLHRLIMDPYIAVVAGALTVCNIPLAFLEPTIAGWMENTMHATKWQIGLAWLPSFFPHVLGVYLTVKLAERYPSMQWFYGAVGMLIIGASSCVVPACKSFSQLMLPLCGICFGIALVDTALLPTMAFLVDVRYASVYGSVYAIADISYSVAYALGPVAAGHIVHTMGFAQLNLGMGLANVLYAPALLALRHVCQIKPSRSERRILL 429          
BLAST of slc18a-4 vs. Ensembl Sea Lamprey
Match: slc18a2 (solute carrier family 18 member 2 [Source:ZFIN;Acc:ZDB-GENE-080514-1])

HSP 1 Score: 501.13 bits (1289), Expect = 5.248e-173
Identity = 254/519 (48.94%), Postives = 346/519 (66.67%), Query Frame = 3
Query:  150 DSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRD--IINQNCTVLIKYQKPDW---TDIIGRKHVAYDEFEGPEIIEKSVI-------------------------NNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELKSE---YQTTGDPKKISDNSEPSND 1604
            +S++ +  VL+IVF+AL+LDNMLLTV+VPI+P YL+ +++ D    N +  +L     P     TD  G       +    E  E S                            +   + L +  +  L  EN+++GL+FA+K  +QLL NP +GP+TNR+GY  PMF GF+++F+ST+ FA A+SY LLF+AR+LQG+GS+CSSV+GMGMLA+ Y DD ERG A G AL GLAMGVL+GP FG +MY +  K  PF +L  LAL DG +Q++VL+PS  +PE Q G  L TLLRDPYILI A SI   N+GIA LEP+LP+W+  TM + + + G+ F+P S+SY +GTN+FGP+  K+GRWL  +IGMV++GI +IC+P A TI  LIVP+FG+GFAIGMVDSSMMP+MGYLVD+RHVSVYGSVYAIADVAFC+GFA+GPS    + + +GF W++ I  II +++ P   FLR+PP +EE  S++MN E       Y + G  +   D ++P+ D
Sbjct:   15 ESRRSRKFVLLIVFVALLLDNMLLTVVVPIVPSYLYAIEHPDEHPRNDSGQLLAPIAAPHAATATDDGGPSQAQGGQEGSQEPQEPSPSPGSPTPDPCSRRRSRHHRSTGSNPGGSALNDSLCDMDVAALLNENVRVGLLFAAKATVQLLANPFIGPLTNRVGYHSPMFAGFIIMFLSTIMFAFAQSYPLLFLARALQGIGSSCSSVAGMGMLASLYPDDEERGNAMGVALGGLAMGVLVGPPFGSIMYDFVGKPAPFLVLAGLALFDGALQMLVLQPSKSEPESQTGTPLLTLLRDPYILITAGSICIANMGIAMLEPALPIWMMETMCSPKWQLGVAFIPASISYWIGTNIFGPLAHKMGRWLCALIGMVVVGISIICVPLAKTIYGLIVPNFGVGFAIGMVDSSMMPLMGYLVDLRHVSVYGSVYAIADVAFCMGFALGPSAGGAIARTIGFPWLMTIIGIIDILFAPLCYFLRSPPGREEKMSILMNEECPVRTRMYTSHGSVRSTVDGAQPTGD 533          
BLAST of slc18a-4 vs. Ensembl Sea Lamprey
Match: slc18a3a (solute carrier family 18 member 3a [Source:NCBI gene;Acc:559347])

HSP 1 Score: 297.745 bits (761), Expect = 3.222e-94
Identity = 164/507 (32.35%), Postives = 276/507 (54.44%), Query Frame = 3
Query:  150 DSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINN------------TCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKP-SIKPEDQ--KGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIG--RWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRN----PPKKE--ESQSLMMNGELKSEYQTTGDPKKISDNSEPSN 1601
            + ++ + +VL IV +AL+LDNML  VIVPIIPDY+  + +RD        L + Q+   +        A   +          + N                          + E+++IG++FASK ++QLL NP+ G   +R+GY +P+  G  ++F+ST  FA  ESY  LF ARSLQGLGSA +  + + M+A  + ++ ER +A G AL+ ++ G L+ P FGG +Y++  K VPF +L  ++L DG + +VV KP S +  +   +G  +  L+ DPYI++ A ++T  N+ +A LEP++  W+K TM A   ++G+ +LP    +++G  +   +  K    +W    +G+VIIG     +P   T   LI P  G+ F I +VD++++P++ +LVD+RH SVYGSVYAIAD+++ + +A+GP ++  +V  +GF  +     +  ++Y P ++ LR+     P     E ++L+     K  Y +    ++     +P  
Sbjct:    3 NPRRQRGLVLFIVCVALLLDNMLYMVIVPIIPDYVEAM-HRDT---ERAALAQEQRAHRSQHRHEVTTAVATYSEEGEEGVGGVYNFTSGTATTAAALATTVAATAHVADDDADEDIRIGILFASKAIVQLLVNPLTGTFIDRVGYDLPLLIGLSIIFLSTAVFAFGESYATLFAARSLQGLGSAFADTAAIAMIADRFTEEAERSRALGIALAFISFGSLVAPPFGGTLYEFVGKRVPFLVLACVSLFDGLLLMVVAKPFSSRSRENMPQGTPIYRLMMDPYIVVVAGALTMANIPLAFLEPTIASWMKKTMGANEWQRGMTWLPAFFPHVLGVYITVKLAAKYPQLQWFYGGLGLVIIGSSSCLVPACRTFEELIAPLCGICFGIALVDTALLPLLAFLVDVRHASVYGSVYAIADISYSLAYAMGPIVAGQIVHTMGFVQLSLGMGLTNVLYAPMLLLLRHVCALRPSASFTERRALLPEDSCKEAYDSFAMEEQQQQARQPEG 505          
BLAST of slc18a-4 vs. Ensembl Sea Lamprey
Match: slc18b1 (solute carrier family 18 member B1 [Source:ZFIN;Acc:ZDB-GENE-050417-386])

