Disintegrin and metalloproteinase domain-containing protein 15

Overview
NameDisintegrin and metalloproteinase domain-containing protein 15
Smed IDSMED30019659
Length (bp)2099
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Disintegrin and metalloproteinase domain-containing protein 15 (SMED30019659) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Disintegrin and metalloproteinase domain-containing protein 15 (SMED30019659) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019659

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30019659SMESG000079144.1 dd_Smed_v4_10958_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019659SMESG000079144.1 dd_Smed_v4_10958_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30019659SMESG000079144.1 dd_Smed_v4_10958_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Human
Match: ADAM9 (ADAM metallopeptidase domain 9 [Source:HGNC Symbol;Acc:HGNC:216])

HSP 1 Score: 201.06 bits (510), Expect = 1.252e-54
Identity = 153/528 (28.98%), Postives = 236/528 (44.70%), Query Frame = 1
Query:  205 QLQIFTLYLIVDSNLYQQSQESTENRIQSIFILIN---KIYLPLGIQFQIICIEIWKE-NLIEI-SQEEYILEELKIYKTKSV--NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTV-DSITQNIKYTAYTVSHELAHNFGLTHDTS---DCGCENCIMATGVEFSSRKLDWSSCSISQIKSL-LKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCE--KCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSC----HCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPYTRNL 1734
            Q +   L+++VD   Y     +     + + +L N    +Y+ L I+  ++ +EIW   NLI I      +L     ++ K +     HD   L L   +  T  G A   T+CS+S   G  V   IT  ++  A  V+HEL HN G+ HD      CG ++CIM +G   +S   ++SSCS    + L L  G  C  ++ + P   +   S    +                  V+ GE+CDCG   +CE   CC   TCK  + ++CA G CC    C+  P GT+CR  T+ CD+ EYCNG  + C  D+F Q+G  C    NNKA+C+ G C+ +  QC+ ++G  +  +   C+ E   +   F NCG             F     K C   N++CG+L C  + +++   G+  +   T      C    F++  +  D GMV +G  CG   +C N  CV    + +  C     C  +G+C + K C C   + PPNC  +    S  S   Y   +
Sbjct:  210 QTRYVELFIVVDKERYDMMGRNQTAVREEMILLANYLDSMYIMLNIRIVLVGLEIWTNGNLINIVGGAGDVLGNFVQWREKFLITRRRHDSAQLVLKKGFGGT-AGMAFVGTVCSRSHAGGINVFGQIT--VETFASIVAHELGHNLGMNHDDGRDCSCGAKSCIMNSG---ASGSRNFSSCSAEDFEKLTLNKGGNCLLNIPK-PDEAYSAPSCGNKL------------------VDAGEECDCGTPKECELDPCCEGSTCKLKSFAECAYGDCCKD--CRFLPGGTLCRGKTSECDVPEYCNGSSQFCQPDVFIQNGYPCQ---NNKAYCYNGMCQYYDAQCQVIFGSKAKAAPKDCFIEVNSKGDRFGNCG-------------FSGNEYKKCATGNALCGKLQC-ENVQEIPVFGIVPAIIQTPSRGTKCWGVDFQLGSDVPDPGMVNEGTKCGAGKICRNFQCVDAS-VLNYDCDVQKKCHGHGVCNSNKNCHCENGWAPPNCETKGYGGSVDSGPTYNGQM 692          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Human
Match: ADAM9 (ADAM metallopeptidase domain 9 [Source:HGNC Symbol;Acc:HGNC:216])

HSP 1 Score: 202.601 bits (514), Expect = 1.285e-54
Identity = 154/530 (29.06%), Postives = 242/530 (45.66%), Query Frame = 1
Query:  205 QLQIFTLYLIVDSNLYQQSQESTENRIQSIFILIN---KIYLPLGIQFQIICIEIWKE-NLIEI-SQEEYILEELKIYKTKSV--NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTV-DSITQNIKYTAYTVSHELAHNFGLTHDTS---DCGCENCIMATGVEFSSRKLDWSSCSISQIKSL-LKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCE--KCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSC----HCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPYTRNLDT 1740
            Q +   L+++VD   Y     +     + + +L N    +Y+ L I+  ++ +EIW   NLI I      +L     ++ K +     HD   L L   +  T  G A   T+CS+S   G  V   IT  ++  A  V+HEL HN G+ HD      CG ++CIM +G   +S   ++SSCS    + L L  G  C  ++ + P   +       P   +K             +V+ GE+CDCG   +CE   CC   TCK  + ++CA G CC    C+  P GT+CR  T+ CD+ EYCNG  + C  D+F Q+G  C    NNKA+C+ G C+ +  QC+ ++G  +  +   C+ E   +   F NCG             F     K C   N++CG+L C  + +++   G+  +   T      C    F++  +  D GMV +G  CG   +C N  CV    + +  C     C  +G+C + K C C   + PPNC E +    ++ + P    ++T
Sbjct:  210 QTRYVELFIVVDKERYDMMGRNQTAVREEMILLANYLDSMYIMLNIRIVLVGLEIWTNGNLINIVGGAGDVLGNFVQWREKFLITRRRHDSAQLVLKKGFGGT-AGMAFVGTVCSRSHAGGINVFGQIT--VETFASIVAHELGHNLGMNHDDGRDCSCGAKSCIMNSG---ASGSRNFSSCSAEDFEKLTLNKGGNCLLNIPK-PDEAY-----SAPSCGNK-------------LVDAGEECDCGTPKECELDPCCEGSTCKLKSFAECAYGDCCKD--CRFLPGGTLCRGKTSECDVPEYCNGSSQFCQPDVFIQNGYPCQ---NNKAYCYNGMCQYYDAQCQVIFGSKAKAAPKDCFIEVNSKGDRFGNCG-------------FSGNEYKKCATGNALCGKLQC-ENVQEIPVFGIVPAIIQTPSRGTKCWGVDFQLGSDVPDPGMVNEGTKCGAGKICRNFQCVDAS-VLNYDCDVQKKCHGHGVCNSNKNCHCENGWAPPNC-ETKGYGGSVDSGPTYNEMNT 693          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Human
Match: ADAM28 (ADAM metallopeptidase domain 28 [Source:HGNC Symbol;Acc:HGNC:206])

HSP 1 Score: 199.904 bits (507), Expect = 6.156e-54
Identity = 144/503 (28.63%), Postives = 228/503 (45.33%), Query Frame = 1
Query:  226 YLIVDSN---LYQQSQESTENRIQSIFILINKIYLPLGIQFQIICIEIW--KENLIEISQEEYILEELKIYKTK--SVNINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCEN--CIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCEK-CCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDK---SCHCFNNGICTNQKKCQCFQQYLPPNCSERQTI 1695
            YL++D+     Y ++Q+    R+  +   +N +Y  L     ++ +EIW  K+ +       + LE    ++    S    HD   L   +    T  G A  +TMCS  S VG   D  + N+   A T++HE+ HNFG+ HD   C C +  C+M   + F     D+SSCS        +         A  PT I        P+  ++             +VE GE CDCG   +C   CC+  TCK  A  QCA G CC  E C+    G +CR +   CDL E CNG+  NCP D F+ +G  C    + K HC  G C     QC  LWG  + ++  SCY+ N E    +  C        +   D+ +     PC+ ++++CG+L+C          G S +  +  +   F     F+ +  +++IGMV +G  CG+  VC N +CV ++  +     S  C  + +C ++ +CQC + ++PP+C +   +
Sbjct:  209 YLVLDNGEFKRYNENQDEIRKRVFEMANYVNMLYKKLNTHVALVGMEIWTDKDKIKITPNASFTLENFSKWRGSVLSRRKRHDIAQLITATELAGTTVGLAFMSTMCSPYS-VGVVQDH-SDNLLRVAGTMAHEMGHNFGMFHDDYSCKCPSTICVMDKALSFYI-PTDFSSCSRLSYDKFFEDKLSNCLFNAPLPTDII-----STPICGNQ-------------LVEMGEDCDCGTSEECTNICCDAKTCKIKATFQCALGECC--EKCQFKKAGMVCRPAKDECDLPEMCNGKSGNCPDDRFQVNGFPC---HHGKGHCLMGTCPTLQEQCTELWGPGTEVADKSCYNRN-EGGSKYGYC--------RRVDDTLI-----PCKANDTMCGKLFC---------QGGSDNLPWKGRIVTFLTCKTFDPEDTSQEIGMVANGTKCGDNKVCINAECVDIEKAYKSTNCSSKCKGHAVCDHELQCQCEEGWIPPDCDDSSVV 662          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Human
Match: ADAM20 (ADAM metallopeptidase domain 20 [Source:HGNC Symbol;Acc:HGNC:199])

HSP 1 Score: 191.43 bits (485), Expect = 3.453e-51
Identity = 158/537 (29.42%), Postives = 241/537 (44.88%), Query Frame = 1
Query:  223 LYLIVDSNLYQQSQESTENRIQSIFILINKI---YLPLGIQFQIICIEIW-KENLIEISQE-EYILEELKIYKTKSVN--INHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCE--NCIMATGVEFSSRKLDWSSCSISQ-----IKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCEK--CCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQF------CEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSCH---CFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPYTRNLDTENPIDK 1758
            L ++VD+  Y  SQ +       +F ++N +   Y PL +   +  I+IW   N +  S + + +LE+  I+K  ++N  + HD  HLF+       + G A    +C      G  V    + + + A T+ HEL HN G+ HDT  C CE   CIM    + +++   +S+CS +Q     I S L +  P       +P  IF                   +  CGN +VE GE+CDCG    C K  CC  L C     + CA G CC    CK  P+GT+CR     CDL E+CNG    CP D++ QDG  C    N  A C+   C +H  QC+ ++GQ +  +  SCY E   + + F +CG++ T    TY           C   + +CGR+ C         +G+  +    +   QF      C  + + +     DIG V DG VCG + +C    C  +  +  ++C    C   GIC N++ C C  ++ PP C ++    S  S  P   N++  N + K
Sbjct:  211 LVVVVDNIRYLFSQSNATTVQHEVFNVVNIVDSFYHPLEVDVILTGIDIWTASNPLPTSGDLDNVLEDFSIWKNYNLNNRLQHDVAHLFIKDTQGM-KLGVAYVKGICQNPFNTGVDVFEDNRLVVF-AITLGHELGHNLGMQHDTQWCVCELQWCIMHAYRKVTTK---FSNCSYAQYWDSTISSGLCIQPP------PYPGNIF------------------RLKYCGNLVVEEGEECDCGTIRQCAKDPCC-LLNCTLHPGAACAFGICCKD--CKFLPSGTLCRQQVGECDLPEWCNGTSHQCPDDVYVQDGISC----NVNAFCYEKTCNNHDIQCKEIFGQDARSASQSCYQEINTQGNRFGHCGIVGT----TYVK---------CWTPDIMCGRVQC-------ENVGVIPNLIEHSTVQQFHLNDTTCWGTDYHLGMAIPDIGEVKDGTVCGPEKICIRKKCASMVHL-SQACQPKTCNMRGICNNKQHCHCNHEWAPPYCKDKGYGGSADSGPPPKNNMEGLNVMGK 690          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Human
Match: ADAM20 (ADAM metallopeptidase domain 20 [Source:HGNC Symbol;Acc:HGNC:199])

HSP 1 Score: 191.43 bits (485), Expect = 6.139e-51
Identity = 158/537 (29.42%), Postives = 241/537 (44.88%), Query Frame = 1
Query:  223 LYLIVDSNLYQQSQESTENRIQSIFILINKI---YLPLGIQFQIICIEIW-KENLIEISQE-EYILEELKIYKTKSVN--INHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCE--NCIMATGVEFSSRKLDWSSCSISQ-----IKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCEK--CCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQF------CEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSCH---CFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPYTRNLDTENPIDK 1758
            L ++VD+  Y  SQ +       +F ++N +   Y PL +   +  I+IW   N +  S + + +LE+  I+K  ++N  + HD  HLF+       + G A    +C      G  V    + + + A T+ HEL HN G+ HDT  C CE   CIM    + +++   +S+CS +Q     I S L +  P       +P  IF                   +  CGN +VE GE+CDCG    C K  CC  L C     + CA G CC    CK  P+GT+CR     CDL E+CNG    CP D++ QDG  C    N  A C+   C +H  QC+ ++GQ +  +  SCY E   + + F +CG++ T    TY           C   + +CGR+ C         +G+  +    +   QF      C  + + +     DIG V DG VCG + +C    C  +  +  ++C    C   GIC N++ C C  ++ PP C ++    S  S  P   N++  N + K
Sbjct:  261 LVVVVDNIRYLFSQSNATTVQHEVFNVVNIVDSFYHPLEVDVILTGIDIWTASNPLPTSGDLDNVLEDFSIWKNYNLNNRLQHDVAHLFIKDTQGM-KLGVAYVKGICQNPFNTGVDVFEDNRLVVF-AITLGHELGHNLGMQHDTQWCVCELQWCIMHAYRKVTTK---FSNCSYAQYWDSTISSGLCIQPP------PYPGNIF------------------RLKYCGNLVVEEGEECDCGTIRQCAKDPCC-LLNCTLHPGAACAFGICCKD--CKFLPSGTLCRQQVGECDLPEWCNGTSHQCPDDVYVQDGISC----NVNAFCYEKTCNNHDIQCKEIFGQDARSASQSCYQEINTQGNRFGHCGIVGT----TYVK---------CWTPDIMCGRVQC-------ENVGVIPNLIEHSTVQQFHLNDTTCWGTDYHLGMAIPDIGEVKDGTVCGPEKICIRKKCASMVHL-SQACQPKTCNMRGICNNKQHCHCNHEWAPPYCKDKGYGGSADSGPPPKNNMEGLNVMGK 740          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Celegans
Match: adm-2 (ADAM (Disintegrin plus metalloprotease) family [Source:UniProtKB/TrEMBL;Acc:G5EDW5])