HSP 1 Score: 63.1586 bits (152), Expect = 6.485e-11
Identity = 62/250 (24.80%), Postives = 105/250 (42.00%), Query Frame = 3
Query:  468 IGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESY-------HLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIG--RWLTTMIGMVIIGICL 1190
            +GL+F S  +  LL++P+ G     IG       G LV    T+ F L +          + F+ R +  LG A S+ +   +LA  +   +     F    +GL  G+++GP  GG +Y+     +PF ++G+  L+   +   +L P  +       S   L+  P I+I +  I      +   +P+  L++         + GLVF    +SY + +   G I  K    R     IG  + GIC 
Sbjct:   63 VGLIFGSFALTNLLSSPLFGKYIVHIGSKFMFLSGMLVTGTCTILFGLLDEAPSGSVYIAMCFVVRCMDALGCAASTTASFTILAGTFPHSIATVMGFLEIFTGL--GLVLGPPVGGFLYELWGFKLPFLVIGTFVLLMIPINFAILPPQGQNSVPSNGSFVRLVMLPPIVIVSLLICSLGSSLGFFDPTFSLFLSEQFDLKPGKIGLVFAGLCISYALSSPFIGYISDKKPHLRRRIMAIGAFVSGICF 310          
BLAST of slc18a-4 vs. Ensembl Sea Lamprey
Match: slc18b1 (solute carrier family 18 member B1 [Source:ZFIN;Acc:ZDB-GENE-050417-386])

HSP 1 Score: 47.7506 bits (112), Expect = 4.510e-6
Identity = 59/252 (23.41%), Postives = 112/252 (44.44%), Query Frame = 3
Query:  468 IGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESY-------HLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGAS--LKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMI--GMVIIGICL 1190
            +GL+F    ++QLL + ++G    +IG       G L     T+ F L +          L F+   +  +G A S  +   +L + +  ++     F   L+GL  G+++GP  GG +Y+     +   I+G   L    + I V+  ++ P+   G+S     LL  P +++ A  I   +  +   +P++ L++      +  + GLVF+   +SY +   V G +     +W+  M+  G  + GIC 
Sbjct:   74 VGLIFGVFSLVQLLFSLLLGKYMVKIGVKFTFLSGLLASGTCTILFGLLDEAPSGKIFIALCFLLHGVDAVGCAASMTASFTILMSMFPHNISTTIGFLELLTGL--GLVMGPPLGGFLYEAWGYRMTLIIVGVFML----LTIPVVLAALPPQVLVGSSGSFVRLLSLPSVIVVALLICCVDSSMGFFDPNISLFLFEQFNLSSGKIGLVFMSLCISYSVSCPVVGYVSDHRPQWMRCMMLAGAFVSGICF 319          
BLAST of slc18a-4 vs. Ensembl Nematostella
Match: EDO38356 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD36])

HSP 1 Score: 55.4546 bits (132), Expect = 5.324e-8
Identity = 72/310 (23.23%), Postives = 136/310 (43.87%), Query Frame = 3
Query:  438 IQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFIS-TMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLI-GPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIK----PEDQ------------KGASLKTLLRDPYILIA---------AASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFL-PCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMM 1283
            + + +    KI  + +    +  L +P+ G +  R  + +    G L   IS  +T     S H+ F    L GLGS    +S +  +A Y+  +  RG A GF  SG+++GVL  GP+   L+  Y  +   F I+  +  +  F+ ++ L P++K    P++Q            K A +   LR P  +IA          A +++ +L    +E  +P        A+ L    +F+  C+L+  + +     I   +  +     G V +G+ ++ +P AT  +H ++ S  +G  IG   ++++
Sbjct:   49 LNYFNDSRQKIAWVGSIAQCLTFLASPLAGLLIGRFNFRVTAVLGSLTCCISLVLTSFTKASLHIFFSYSVLYGLGSCLFYMSCVYAVAEYF--EKRRGLALGFLTSGISVGVLAQGPVLQVLLDAYGWRGT-FRIMAGVVGVALFL-LLTLDPNVKKAEIPDEQTDDVTKPQQSRGKCALVSETLRTPAYIIALVTLTLETLTAFVSYVHLVKYCMESGIP-----EKDASEL---FIFIGACALASSIVSGRVLDIK-SLNPFFVNQFGAVSMGMSMVLLPLATQYTHFVIFSVFLGLGIGCCVTTLI 345          

HSP 2 Score: 51.9878 bits (123), Expect = 7.165e-7
Identity = 88/421 (20.90%), Postives = 176/421 (41.81%), Query Frame = 3
Query:  438 IQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFIS-TMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLI-GPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSI--------------------KPEDQKG--ASLKTLLRDPYILIA---------AASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFL-PCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLV--DIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVG-FRWMIWISAIICLI--YTPFIIFLRNPPKKEESQSLMMNGELKSEYQTTGDPKKISD 1583
            + + +    KI  + +    +    +P+ G +  ++ + +    G L   IS  +T     S H+ F    L GLGS    +S +  +A Y+  +  RG A GF  SG+++GVL  GP+   L+  Y  + + F I+  +  +  F+ ++   P++                    KP+  +G  A +   LR P  +IA          A +++ +L    +E  +P        A+ L    +F+  C+L+  + +     I   +  +     G V +G+ ++ +P AT  +H ++ S  +G  IG   ++++ ++   V  ++R V+     Y I       G A G  L+  +    G +    + +  I L+  + P + +   P ++ + Q    NG L  E +   D + ++ 
Sbjct:  454 LNYFNDSRQKIAWVGSITQCLTFFASPLAGLLIGKLSFRVTAVLGSLTCCISLVLTSFTKASLHIFFSYSVLYGLGSCLFYMSCVYAVAEYF--EKRRGLALGFLTSGISVGVLAQGPVLQVLLDAYGWR-ITFRIMAGVVGLALFL-VLTFDPNVQNATARVPVEISEEQTDDFTKPQQSRGKCALVSETLRTPAYIIALVTLTLETLTAFVSYVHLVKYCMESGIP-----EKDASEL---FIFIGACALASSIVSGRVLDIK-SLNPFFVNQFGAVSMGMSMVLLPLATQYTHFVIFSVFLGLGIGCCVTTLIVLVLETVREELRVVA-----YPIGQFVTSAGNAAGAPLAGFIADLYGSYDPSYYTAGSIMLLAAFVPLLQYCFKPWRQTKHQQKSTNGSLL-EAEKDNDEQAMTK 855          
BLAST of slc18a-4 vs. Ensembl Medaka
Match: slc18a2 (solute carrier family 18 member A2 [Source:NCBI gene;Acc:101158793])