HSP 1 Score: 191.045 bits (484), Expect = 8.374e-51
Identity = 153/531 (28.81%), Postives = 220/531 (41.43%), Query Frame = 1
Query:  187 IDRNKNQLQ--------IFTLYLIVDSNLYQQ---SQESTENRIQSIFILINKIYLPLGIQFQIICIEIWK--ENLIEISQEEYILEELKIYKTKSVNINHDCLHLFLGSNYFFTR-------QGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSD-----CGCENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCEKCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKT---------NQFCEASRFEV-DWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSCHCFNN----GICTNQKKCQCFQQY 1662
            IDRN + ++           L L+ D ++Y +    ++   + +Q    ++N +Y PL I+  ++  EIWK  + +  I   +  L     YK K +  +H     F  + Y  T         G+A   TMCS     G  VD     ++ T  T +HEL H FG+ HD +D     C    CIM      S     WS CS+  + S    G             +F +  ++    K                VE GE+CDCG       CCN  TCK    ++CASG CC+ + CK  P  T+CR +   CDL EYCNG+  +CP D F Q+   C  K N    C+ G C     QC  LWG T      +CY +NTE      NCG      +            K C+  N+ CG L C    E+ +  G   S +F+  T          +FC   +      N  D G+VPDGA+CG + +C    C   + I   +  C +N    G+C N   C C + +
Sbjct:  161 IDRNPSYIREHLDGRKRFVELALVADYSVYTKYDSDEKKVNDYMQQTMNILNSLYFPLNIRITLVHSEIWKKGDQISVIPDSKETLNNFMEYK-KIMLKDH-----FFDTGYLMTTLKFDEGVVGKAYKGTMCSYDYSGGIYVDHNNDTVE-TVATFAHELGHTFGMDHDPNDKDVCYCPMPRCIMNPQ---SGHMEVWSECSVKNLASGFNRGID---------LCLFNEPGKKPSDAKCGNGI-----------VEPGEECDCGPLKCDNHCCNGSTCKLIGEAECASGDCCDLKTCKPKPRATVCRAAIGICDLDEYCNGETNDCPADFFVQNAALCPGKENE--FCYEGGCGSRNDQCAKLWGPTGKNGDENCYRKNTEGTF-HGNCGTNAHTKE-----------IKKCETENAKCGLLQCETQAERPV-FGDPGSVTFSHSTVYSSLKRDDKKFCYVFKSAYGGLNAPDPGLVPDGAICGEEQMCIGQKCHKKEKISKVTAQCLDNCNFRGVCNNVGNCHCERGF 646          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Celegans
Match: adm-2 (ADAM (Disintegrin plus metalloprotease) family [Source:UniProtKB/TrEMBL;Acc:G5EDW5])

HSP 1 Score: 191.045 bits (484), Expect = 8.507e-51
Identity = 153/531 (28.81%), Postives = 220/531 (41.43%), Query Frame = 1
Query:  187 IDRNKNQLQ--------IFTLYLIVDSNLYQQ---SQESTENRIQSIFILINKIYLPLGIQFQIICIEIWK--ENLIEISQEEYILEELKIYKTKSVNINHDCLHLFLGSNYFFTR-------QGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSD-----CGCENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCEKCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKT---------NQFCEASRFEV-DWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSCHCFNN----GICTNQKKCQCFQQY 1662
            IDRN + ++           L L+ D ++Y +    ++   + +Q    ++N +Y PL I+  ++  EIWK  + +  I   +  L     YK K +  +H     F  + Y  T         G+A   TMCS     G  VD     ++ T  T +HEL H FG+ HD +D     C    CIM      S     WS CS+  + S    G             +F +  ++    K                VE GE+CDCG       CCN  TCK    ++CASG CC+ + CK  P  T+CR +   CDL EYCNG+  +CP D F Q+   C  K N    C+ G C     QC  LWG T      +CY +NTE      NCG      +            K C+  N+ CG L C    E+ +  G   S +F+  T          +FC   +      N  D G+VPDGA+CG + +C    C   + I   +  C +N    G+C N   C C + +
Sbjct:  161 IDRNPSYIREHLDGRKRFVELALVADYSVYTKYDSDEKKVNDYMQQTMNILNSLYFPLNIRITLVHSEIWKKGDQISVIPDSKETLNNFMEYK-KIMLKDH-----FFDTGYLMTTLKFDEGVVGKAYKGTMCSYDYSGGIYVDHNNDTVE-TVATFAHELGHTFGMDHDPNDKDVCYCPMPRCIMNPQ---SGHMEVWSECSVKNLASGFNRGID---------LCLFNEPGKKPSDAKCGNGI-----------VEPGEECDCGPLKCDNHCCNGSTCKLIGEAECASGDCCDLKTCKPKPRATVCRAAIGICDLDEYCNGETNDCPADFFVQNAALCPGKENE--FCYEGGCGSRNDQCAKLWGPTGKNGDENCYRKNTEGTF-HGNCGTNAHTKE-----------IKKCETENAKCGLLQCETQAERPV-FGDPGSVTFSHSTVYSSLKRDDKKFCYVFKSAYGGLNAPDPGLVPDGAICGEEQMCIGQKCHKKEKISKVTAQCLDNCNFRGVCNNVGNCHCERGF 646          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Celegans
Match: unc-71 (Disintegrin and metalloproteinase domain-containing protein unc-71 [Source:UniProtKB/Swiss-Prot;Acc:G5EFD5])

HSP 1 Score: 138.658 bits (348), Expect = 1.536e-33
Identity = 128/493 (25.96%), Postives = 218/493 (44.22%), Query Frame = 1
Query:  283 IQSIFILINKIYLPLGIQFQIICIEIWKE-NLIEISQE-EYILEELKIYKTKSV-NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQ-NIKYTAYTVSHELAHNFGLTHDTSDCGCE---NCIM------ATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCE-KCCNFLTCKFSANSQCASG-SCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSK-SYSFTTKTNQF-CEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSC--------HCFNNGICTNQKKCQCFQQYLPPNCSER 1686
            ++S+ I  + +   L I+   + +E+W +   I++ ++ E  L  +  Y +  + +I  D   LF   ++       A   ++C+  S V   V  + Q    +    ++  + H  GL HDT+ C CE    C+M        G   S     +S CS++++  + + G               ++    +P   S+      +  CGNG+V+  E+CDCG R +C+  CC+ LTC    ++QCA+   CC+   C+L   G  CR+S + CD+ E C+G+  +CP D    DGT C T       C+ G C D   QC+ LWG+ + ++   C+++NT +   + NCG      D TY          PCQ  ++ CG L C   +   +   L   ++ FT  ++Q  C++        +  +G+  DG  C +  VC  G CV +  +   +          C  +G CT   +C CF  +    C  R
Sbjct:  255 LESLNIADSMLSRDLNIRLSAVYVELWTDVQRIDLWEDIERTLSGVVDYASGHIYHIQKDASILFTAGSFANQEVSNAAIRSICTARSAV--IVKGVEQFATHWNGELLAQSIGHLLGLEHDTTACSCEPSPECVMRQQPGRVGGGGGSPFSWQFSKCSVARMHGIWQDGN--------------IQCLLNKPFQVSE------LRECGNGVVDGSEECDCGSRENCQDPCCDPLTCTLRPHAQCAAHHKCCHR--CELRKAGDTCRSSKSPCDVAEQCDGKSGDCPPDGHLIDGTVCGT----DGQCWRGNCSDSHQQCQKLWGREARVAEPVCFEQNT-KGAEYANCGQRQA--DGTYH---------PCQIEDTRCGTLHCHSGSITPIDSSLKAFTFHFTENSHQIQCKS------IASAAVGLTSDGTNCASGRVCVAGSCVEMSSVSSATACPTNNLALLCSGHGHCTTTARCVCFNGWSGVACDIR 701          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Celegans
Match: sup-17 (Disintegrin and metalloproteinase domain-containing protein 10 homolog [Source:UniProtKB/Swiss-Prot;Acc:G5EFD9])

HSP 1 Score: 58.151 bits (139), Expect = 1.890e-8
Identity = 68/239 (28.45%), Postives = 101/239 (42.26%), Query Frame = 1
Query:  577 KYTAYTVSHELAHNFGLTHD-TSDCGCE----NCIMATGVEFSSRKLD--WSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXX--XXXXVENGEQCDCG-KRSDCE----KCC---------NFLTCKFSANSQCAS--GSCCNTEICKLYPTG--TICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECL--TKFNNKAHCFGGQCKDHGTQCRFL 1206
            + +  T++HE+ HNFG  HD  ++C       N IM        +  +  +S CS+  I ++L +       L   P       S   P+   KR      +    GN I E GE+CDCG  ++DC+    KCC             CK    +QC+   G CCN + C L+      ICR  +  C   + C+G++  CP+   + DG  C   TK  +   C G  C   G +  FL
Sbjct:  418 RVSQLTLAHEIGHNFGSPHDFPAECQPGLPDGNFIMFASATSGDKPNNGKFSPCSVKNISAVLAV------VLKSMPVDPTRNAS---PVGIGKRNCFQERTSAFCGNQIYEPGEECDCGFSQADCDQMGDKCCVPHEARGNGGPGPCKRKPGAQCSPSQGYCCNPDTCSLHGKNEEKICRQESE-CSNLQTCDGRNAQCPVSPPKHDGIPCQDSTKVCSSGQCNGSVCAMFGLEDCFL 646          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Fly
Match: Meltrin (gene:FBgn0265140 transcript:FBtr0301499)

HSP 1 Score: 236.498 bits (602), Expect = 3.217e-66
Identity = 174/532 (32.71%), Postives = 257/532 (48.31%), Query Frame = 1
Query:  154 GSVNANEFSIKIDRNKNQLQIFTLYLIVDSNLYQQSQESTENRIQ---SIFILINKIYLPLGIQFQIICIEIWKE-NLIEISQE-EYILEELKIYKTKSVNINH--DCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGC--ENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCE-KCCNFLTCKF-SANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKV---MQIGLSKSYSFTTKTNQF--CEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGI----FDKSC--HCFNNGICTNQKKCQCFQQYLPPNCSE 1683
            G  NAN++S  ++          L ++VD+ +Y+  QE+T+   Q    I  +IN +Y+PL I   ++ + IW E N IE S + +  L     Y++  + ++H  D   L    N+     G+A    +C+     G ++   + N    A T++HE+ HNFG+ HDTSDC C  E C+MA     S   ++WSSCSI Q+      G                        +++K         CGNG VE GEQCDCG    CE  CCN  TC   S N+ CA+G CC+   C+    G+ CR +   CDL EYC G+ E CP D+FR+D   C      +A+CF G C+ H  QCR LWG T + S   CY++NTE      NCG    LN KT+           C++ +  CG L CIH NE++   M+     S+S+ +   +   C  +  ++     D G+ P+GA CG   +C +  C+P+D +      K C   C  NGIC ++  C C   +   +CS+
Sbjct:  259 GPYNANKYSSYVE----------LVIVVDNKVYKNFQENTKKVHQYCKGIANIINALYVPLNIFVALVGVVIWNESNEIEFSSDGDLTLRNFLNYRSTKLVLDHPNDNAQLLTKENFAGGVVGKALKGPICTYEYSGGVSMQH-SPNPAMVATTMAHEMGHNFGMEHDTSDCHCRDEKCVMAAS-STSFIPVNWSSCSIDQLTIAFSRGM--------------------NYCLRNKPERLFESPTCGNGFVEPGEQCDCGLPEHCENACCNAQTCMLHSKNATCATGECCDLTTCRPKLAGSACREAENECDLPEYCTGESEYCPADVFRRDTEPC---DGGQAYCFHGTCRSHSNQCRTLWGPTGDNS-EHCYNKNTEGTR-LGNCGYN-RLN-KTFLR---------CEEQHVNCGMLHCIHLNERLEFGMESAAVLSHSYISHDRKIVACRTALVDLGLQTTDPGLTPNGAKCGVDKMCVDQRCLPVDAVRQKGMGKPCPEDCNGNGICNSRGHCHCDVGFGGESCSK 742          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Fly
Match: Meltrin (gene:FBgn0265140 transcript:FBtr0301498)