HSP 1 Score: 442.965 bits (1138), Expect = 1.758e-150
Identity = 229/474 (48.31%), Postives = 319/474 (67.30%), Query Frame = 3
Query:  126 FQQITGYFDSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLD-NRDIINQNCTVLIKYQKPDWTDIIGRKHVA------------YDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEE 1508
            F+ I    + +Q + ++L IVF+AL+LDNMLLTV+VPIIP YL+ LD + D+  +N ++  K  +  +  I+     +             D      ++ K   N++   +  +R    L  EN+K+G++FASK  +QL+TNP +GP+TNRIGY +P+F GF ++F+ST+ FA + SY LLF+ARSLQG+GS+CSSV+GMGMLA+ Y DD ERG A G AL GLA+GVL+GP FG +MY +  K+ PF IL  LA+ DG    ++       + QKG  L TL++DPYILIAA +I FGN+ IA +EP+LP+W+  TM   + + G+ FLP S+SYL+GTN+FG +  K+GRWL  +IGMV++G  +IC+     ISH+      M    GMVDSSMMPIMGYLVD+RH+SVYGSVYAIADVAFC+GFA+GPS+   + + +GF W++ I  I+ + + P  IFLRNPP +EE
Sbjct:   10 FRLIQWLREERQSRKLILFIVFVALLLDNMLLTVVVPIIPSYLYNLDESADVALRNDSLSQKGPEGSFHTIVSLYDNSIRLSSSNFTTRPADPVPPTLVVTKLQQNSSDCPQSSSR----LLNENVKVGMLFASKATVQLVTNPFIGPLTNRIGYQLPIFAGFCIMFLSTIMFAFSSSYTLLFLARSLQGVGSSCSSVAGMGMLASVYTDDEERGHAIGIALGGLALGVLVGPPFGSVMYDFVGKTAPFLILAFLAVFDGGTVFLLF----FFQSQKGTPLLTLMKDPYILIAAGAICFGNMAIAMMEPTLPIWMMETMCTRKWQLGIAFLPASISYLIGTNIFGTLAHKMGRWLCALIGMVLVGFSVICV-----ISHV------MSCVAGMVDSSMMPIMGYLVDLRHISVYGSVYAIADVAFCMGFALGPSIGGSIAENIGFPWLMTIIGIVDIFFAPLCIFLRNPPGQEE 464          
BLAST of slc18a-4 vs. Ensembl Medaka
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:101172172])

HSP 1 Score: 430.254 bits (1105), Expect = 1.408e-145
Identity = 220/413 (53.27%), Postives = 298/413 (72.15%), Query Frame = 3
Query:  375 PEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEE-----SQSLMMNGELKSEYQTTGDPKK--ISDNS 1589
            P++I ++  N++C+++        L  EN+ +GL+FASK +IQLL NP VGP+TNR+GY IPMF GF+++F+ST+ FA + +Y LLF ARSLQG+GS+ SSV+G+GMLA+ Y +D ERG A G AL GLAMGVLIG  FG +MY +  K  PF IL  LA+ DG +Q+ +L+PS I P   +G  L TLL+DPYILI+A S+ F N+G+A LEP+LP+W+  TM + + + G+ FLP S+SYL+GTN+FG +  K+GRWL +M+GMVI+GI L+C+PFAT+I  LI P+ G+GFAIGMVDSSMM IMGYLVDIRH SVYG+VYAIADVA C+GFAIGPS    LV+AVGF  ++    +I ++Y P  + LRNP  +EE      Q  +M+   +  Y T  + ++  +SD S
Sbjct:   62 PQLINETA-NSSCLQDSV-----FLEEENVHVGLLFASKALIQLLVNPFVGPLTNRVGYHIPMFAGFIIMFVSTIMFAFSGTYALLFFARSLQGIGSSFSSVAGLGMLASVYTNDEERGIAMGIALGGLAMGVLIGAPFGSVMYDFVGKRAPFLILALLAVFDGALQLCILQPSKICPGSVEGTPLLTLLKDPYILISAGSLCFANMGVAILEPTLPIWMMQTMCSPKWQLGVAFLPASISYLIGTNLFGVLANKMGRWLCSMLGMVIVGISLLCVPFATSIYGLIGPNGGLGFAIGMVDSSMMAIMGYLVDIRHASVYGTVYAIADVALCMGFAIGPSTGGALVQAVGFPCLMVFIGVINILYAPLCLLLRNPAVREEKLAIIDQECVMH---RKSYNTHKESREFPLSDYS 465          
BLAST of slc18a-4 vs. Ensembl Medaka
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:101172172])