HSP 1 Score: 237.654 bits (605), Expect = 7.219e-66
Identity = 174/521 (33.40%), Postives = 253/521 (48.56%), Query Frame = 1
Query:  154 GSVNANEFSIKIDRNKNQLQIFTLYLIVDSNLYQQSQESTENRIQ---SIFILINKIYLPLGIQFQIICIEIWKE-NLIEISQE-EYILEELKIYKTKSVNINH--DCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGC--ENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCE-KCCNFLTCKF-SANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKV---MQIGLSKSYSFTTKTNQF--CEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGI----FDKSC--HCFNNGICTNQKKCQC 1650
            G  NAN++S  ++          L ++VD+ +Y+  QE+T+   Q    I  +IN +Y+PL I   ++ + IW E N IE S + +  L     Y++  + ++H  D   L    N+     G+A    +C+     G ++   + N    A T++HE+ HNFG+ HDTSDC C  E C+MA     S   ++WSSCSI Q+      G   +  L   P  +F                      CGNG VE GEQCDCG    CE  CCN  TC   S N+ CA+G CC+   C+    G+ CR +   CDL EYC G+ E CP D+FR+D   C      +A+CF G C+ H  QCR LWG T + S   CY++NTE      NCG    LN KT+           C++ +  CG L CIH NE++   M+     S+S+ +   +   C  +  ++     D G+ P+GA CG   +C +  C+P+D +      K C   C  NGIC ++  C C
Sbjct:  259 GPYNANKYSSYVE----------LVIVVDNKVYKNFQENTKKVHQYCKGIANIINALYVPLNIFVALVGVVIWNESNEIEFSSDGDLTLRNFLNYRSTKLVLDHPNDNAQLLTKENFAGGVVGKALKGPICTYEYSGGVSMQH-SPNPAMVATTMAHEMGHNFGMEHDTSDCHCRDEKCVMAAS-STSFIPVNWSSCSIDQLTIAFSRGM--NYCLRNKPERLF------------------ESPTCGNGFVEPGEQCDCGLPEHCENACCNAQTCMLHSKNATCATGECCDLTTCRPKLAGSACREAENECDLPEYCTGESEYCPADVFRRDTEPC---DGGQAYCFHGTCRSHSNQCRTLWGPTGDNSE-HCYNKNTEGTR-LGNCGYN-RLN-KTFLR---------CEEQHVNCGMLHCIHLNERLEFGMESAAVLSHSYISHDRKIVACRTALVDLGLQTTDPGLTPNGAKCGVDKMCVDQRCLPVDAVRQKGMGKPCPEDCNGNGICNSRGHCHC 731          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Fly
Match: mmd (gene:FBgn0259110 transcript:FBtr0299534)

HSP 1 Score: 180.259 bits (456), Expect = 2.496e-47
Identity = 151/545 (27.71%), Postives = 245/545 (44.95%), Query Frame = 1
Query:  187 IDRNKNQLQIFTLYL----IVDSNLYQQSQESTENRIQSIFILINKI----YLPLGIQFQIICIEIWKENLIEISQEEYI---LEELKIYKTKSV-NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTS--DCGCEN---CIMATGV--EFSSRKLDWSSCSISQIKSLLKLGFP-CHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDC--EKCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTEC-LTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFT---TKTNQF-CEASRFEVDWNN-RDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKS--------CHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMST 1713
            + RNK  ++  T Y+    IVD  ++ +   ST   +    I +  I    +  L  +  ++ IE W +N   I   + I   +     Y ++++  I  D   L  G  +     G A   T+C+  + VG +VD         A T++H + HN G+ HD    +C C +   CIMA  +  + + +   +S CS       L+ G   C   L   P  I +   RR    K               +VE  E+CDCG   +C  ++CC+ +TCK  + +QCASG+CC+   C+L P   ICR+S   CDL EYC+G+   CP D+F+++G+ C L+K     +CF G C     QC  +WG   + +   CY++   +     +CG      ++ Y           C+  N  CG L C     + +  G+ + YS T    K  +F C+A+  +V  N+  + G+V DG  CG+ ++C N  CV L    D++          C  +G+CTN  +C C   +   +CS    + + + T
Sbjct:  258 VGRNKRDVREATKYIETAIIVDKAMFDKRNGSTRAEVIHDAIQVANIADLYFRTLNTRVSVVYIETWGKNQAVIDGSKDISKAISNFNDYTSRNLFQIERDTTQLLTGETFAGGEAGMAVPETVCTPRA-VGISVDVNVYEPHLLAGTMAHMIGHNIGMGHDDGREECFCRDWHGCIMAQSIVGQENVQPYKFSECSKKDYIDALRTGHGLC---LLNKPNEIEL---RRNCGNK---------------VVEEDEECDCGTFEECALDQCCDGITCKLKSEAQCASGACCDQ--CRLRPKDYICRDSNNECDLPEYCDGEIGQCPSDVFKKNGSPCGLSKTGISGYCFQGYCPTLSLQCEAIWGYGGSAADRQCYEQFNSKGSINGHCGRDA---NEHYIK---------CEPENVQCGTLQCKDGERQPVNDGIDQLYSRTIISIKGQEFECKATSGQVGSNSYPEHGLVKDGTPCGDNLICLNQTCVSLFPHVDQTKCPANSQGLECSEHGVCTNTNRCFCDMGWGGNDCSSVVLLTTALPT 766          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Fly
Match: mmd (gene:FBgn0259110 transcript:FBtr0307542)

HSP 1 Score: 180.644 bits (457), Expect = 5.341e-47
Identity = 151/545 (27.71%), Postives = 245/545 (44.95%), Query Frame = 1
Query:  187 IDRNKNQLQIFTLYL----IVDSNLYQQSQESTENRIQSIFILINKI----YLPLGIQFQIICIEIWKENLIEISQEEYI---LEELKIYKTKSV-NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTS--DCGCEN---CIMATGV--EFSSRKLDWSSCSISQIKSLLKLGFP-CHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDC--EKCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTEC-LTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFT---TKTNQF-CEASRFEVDWNN-RDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKS--------CHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMST 1713
            + RNK  ++  T Y+    IVD  ++ +   ST   +    I +  I    +  L  +  ++ IE W +N   I   + I   +     Y ++++  I  D   L  G  +     G A   T+C+  + VG +VD         A T++H + HN G+ HD    +C C +   CIMA  +  + + +   +S CS       L+ G   C   L   P  I +   RR    K               +VE  E+CDCG   +C  ++CC+ +TCK  + +QCASG+CC+   C+L P   ICR+S   CDL EYC+G+   CP D+F+++G+ C L+K     +CF G C     QC  +WG   + +   CY++   +     +CG      ++ Y           C+  N  CG L C     + +  G+ + YS T    K  +F C+A+  +V  N+  + G+V DG  CG+ ++C N  CV L    D++          C  +G+CTN  +C C   +   +CS    + + + T
Sbjct:  258 VGRNKRDVREATKYIETAIIVDKAMFDKRNGSTRAEVIHDAIQVANIADLYFRTLNTRVSVVYIETWGKNQAVIDGSKDISKAISNFNDYTSRNLFQIERDTTQLLTGETFAGGEAGMAVPETVCTPRA-VGISVDVNVYEPHLLAGTMAHMIGHNIGMGHDDGREECFCRDWHGCIMAQSIVGQENVQPYKFSECSKKDYIDALRTGHGLC---LLNKPNEIEL---RRNCGNK---------------VVEEDEECDCGTFEECALDQCCDGITCKLKSEAQCASGACCDQ--CRLRPKDYICRDSNNECDLPEYCDGEIGQCPSDVFKKNGSPCGLSKTGISGYCFQGYCPTLSLQCEAIWGYGGSAADRQCYEQFNSKGSINGHCGRDA---NEHYIK---------CEPENVQCGTLQCKDGERQPVNDGIDQLYSRTIISIKGQEFECKATSGQVGSNSYPEHGLVKDGTPCGDNLICLNQTCVSLFPHVDQTKCPANSQGLECSEHGVCTNTNRCFCDMGWGGNDCSSVVLLTTALPT 766          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Fly
Match: mmd (gene:FBgn0259110 transcript:FBtr0307540)