HSP 1 Score: 429.483 bits (1103), Expect = 2.335e-144
Identity = 239/514 (46.50%), Postives = 322/514 (62.65%), Query Frame = 3
Query:  207 DNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGR--------------------KHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQH---LSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMT----------------------FALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPS-IKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEE-----SQSLMMNGELKSEYQTTGDPKK--ISDNS 1589
            DNMLLTV+VPIIP +L+ +++     Q  T       P     + R                    + V  +    P      +IN T     ++  +Q    L  EN+ +GL+FASK +IQLL NP VGP+TNR+GY IPMF GF+++F+ST++                      FA + +Y LLF ARSLQG+GS+ SSV+G+GMLA+ Y +D ERG A G AL GLAMGVLIG  FG +MY +  K  PF IL  LA+ DG +Q+ +L+PS I P   +G  L TLL+DPYILI+A S+ F N+G+A LEP+LP+W+  TM + + + G+ FLP S+SYL+GTN+FG +  K+GRWL +M+GMVI+GI L+C+PFAT+I  LI P+ G+GFAIGMVDSSMM IMGYLVDIRH SVYG+VYAIADVA C+GFAIGPS    LV+AVGF  ++    +I ++Y P  + LRNP  +EE      Q  +M+   +  Y T  + ++  +SD S
Sbjct:   25 DNMLLTVVVPIIPTFLYAMEHPSPEPQ--TSERPSPTPPSAQTVPRLSSSTFSPLVSLFDNSTFSLQQVQPEAPRNPNPTPPQLINET-ANASESSCLQDSVFLEEENVHVGLLFASKALIQLLVNPFVGPLTNRVGYHIPMFAGFIIMFVSTISKWVSSPGGWFRTGPCLTVFVSVFAFSGTYALLFFARSLQGIGSSFSSVAGLGMLASVYTNDEERGIAMGIALGGLAMGVLIGAPFGSVMYDFVGKRAPFLILALLAVFDGALQLCILQPSKICPGSVEGTPLLTLLKDPYILISAGSLCFANMGVAILEPTLPIWMMQTMCSPKWQLGVAFLPASISYLIGTNLFGVLANKMGRWLCSMLGMVIVGISLLCVPFATSIYGLIGPNGGLGFAIGMVDSSMMAIMGYLVDIRHASVYGTVYAIADVALCMGFAIGPSTGGALVQAVGFPCLMVFIGVINILYAPLCLLLRNPAVREEKLAIIDQECVMH---RKSYNTHKESREFPLSDYS 532          
BLAST of slc18a-4 vs. Ensembl Medaka
Match: slc18a3b (probable vesicular acetylcholine transporter-B [Source:NCBI gene;Acc:101163117])

HSP 1 Score: 318.931 bits (816), Expect = 1.301e-101
Identity = 171/465 (36.77%), Postives = 269/465 (57.85%), Query Frame = 3
Query:  138 TGYFDSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQK---GASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIG--RWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQS 1517
            T   D  Q + ++L+IV +AL+LDNML  VIVPIIPDYL  L+N  +                      +HV         ++  +   N+  ++  N+     +  +++IG++FASK ++QLL NP+ G   +R+GY IP+  G  V+FIST  FA  E+Y  LF ARSLQGLGSA +  SG+ M+A  Y ++ ER  A G AL+ ++ G L+ P FGG++Y++  K VPF +L S+ L DG + + V+KP      +    G  +  L+ DPYI + A ++T  N+ +A LEP++  W++TTM +T+ E GL +LP    +++G  +   +  K    +W    +GMVIIG     +P   T   LI P  G+ F I +VD++++P + +LVD+RHVSVYGSVYAIAD+++ V +A+GP ++  +V  +GF  +     ++ ++Y P ++ LR   + + S S
Sbjct:   30 TAMRDPHQQRRIILVIVCVALLLDNMLYMVIVPIIPDYLADLENEQL----------------------EHVHV-------VMHPNTSGNSTSQDKSNK-----NNLDLQIGVLFASKAILQLLVNPLSGTFIDRVGYDIPLLIGLTVMFISTCIFAFGENYATLFAARSLQGLGSAFADTSGIAMIADKYTEEAERSTALGIALAFISFGSLVAPPFGGVLYEFAGKRVPFLVLASICLADGVLVLTVIKPFSNRTRENMPVGTPIYKLMVDPYIAVVAGALTVANIPLAFLEPTIANWMETTMHSTQWEMGLTWLPAFFPHVLGVYITVKLAAKNPHLQWFYGALGMVIIGASSCTVPACKTFGQLIAPLCGICFGIALVDTALLPTLAFLVDVRHVSVYGSVYAIADISYSVAYAMGPIVAGQIVHTLGFVQLNLGMGLVNVLYAPALLLLRTVSQMKPSFS 460          
BLAST of slc18a-4 vs. Ensembl Medaka
Match: slc18a3a (solute carrier family 18 member 3a [Source:NCBI gene;Acc:559347])