HSP 1 Score: 180.259 bits (456), Expect = 6.164e-47
Identity = 151/545 (27.71%), Postives = 245/545 (44.95%), Query Frame = 1
Query:  187 IDRNKNQLQIFTLYL----IVDSNLYQQSQESTENRIQSIFILINKI----YLPLGIQFQIICIEIWKENLIEISQEEYI---LEELKIYKTKSV-NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTS--DCGCEN---CIMATGV--EFSSRKLDWSSCSISQIKSLLKLGFP-CHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDC--EKCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTEC-LTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFT---TKTNQF-CEASRFEVDWNN-RDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKS--------CHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMST 1713
            + RNK  ++  T Y+    IVD  ++ +   ST   +    I +  I    +  L  +  ++ IE W +N   I   + I   +     Y ++++  I  D   L  G  +     G A   T+C+  + VG +VD         A T++H + HN G+ HD    +C C +   CIMA  +  + + +   +S CS       L+ G   C   L   P  I +   RR    K               +VE  E+CDCG   +C  ++CC+ +TCK  + +QCASG+CC+   C+L P   ICR+S   CDL EYC+G+   CP D+F+++G+ C L+K     +CF G C     QC  +WG   + +   CY++   +     +CG      ++ Y           C+  N  CG L C     + +  G+ + YS T    K  +F C+A+  +V  N+  + G+V DG  CG+ ++C N  CV L    D++          C  +G+CTN  +C C   +   +CS    + + + T
Sbjct:  258 VGRNKRDVREATKYIETAIIVDKAMFDKRNGSTRAEVIHDAIQVANIADLYFRTLNTRVSVVYIETWGKNQAVIDGSKDISKAISNFNDYTSRNLFQIERDTTQLLTGETFAGGEAGMAVPETVCTPRA-VGISVDVNVYEPHLLAGTMAHMIGHNIGMGHDDGREECFCRDWHGCIMAQSIVGQENVQPYKFSECSKKDYIDALRTGHGLC---LLNKPNEIEL---RRNCGNK---------------VVEEDEECDCGTFEECALDQCCDGITCKLKSEAQCASGACCDQ--CRLRPKDYICRDSNNECDLPEYCDGEIGQCPSDVFKKNGSPCGLSKTGISGYCFQGYCPTLSLQCEAIWGYGGSAADRQCYEQFNSKGSINGHCGRDA---NEHYIK---------CEPENVQCGTLQCKDGERQPVNDGIDQLYSRTIISIKGQEFECKATSGQVGSNSYPEHGLVKDGTPCGDNLICLNQTCVSLFPHVDQTKCPANSQGLECSEHGVCTNTNRCFCDMGWGGNDCSSVVLLTTALPT 766          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Zebrafish
Match: adam15 (ADAM metallopeptidase domain 15 [Source:ZFIN;Acc:ZDB-GENE-070809-4])

HSP 1 Score: 209.149 bits (531), Expect = 3.784e-57
Identity = 151/529 (28.54%), Postives = 246/529 (46.50%), Query Frame = 1
Query:  202 NQLQIFTLYLIVDSNLYQQSQESTENRIQSIFILINKI---YLPLGIQFQIICIEIWK-ENLIEISQEEY-ILEELKIYKTKSV--NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSD--CGCEN------CIMATGVEFSSRKLDWSSCSISQIK-SLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDC-EKCCNFLTCKFSANSQCAS-GSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQ---FCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDC--VPLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSP 1719
            ++++   L L+ D   Y   Q++ +  I  +  + N++   Y PL ++  ++ +EIW  ++ I++ +     L     ++T+ +   + HD   L +G ++  T  G A  ++MCSK    G  VD +  ++   A TV+HEL HN G++HDT+D  C C+N      CIM     F   +L +SSCS   +  SLL  G  C              + + + ++   R  ++         VE GE+CDCG   +C + CCN  TCK    +QC+S G CC  E CKL   G++CR     CDL E+C G    CP ++F Q+G  C       ++C+ G C     QC+ LWGQ S  +   C+    ++ + + NCG M    + +Y          PC K +  CGR+ C    E+ +    ++  + T   NQ    C  + F +  +  D  MV  G  CG    C +  C  V + G+ +    C  +G+C + K C C + + PP+C       S  ++ P
Sbjct:  199 SEIKYIELVLVADHKEYLNYQKNNKTIIYRMLDVANQVDWFYRPLNVRVALLGLEIWSDQDKIKVDKSPTETLNRFLDWRTRELLPRLRHDNAQLIMGESFDGTTVGMASQSSMCSKDRSGGVNVDHLV-SVLGVASTVAHELGHNLGMSHDTADRRCHCQNEPRLGGCIMEPSTGFMPGQL-FSSCSERDLSLSLLHGGGMC-----------LFNVPQPESLLGGPRCGNLY--------VEKGEECDCGLLDECNDPCCNASTCKLVPGAQCSSDGICC--ENCKLRVAGSVCREPLGECDLPEHCTGSSPYCPPNVFLQNGEPCK---GGSSYCYSGVCASLDDQCQMLWGQNSTRAPPICFSSVNKQGNKYGNCGQM---PNGSYI---------PCLKWDVHCGRIQCQGGGERPLLGSNAEILTTTVILNQSDFTCRGTYFNLGDDVSDPAMVLQGTACGPNKACVDQKCRDVSMFGVDECRSKCHGHGVCNSNKNCHCDEGWAPPDCRYSGNGGSVDNSDP 689          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Zebrafish
Match: adam9 (ADAM metallopeptidase domain 9 [Source:ZFIN;Acc:ZDB-GENE-040912-127])