HSP 1 Score: 313.538 bits (802), Expect = 1.458e-99
Identity = 175/472 (37.08%), Postives = 270/472 (57.20%), Query Frame = 3
Query:  150 DSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTEN--MKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQK---GASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIG--RWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRN----PPKKEESQSLMMNG 1532
            D ++ K ++L+IV +AL+LDNML  VIVPIIPDYL  L       Q+  V               +H                 N+T      N +     T N  ++IG++FASK ++QLL NPI G   +R+GY IP+F G  V+F+ST+TFA AE+Y  LF+ARS+QGLGSA +  SG+ ++A  Y ++ ER KA G AL+ ++ G L+ P +GG++Y++  K VPF IL  + LIDG + + VLKP    E      G  +  L+ DPYI + A ++   N+ +A LEP++  W++ TM+AT  E G+ + P    +++G  +   +  K    +W    +GMV IG     +P       L++P  G+ F I +VD++++P +G+LVD+RHVSVYGSVYAIAD+++CV +A+GP ++  +V  +GF  +     +  ++Y P ++ L+N     P   E   L+ +G
Sbjct:   37 DPERQKRIILVIVCVALLLDNMLYMVIVPIIPDYLEGLQKAADNAQHAIV---------------RHS----------------NST------NSSTPKAPTGNFDLQIGVLFASKAIVQLLVNPISGTFIDRVGYDIPLFIGLNVMFLSTLTFAFAENYATLFLARSIQGLGSAFADTSGIALIADRYTEETERSKALGIALAFISFGSLVAPPYGGVLYEFAGKRVPFLILACICLIDGVLCLTVLKPFSNQERGNMPVGTPIYKLMIDPYIAVVAGALIICNIPLAFLEPTIANWMEDTMQATEWEIGMTWFPAFFPHVLGVYLTVKLAAKHPHLQWFYGAMGMVFIGASSCTVPACKNFGQLMIPLCGVCFGIALVDTALLPTLGFLVDVRHVSVYGSVYAIADISYCVAYALGPVVAGQIVHNLGFVQLNLGMGLANVLYAPALLLLKNVSQMKPSFSERNMLLEDG 471          
BLAST of slc18a-4 vs. Planmine SMEST
Match: SMESG000064025.1 (SMESG000064025.1)

HSP 1 Score: 1083.94 bits (2802), Expect = 0.000e+0
Identity = 533/533 (100.00%), Postives = 533/533 (100.00%), Query Frame = 3
Query:   63 MKYINIDSDGNHKSVSRISYVFQQITGYFDSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELKSEYQTTGDPKKISDNSEPSNDLSIPIDKTVLSQGYGYGDD 1661
            MKYINIDSDGNHKSVSRISYVFQQITGYFDSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELKSEYQTTGDPKKISDNSEPSNDLSIPIDKTVLSQGYGYGDD
Sbjct:    1 MKYINIDSDGNHKSVSRISYVFQQITGYFDSKQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELKSEYQTTGDPKKISDNSEPSNDLSIPIDKTVLSQGYGYGDD 533          
BLAST of slc18a-4 vs. Planmine SMEST
Match: SMESG000009088.1 (SMESG000009088.1)

HSP 1 Score: 617.461 bits (1591), Expect = 0.000e+0
Identity = 317/516 (61.43%), Postives = 401/516 (77.71%), Query Frame = 3
Query:   78 IDSDGNHKSVSRISYVFQQI-TGYFDSK---QHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNT--CVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELKSEYQTTGDPKKISDNSEPSNDL 1607
            ID +G  ++       FQ+I   +FD     + +T+VL+IVF+AL+LDN+LLTVIVPI+P+YLW +++ + I   C    K    DWT +IGRKH       G EI+  +  N++  C+EELK+ ++ ++S+E++ IGLMFASKPV+QL+ NP+VGPITNR+GY++PMF GF+VLFIST+ FA AESY LLF ARS QG+GSACSSVSGMGMLAT+Y DD ERG+AFGFALSGLAMGVLIGP FGG+MY+YT K VPF ILG+L  +DG +Q++VLKPSIKPE Q GASLK+LL DPYI++AAA IT GN+GIA LEPSLP+WIK+TMKA+RLEQGLVFLP SLSYL+GTNVFG IG KIGRWL TMIGM++I I L+ IP A  I  LIVP   +GFAIGMVDSS++PIMGYLVDIRHVSVYG+VYAIADVAFCVGFA GP++S  ++KA+GF+WM+ ++AI+C ++TP I+FLRNPP K    +  +  +   EYQ      KI DNS  +N++
Sbjct:    5 IDENGERQT----DNCFQKIGRKFFDFNFKVKQRTLVLMIVFVALLLDNVLLTVIVPIMPEYLWTINHNEKIKLFCPGE-KVTNKDWTSMIGRKHF------GSEILTSTRENDSISCIEELKSNSLSNISSESIAIGLMFASKPVVQLIVNPLVGPITNRMGYTVPMFTGFVVLFISTIVFAFAESYKLLFFARSFQGIGSACSSVSGMGMLATFYPDDKERGEAFGFALSGLAMGVLIGPSFGGIMYEYTDKQVPFIILGALVFLDGVLQMIVLKPSIKPEPQLGASLKSLLMDPYIVLAAACITIGNMGIAVLEPSLPIWIKSTMKASRLEQGLVFLPFSLSYLLGTNVFGYIGHKIGRWLGTMIGMLLISIFLLIIPLAVDIGSLIVPGTIIGFAIGMVDSSILPIMGYLVDIRHVSVYGTVYAIADVAFCVGFATGPAISGAIIKAIGFQWMLTVAAIVCFLFTPLIVFLRNPPAKVHDSATFIKEQCPVEYQK----NKIIDNSNLANNI 505          
BLAST of slc18a-4 vs. Planmine SMEST
Match: SMESG000051356.1 (SMESG000051356.1)

HSP 1 Score: 288.886 bits (738), Expect = 4.579e-89
Identity = 158/452 (34.96%), Postives = 252/452 (55.75%), Query Frame = 3
Query:  168 TMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKP------SIKPEDQ--KGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKA-TRLEQGLVFLPCSLSYLMGTNVFGPIGVKIG--RWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRN 1490
            TMVLI+V +AL+LDNML  VIVPI+P Y+  + N+   N                                               ++ ++ H    N ++GL+FA K ++QLL NP+ G + +RIGY IPM  G +++F+ST  FA  ++  ++F+AR LQG+GSA +  SG+ M+A  + ++  R  A G AL+ ++ G L+ P FG ++YQY  K  PFF L  +AL+DGF+ ++++KP       +K E    KG  ++ L  DPYI I A ++   N+ +A LEP++  W+ +     +    GL++LP    ++ G  V   +  K    +WL   IG+ + GI  I IPF +   +L++P   + F I +VD++++P +GYLVD RHVSVYGSVYAIAD+++ + +AIGP ++  +V  +GF  +  I  ++ + Y P +  +RN
Sbjct:  114 TMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNKGQSNN----------------------------------------------ESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRN 519          
BLAST of slc18a-4 vs. Planmine SMEST
Match: SMESG000019093.1 (SMESG000019093.1)

HSP 1 Score: 153.295 bits (386), Expect = 5.868e-40
Identity = 102/362 (28.18%), Postives = 178/362 (49.17%), Query Frame = 3
Query:  159 QHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGR--KHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSV----PFFILG-----------SLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLI 1193
             ++T + I +F+A  +D++LLT++VPI P+   Q       N         ++ ++T I  R   ++ Y+         + ++N   +        + L + +  IG++FASK  +QL  +P++G I  + G+      G   L +S + F    ++ +L  AR + G+ S    +SGM  LA  Y DD  R +A    LSG A+GV+ G  +G ++ ++    +    P  ILG           S +L+  +  I ++    +P       L  L+++P I+I   SI    + +A LE +LP W+           GLVF+P S+ YL+GT++FG I ++IGRW+  +I +++ GIC I
Sbjct:    4 DYRTTITISIFVAFFMDSLLLTIVVPIFPELFRQQKESTFKNN--------KEINFTKIYHRFCSNINYNTSSKLFTKFRCLLNEIALN-------RKLISNDQFIGVIFASKAYVQLFISPVIGFIVIKYGHISCFLIGQFFLGVSYILFFSNINFWILLAARMVHGIASCSIGISGMSALAISYSDDFCRSRAMSIVLSGQALGVVFGYPYGAILDEFVGSKILFGIPVLILGGNFILTISLYFSCSLLQQYTNIGIIDRENQP-----IGLWKLIKNPIIMITIFSIFLPEMNLACLEATLPNWLMENFNIEEWRIGLVFVPDSIGYLIGTSLFGTISIRIGRWICVVISLLLNGICFI 345          
BLAST of slc18a-4 vs. Planmine SMEST
Match: SMESG000019093.1 (SMESG000019093.1)