HSP 1 Score: 209.149 bits (531), Expect = 4.074e-57
Identity = 158/532 (29.70%), Postives = 248/532 (46.62%), Query Frame = 1
Query:  202 NQLQIFTLYLIVDSNLYQ---QSQESTENRIQSIFILINKIYLPLGIQFQIICIEIWK-ENLIEI-SQEEYILEELKIYKTKSV--NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQN-IKYTAYTVSHELAHNFGLTHDTS-DCGCE--NCIMATGVEFSSRKLDWSSCSISQI-KSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCEK--CCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGI-----FDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPYTRNLDT 1740
            +Q     L ++VD+  Y    ++  +    +  I   ++ +Y+PL I+  ++ +EIW  +NLI I      +L     ++ K +     HD   L L   +  T  G A   T CS+S   G  +++ T N +   A  V+HEL HN G+ HD   +C C+  +CIM +G   S    ++SSCS     K +L  G  C  ++ + P   +       P   +K             +V+ GE+CDCG   +CEK  CC   TCK  + +QCA G CC    C+  P G++CR+ST  CDL EYCNG    C  D+F+QDG  C     + A+C+ GQC+ + TQC+ ++G+ +  +   C+ +   +   F NCG         Y  S      K C+  N++CG+L C +     +  G+  +   T      C    F +  +  D GMV +G  CG+  VC N +C   D +      +K CH   +G+C + K C C   + PP C E      ++ + P   + DT
Sbjct:  212 HQTHYVELLMVVDNERYNYKNRNHTAVREEVVQIANYVDSMYIPLNIRIVLVGLEIWNMQNLINIDGSAGEVLSRFTQWREKELVHRRRHDSAQLILKKGFGGT-AGMAFVGTACSRSH--GGGINAFTNNNVMSFASIVAHELGHNLGMNHDDGRNCKCDVTHCIMNSGATGS---CNFSSCSADDFEKMILNSGGRCLLNIPR-PDEAY-----SAPFCGNK-------------LVDVGEECDCGSEEECEKDPCCEAKTCKLRSGAQCAYGVCCKN--CRFLPGGSVCRSSTDECDLAEYCNGSSALCQNDVFKQDGHPCK---QDTAYCYNGQCQHYDTQCQNIFGKKAKAAPELCFKDVNSKGDRFGNCG---------YHSSGF----KKCESRNAMCGKLQCENVFSLSVIFGIKPARIETPIAGTTCWGVDFRLGSDVPDPGMVNEGTKCGDNKVCLNFECRSADVLNYDCDVEKKCH--GHGVCNSNKNCHCEYGWAPPFC-EASGYGGSIDSGPTWNDKDT 697          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Zebrafish
Match: adam15 (ADAM metallopeptidase domain 15 [Source:ZFIN;Acc:ZDB-GENE-070809-4])

HSP 1 Score: 209.92 bits (533), Expect = 6.015e-57
Identity = 149/515 (28.93%), Postives = 242/515 (46.99%), Query Frame = 1
Query:  202 NQLQIFTLYLIVDSNLYQQSQESTENRIQSIFILINKI---YLPLGIQFQIICIEIWK-ENLIEISQEEY-ILEELKIYKTKSV--NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSD--CGCEN------CIMATGVEFSSRKLDWSSCSISQIK-SLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDC-EKCCNFLTCKFSANSQCAS-GSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQ---FCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDC--VPLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNC 1677
            ++++   L L+ D   Y   Q++ +  I  +  + N++   Y PL ++  ++ +EIW  ++ I++ +     L     ++T+ +   + HD   L +G ++  T  G A  ++MCSK    G  VD +  ++   A TV+HEL HN G++HDT+D  C C+N      CIM     F   +L +SSCS   +  SLL  G  C              + + + ++   R  ++         VE GE+CDCG   +C + CCN  TCK    +QC+S G CC  E CKL   G++CR     CDL E+C G    CP ++F Q+G  C       ++C+ G C     QC+ LWGQ S  +   C+    ++ + + NCG M    + +Y          PC K +  CGR+ C    E+ +    ++  + T   NQ    C  + F +  +  D  MV  G  CG    C +  C  V + G+ +    C  +G+C + K C C + + PP+C
Sbjct:  246 SEIKYIELVLVADHKEYLNYQKNNKTIIYRMLDVANQVDWFYRPLNVRVALLGLEIWSDQDKIKVDKSPTETLNRFLDWRTRELLPRLRHDNAQLIMGESFDGTTVGMASQSSMCSKDRSGGVNVDHLV-SVLGVASTVAHELGHNLGMSHDTADRRCHCQNEPRLGGCIMEPSTGFMPGQL-FSSCSERDLSLSLLHGGGMC-----------LFNVPQPESLLGGPRCGNLY--------VEKGEECDCGLLDECNDPCCNASTCKLVPGAQCSSDGICC--ENCKLRVAGSVCREPLGECDLPEHCTGSSPYCPPNVFLQNGEPCK---GGSSYCYSGVCASLDDQCQMLWGQNSTRAPPICFSSVNKQGNKYGNCGQM---PNGSYI---------PCLKWDVHCGRIQCQGGGERPLLGSNAEILTTTVILNQSDFTCRGTYFNLGDDVSDPAMVLQGTACGPNKACVDQKCRDVSMFGVDECRSKCHGHGVCNSNKNCHCDEGWAPPDC 722          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Zebrafish
Match: adam8a (ADAM metallopeptidase domain 8a [Source:ZFIN;Acc:ZDB-GENE-030616-622])

HSP 1 Score: 200.29 bits (508), Expect = 6.743e-54
Identity = 147/505 (29.11%), Postives = 231/505 (45.74%), Query Frame = 1
Query:  211 QIFTLYLIVDSNLYQQ--SQESTENRIQSIFILINKIYLPLGIQFQIICIEIWKE-NLIEISQEEYI-LEELKIYKTKSV--NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGC---ENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCE-KCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQFCEASR---FEVDWN-NRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSC--HCFNNGICTNQKKCQCFQQYLPPNC 1677
            QI  + L+VD+  Y++  S +  E R+  +   ++K+Y PL I+  ++ +E+W + +LI++S    + LE    ++  S+     HD  H   G ++  +  G A    MCS SS      D  +  I   A TV+HE+ HN G++HD S CGC   + CIM   +  S     +S+CS S +K+ L+           + T   + +     +            +CGN  VE GE+CDCG   +C   CCN  TC+ +  ++CA G CC+   C+L  TG++CR S   CDL EYC G+   CP D ++ +G  C     N+ +C+ GQC  H   C+ LWG  +++   +C+  N                         +D  +K  +     CGR++C   N           +  T K       SR     +D +   D+GMVP G  CG   VC    C+ +     ++C   C N G+C ++ KC C   + PP C
Sbjct:  197 QIVEMVLVVDNTEYKKFGSFKKIEERMMLVANHVDKLYRPLNIRVMLVGLEVWSQRDLIDVSSRPNLTLERFLKWRRDSLLQRKKHDNAHFITGIDFEGSTVGLATLYAMCSSSSSGAVNEDHNSNPIA-VASTVAHEMGHNLGMSHDDSSCGCSSNKGCIMGDTIG-SIYPDSFSTCSQSSLKAFLE----------NYDTNCLIDVPNEGQIYGGP--------VCGNAFVEKGEECDCGTVEECNNPCCNATTCRLTEGARCAHGECCHN--CQLKHTGSLCRKSAHDCDLDEYCTGESAFCPEDDYKMNGLPC---NYNQGYCYNGQCPTHKEHCKMLWGSGADVDDDACFQYNV------------------------IDRTSKSAEHRK--CGRIYCYGGN----------PFPKTNKKANVNVQSRTCYMALDSSPTEDLGMVPTGTKCGTNKVCYKSLCLDISMYGTENCSNKCNNRGVCNHELKCHCDPGWAPPYC 640          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Zebrafish
Match: adam23a (ADAM metallopeptidase domain 23a [Source:ZFIN;Acc:ZDB-GENE-070810-2])