HSP 1 Score: 144.05 bits (362), Expect = 8.547e-37
Identity = 98/347 (28.24%), Postives = 169/347 (48.70%), Query Frame = 3
Query:  204 LDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGR--KHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSV----PFFILG-----------SLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTNVFGPIGVKIGRWLTTMIGMVIIGICLI 1193
            +D++LLT++VPI P+   Q       N         ++ ++T I  R   ++ Y+         + ++N   +        + L + +  IG++FASK  +QL  +P++G I  + G+      G   L +S + F    ++ +L  AR + G+ S    +SGM  LA  Y DD  R +A    LSG A+GV+ G  +G ++ ++    +    P  ILG           S +L+  +  I ++    +P       L  L+++P I+I   SI    + +A LE +LP W+           GLVF+P S+ YL+GT++FG I ++IGRW+  +I +++ GIC I
Sbjct:    1 MDSLLLTIVVPIFPELFRQQKESTFKNN--------KEINFTKIYHRFCSNINYNTSSKLFTKFRCLLNEIALN-------RKLISNDQFIGVIFASKAYVQLFISPVIGFIVIKYGHISCFLIGQFFLGVSYILFFSNINFWILLAARMVHGIASCSIGISGMSALAISYSDDFCRSRAMSIVLSGQALGVVFGYPYGAILDEFVGSKILFGIPVLILGGNFILTISLYFSCSLLQQYTNIGIIDRENQP-----IGLWKLIKNPIIMITIFSIFLPEMNLACLEATLPNWLMENFNIEEWRIGLVFVPDSIGYLIGTSLFGTISIRIGRWICVVISLLLNGICFI 327          
The following BLAST results are available for this feature:
BLAST of slc18a-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC18A24.805e-16149.51solute carrier family 18 member A2 [Source:HGNC Sy... [more]
SLC18A19.811e-14048.07solute carrier family 18 member A1 [Source:HGNC Sy... [more]
SLC18A19.811e-14048.07solute carrier family 18 member A1 [Source:HGNC Sy... [more]
SLC18A16.552e-12245.21solute carrier family 18 member A1 [Source:HGNC Sy... [more]
SLC18A16.552e-12245.21solute carrier family 18 member A1 [Source:HGNC Sy... [more]
back to top
BLAST of slc18a-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cat-13.246e-14845.74pep chromosome:WBcel235:X:5705719:5710625:-1 gene:... [more]
cat-18.428e-13846.11pep chromosome:WBcel235:X:5705719:5710585:-1 gene:... [more]
unc-179.649e-8333.46Vesicular acetylcholine transporter unc-17 [Sourc... [more]
vpat-16.307e-1124.92Vesicular PolyAmine Transporter [Source:UniProtKB... [more]
vpat-13.449e-1024.46Vesicular PolyAmine Transporter [Source:UniProtKB... [more]
back to top
BLAST of slc18a-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vmat4.396e-17855.84gene:FBgn0260964 transcript:FBtr0310062[more]
Vmat4.396e-17855.84gene:FBgn0260964 transcript:FBtr0091491[more]
Vmat4.396e-17855.84gene:FBgn0260964 transcript:FBtr0091493[more]
Vmat1.429e-17655.63gene:FBgn0260964 transcript:FBtr0091492[more]
VAChT1.195e-8635.40gene:FBgn0270928 transcript:FBtr0083671[more]
back to top
BLAST of slc18a-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc18a21.166e-17550.49solute carrier family 18 member 2 [Source:ZFIN;Acc... [more]
slc18a21.972e-16851.17solute carrier family 18 member 2 [Source:ZFIN;Acc... [more]
SLC18A13.044e-15647.17solute carrier family 18 member A1 [Source:NCBI ge... [more]
SLC18A16.711e-14947.13solute carrier family 18 member A1 [Source:NCBI ge... [more]
SLC18A15.874e-14845.74solute carrier family 18 member A1 [Source:NCBI ge... [more]
back to top
BLAST of slc18a-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gtf2e1.21.029e-13144.26general transcription factor IIE, polypeptide 1, a... [more]
ddx422.801e-12442.20DEAD-box helicase 42 [Source:Xenbase;Acc:XB-GENE-9... [more]
ddx426.837e-12240.24DEAD-box helicase 42 [Source:Xenbase;Acc:XB-GENE-9... [more]
ddx421.292e-12144.29DEAD-box helicase 42 [Source:Xenbase;Acc:XB-GENE-9... [more]
ddx421.420e-12139.76DEAD-box helicase 42 [Source:Xenbase;Acc:XB-GENE-9... [more]
back to top
BLAST of slc18a-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc18a21.927e-16350.00solute carrier family 18 (vesicular monoamine), me... [more]
Slc18a11.219e-14249.51solute carrier family 18 (vesicular monoamine), me... [more]
Slc18a31.929e-9335.55solute carrier family 18 (vesicular monoamine), me... [more]
Slc18b14.341e-1023.16solute carrier family 18, subfamily B, member 1 [S... [more]
Slc18b11.434e-923.45solute carrier family 18, subfamily B, member 1 [S... [more]
back to top
BLAST of slc18a-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q27963|VMAT2_BOVIN2.452e-16349.90Synaptic vesicular amine transporter OS=Bos taurus... [more]
sp|Q01827|VMAT2_RAT5.833e-16351.27Synaptic vesicular amine transporter OS=Rattus nor... [more]
sp|Q8BRU6|VMAT2_MOUSE1.348e-16250.00Synaptic vesicular amine transporter OS=Mus muscul... [more]
sp|Q05940|VMAT2_HUMAN2.307e-16049.51Synaptic vesicular amine transporter OS=Homo sapie... [more]
sp|Q01818|VMAT1_RAT2.709e-14249.02Chromaffin granule amine transporter OS=Rattus nor... [more]
back to top
BLAST of slc18a-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJ830.000e+0100.00Slc18a-4 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
S5W2Q80.000e+099.81Vmat OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
V5SMF70.000e+061.43Vesicular monoamine transporter OS=Schmidtea medit... [more]
A0A0H3YFC20.000e+060.74Slc18a-7 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A267E7U60.000e+051.43MFS domain-containing protein OS=Macrostomum ligna... [more]
back to top
BLAST of slc18a-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc18a27.514e-17650.20synaptic vesicular amine transporter [Source:NCBI ... [more]
SLC18A11.968e-15349.69solute carrier family 18 member A1 [Source:NCBI ge... [more]
SLC18A18.594e-14748.77solute carrier family 18 member A1 [Source:NCBI ge... [more]
slc18a3a1.062e-9032.02solute carrier family 18 member A3 [Source:NCBI ge... [more]
slc18a3b4.251e-9034.54solute carrier family 18 member 3b [Source:NCBI ge... [more]
back to top
BLAST of slc18a-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc18a25.248e-17348.94solute carrier family 18 member 2 [Source:ZFIN;Acc... [more]
slc18a3a3.222e-9432.35solute carrier family 18 member 3a [Source:NCBI ge... [more]
slc18b16.485e-1124.80solute carrier family 18 member B1 [Source:ZFIN;Ac... [more]
slc18b14.510e-623.41solute carrier family 18 member B1 [Source:ZFIN;Ac... [more]
back to top
BLAST of slc18a-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc18a-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO383565.324e-823.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc18a-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc18a21.758e-15048.31solute carrier family 18 member A2 [Source:NCBI ge... [more]
SLC18A11.408e-14553.27solute carrier family 18 member A1 [Source:NCBI ge... [more]
SLC18A12.335e-14446.50solute carrier family 18 member A1 [Source:NCBI ge... [more]
slc18a3b1.301e-10136.77probable vesicular acetylcholine transporter-B [So... [more]
slc18a3a1.458e-9937.08solute carrier family 18 member 3a [Source:NCBI ge... [more]
back to top
BLAST of slc18a-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064025.10.000e+0100.00SMESG000064025.1[more]
SMESG000009088.10.000e+061.43SMESG000009088.1[more]
SMESG000051356.14.579e-8934.96SMESG000051356.1[more]
SMESG000019093.15.868e-4028.18SMESG000019093.1[more]
SMESG000019093.18.547e-3728.24SMESG000019093.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30019663
GenBankAKN21539.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019663 ID=SMED30019663|Name=slc18a-4|organism=Schmidtea mediterranea sexual|type=transcript|length=1812bp
TGTCGACGTATTTTTGGTTTGAAAATTTTATCTAAATTACTTTTTGAACC
GTTGAAGAAAATATGAAATATATCAATATAGATTCGGATGGGAATCACAA
ATCTGTCAGTCGAATATCTTACGTTTTTCAACAGATCACTGGATATTTTG
ATAGCAAACAGCACAAAACAATGGTTTTAATTATTGTTTTTATTGCACTC
GTATTAGACAATATGCTATTGACTGTCATCGTTCCTATTATCCCGGATTA
TTTGTGGCAGTTGGACAACAGAGATATTATTAACCAAAACTGTACAGTTT
TGATAAAATATCAGAAACCTGATTGGACTGACATAATTGGAAGAAAGCAT
GTAGCATATGATGAATTTGAAGGTCCGGAAATTATTGAAAAATCAGTTAT
AAATAATACTTGCGTCGAGGAATTGAAAAACCGAACCATTCAGCATCTAT
CAACAGAAAATATGAAAATCGGACTCATGTTCGCCTCGAAACCCGTCATC
CAACTGCTAACGAACCCCATAGTCGGTCCTATCACTAATAGGATTGGTTA
CAGTATTCCTATGTTCTTTGGATTTTTGGTGCTCTTCATTTCAACAATGA
CTTTTGCATTGGCTGAGTCTTATCATTTATTATTTATTGCTAGAAGTCTT
CAAGGTCTTGGGTCAGCCTGTTCAAGCGTATCAGGTATGGGAATGCTTGC
AACTTATTATGTTGATGACGTGGAACGAGGTAAAGCATTTGGGTTTGCTC
TTAGTGGACTGGCAATGGGCGTTCTTATAGGTCCATTATTCGGAGGTTTA
ATGTACCAATATACATCAAAATCAGTTCCATTCTTTATTCTTGGCAGTCT
GGCACTGATTGATGGATTTATGCAGATTGTTGTTCTTAAACCTTCGATAA
AACCAGAAGACCAGAAAGGTGCATCACTCAAGACTCTTCTTAGGGATCCG
TATATACTTATTGCTGCTGCATCAATAACATTTGGAAACCTTGGAATAGC
TACACTTGAGCCATCTTTACCTTTGTGGATCAAGACCACAATGAAAGCAA
CTCGTCTTGAACAGGGCTTAGTGTTTTTACCATGTAGTTTATCCTATCTT
ATGGGAACAAATGTTTTTGGTCCTATCGGAGTGAAAATCGGTCGTTGGTT
AACTACCATGATAGGAATGGTAATTATCGGCATTTGTTTGATTTGTATAC
CCTTTGCGACTACTATTAGTCATTTAATCGTTCCGTCATTTGGTATGGGA
TTTGCTATTGGCATGGTAGACTCGTCTATGATGCCAATAATGGGATATCT
TGTAGATATTCGACACGTATCAGTATATGGTAGCGTTTATGCAATAGCCG
ATGTGGCATTCTGCGTCGGGTTTGCAATAGGACCTTCATTAAGCAGTGGG
CTTGTAAAAGCTGTCGGTTTTCGATGGATGATATGGATATCGGCTATAAT
TTGCCTAATTTATACTCCATTCATTATATTTTTACGGAATCCTCCGAAAA
AAGAAGAATCTCAGAGTCTTATGATGAACGGGGAATTGAAAAGTGAGTAT
CAAACAACCGGTGATCCAAAGAAAATAAGTGATAATTCTGAGCCCTCAAA
CGATTTAAGCATTCCGATTGATAAAACGGTTCTTTCACAAGGCTATGGCT
ATGGAGATGACTGAATTAAGAAGCAGATGTCTAATTTTAGGAATGATTAT
AATAATTCTGAATAATGATAATAATATCATCTCATTTGTGTTGTGATTAA
CTAGAAACTAAAACTTCTTAAACTTGTTTTTACTGATTTGAGTCTATCTT
TGCGTATGATGC
back to top

protein sequence of SMED30019663-orf-1

>SMED30019663-orf-1 ID=SMED30019663-orf-1|Name=SMED30019663-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=534bp
MKYINIDSDGNHKSVSRISYVFQQITGYFDSKQHKTMVLIIVFIALVLDN
MLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYD
EFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLT
NPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLG
SACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQY
TSKSVPFFILGSLALIDGFMQIVVLKPSIKPEDQKGASLKTLLRDPYILI
AAASITFGNLGIATLEPSLPLWIKTTMKATRLEQGLVFLPCSLSYLMGTN
VFGPIGVKIGRWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIG
MVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKA
VGFRWMIWISAIICLIYTPFIIFLRNPPKKEESQSLMMNGELKSEYQTTG
DPKKISDNSEPSNDLSIPIDKTVLSQGYGYGDD*
back to top
Aliases
The feature 'slc18a-4' has the following synonyms
Synonym
slc18a-4
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0042910xenobiotic transporter activity
Vocabulary: biological process
TermDefinition
GO:0042908xenobiotic transport
GO:0055085transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000105secretory cell
PLANA:0000143ventral region of the whole animal
PLANA:0000418head
PLANA:0000419prepharyngeal region
PLANA:0000420parapharyngeal region
PLANA:0000481serotonergic neuron
PLANA:0000482dopaminergic neuron
PLANA:0000483octopaminergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 297..521
e-value: 2.4E-25
score: 91.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 495..533
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 495..520
NoneNo IPR availablePANTHERPTHR23506:SF30SYNAPTIC VESICULAR AMINE TRANSPORTERcoord: 28..498
NoneNo IPR availablePANTHERPTHR23506FAMILY NOT NAMEDcoord: 28..498
NoneNo IPR availableCDDcd17384MFS_SLC18A1_2_VAT1_2coord: 38..475
e-value: 0.0
score: 568.742
NoneNo IPR availableTMHMMTMhelixcoord: 226..248
NoneNo IPR availableTMHMMTMhelixcoord: 335..357
NoneNo IPR availableTMHMMTMhelixcoord: 418..440
NoneNo IPR availableTMHMMTMhelixcoord: 198..217
NoneNo IPR availableTMHMMTMhelixcoord: 362..384
NoneNo IPR availableTMHMMTMhelixcoord: 258..275
NoneNo IPR availableTMHMMTMhelixcoord: 389..411
NoneNo IPR availableTMHMMTMhelixcoord: 296..315
NoneNo IPR availableTMHMMTMhelixcoord: 455..474
NoneNo IPR availableTMHMMTMhelixcoord: 38..60
NoneNo IPR availableTMHMMTMhelixcoord: 161..183
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 44..414
e-value: 4.9E-36
score: 124.4
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 38..479
score: 20.778
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 33..481