HSP 1 Score: 187.963 bits (476), Expect = 5.031e-50
Identity = 157/544 (28.86%), Postives = 250/544 (45.96%), Query Frame = 1
Query:  205 QLQIFTLYLIVDSNLYQQ--SQESTENRIQSIFILINKIYLP-LGIQFQIICIEIWKE-NLIEISQEEY-ILEELKIYKTKSVNINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTS----DCGCEN----CIMA-TGVEFSSRKLDWSSCSISQIKS-LLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCEK-CCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIG-LSKSYSFTTKTNQF----CEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSCH-------CFNNGICTNQKKCQCFQQYLPPNCS------ERQTIKSTMSTSPYTRNL 1734
            +++   + ++ D N +++  S++ T N  +S+  L++ I+   L  +  ++ +EIW + + I +S +   +L++   Y+ +++NIN D +HLF    + + R        +CSK+  +G      T  +   A   S  LA N G+  D S    +CGC +    CIM  TGV+   +   +S CSI+  ++ LL+ G  C   L   P  +F                    + CGNG VE GE+CDCG R +C K CC    C  S  + C+ G CCN   C  YP G  CR +   CD++E C+G    CP ++ +QDG  C     N+  C+ G+CK   +QC+++WG  +  S   CY++   E     NCG      DK        W   PC K +  CG L C     ++ +IG L    + TT  +Q     C      +D ++ D+G V DG  CG  M+C    C+P+  +   +C        C ++G+C N+  C C   +   +CS      E   I+      P   NL
Sbjct:  252 EMKYLEIMIVADHNTFKKHRSKKHTRNTAKSLVNLVDAIFKEQLNTRVVLVAVEIWTDKDRIPLSVKPLEMLKDFSKYRQQNININADAVHLFTNMTFHYGRSSVGYIGGVCSKARGIGVNEFGNTWTM---AGFFSQSLAQNLGIQWDPSLRRKECGCMDSWLGCIMEDTGVQHPRK---FSKCSITDYRNFLLRGGASC---LFNKPNKLF------------------EATECGNGYVEVGEECDCGARMECYKDCCK--KCSLSNGAHCSDGPCCNG-TCLFYPRGYSCRFAVNDCDISETCSGDSGQCPPNLHKQDGYSCQL---NQGRCYSGECKTRESQCKYIWGPKAGGSEKHCYEKLNTEGTEKGNCG---RDGDK--------W--VPCSKHDVFCGYLLC-SSTGRIPRIGTLKGDVTPTTFNHQGRLVDCSGGHVLLD-DDTDLGYVEDGTPCGPSMMCLERKCLPISSLNLTACPSGPGGRVCSSHGVCNNEATCTCDATWAGTDCSMHDPPKEPPVIEDPGPKGPSATNL 747          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Xenopus
Match: adam12 (ADAM metallopeptidase domain 12 [Source:NCBI gene;Acc:677729])

HSP 1 Score: 196.438 bits (498), Expect = 2.712e-52
Identity = 146/526 (27.76%), Postives = 235/526 (44.68%), Query Frame = 1
Query:  223 LYLIVDSNLYQQSQESTE---NRIQSIFILINKIYLPLGIQFQIICIEIWKE-NLIEISQEEYI-LEE------LKIYKTKSVNINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCE--------NCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFP-CHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDC-EKCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVM----QIGLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDC--VPLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSP 1719
            L ++ D+  YQ+  +  +   +R+  +   ++K + PL I+  ++ +EIW + +   I+Q+ +  L+E      LK+   K     HD   L  G  +  T  G A   +MC+     G  +D  + N    A T++HEL HNFG+ HDT + GC          CIM     +    + +SSCS   + S L+ G   C  ++ +                    T S     CGNG VE GEQCDCG+  +C   CCN   C     + CA G CC  E CKL P GT CR++  FCDL E+C+G   +CP +++  DG  C   F  + +C+ G C+ H  QC  LWGQ +  +   C++        + NCG       K    SF       C+  ++ CG++ C     + +     + +  +          C  +   +  +  D G+V  G  C    +C N  C  + + G+ D +  C  +G+C N+K C C  ++ PP C ++     ++ + P
Sbjct:  231 LVIVADNREYQRQGKDVDKVKHRLIEMANYVDKFFRPLNIRVALVGVEIWSDSDKCSITQDPFTTLQEFLDWRKLKLLPQKP----HDNAQLVSGVYFQGTTIGMAPIMSMCTADKSGGIVMDH-SGNPLGAAVTLAHELGHNFGMNHDTLERGCNCRGSADNGGCIMTPSTAYPFPTV-FSSCSKKDLDSSLEKGVGMCLYNMPEV-------------------TESFGEQKCGNGYVEEGEQCDCGEPDECTNPCCNASLCMLKPGAVCAHGLCC--EDCKLKPAGTPCRDANNFCDLPEFCSGTSAHCPANVYLHDGHPC---FKIEGYCYNGVCQTHEQQCITLWGQGAKPAPGICFERVNSAGDPYGNCG-------KDSTGSFTK-----CENRDAKCGKIQCQGGANRPVIGTNAVSIETNIPLQEGRRILCRGTHVYLGDDLPDPGLVLAGTKCEEGKICLNRKCQNISIFGVHDCALKCHGHGVCNNKKNCHCEAEWAPPFC-DKHGFGGSVDSGP 713          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Xenopus
Match: tbc1d32 (TBC1 domain family member 32 [Source:Xenbase;Acc:XB-GENE-5791257])

HSP 1 Score: 192.586 bits (488), Expect = 5.499e-51
Identity = 146/505 (28.91%), Postives = 229/505 (45.35%), Query Frame = 1
Query:  223 LYLIVDSNLYQQSQ---ESTENRIQSIFILINKIYLPLGIQFQIICIEIWKE-NLIEISQEEY-ILEELKIYKTKSV-NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCE-----NCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFP-CHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDC-EKCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQ---IGLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSC--HCFNNGICTNQKKCQCFQQYLPPNCSE 1683
            LYL+ D   +Q+     E T+ ++  +   I+K Y  L I+  ++ +E+W   +   +S+  Y  L     ++ K + +  HD   L  G +++ T  G A    MCS     G  +D  + N    A T++HEL HNFG++HD + C         CIMA        K+ +++C+  ++    + G   C   L+  P T  +    R                CGNG +E GEQCDCG    C   CCN  TC   A + CA G+CC    CKL P G  CR  +  CDL E+C GQ   CP + F+ DGT C      +A C+ G+C  H  QC+ LWG  S ++   C++        + NCG  ++    TY         + C+  + +CG++ C+    K M+   + +  + +   K  Q      ++ + +  D G+V  G  CG   +C +G C     +    C   C  NG+C N + C CF  + PP C++
Sbjct:  213 LYLVADYAEFQKHDSDLEETQRKMLEVMNYIDKFYRALNIRIALVGLEVWTAGDKCNVSENPYSTLRAFLSWRRKLLQHTPHDNAQLITGRSFYGTTIGLAPLQAMCSVYQSGGVNMDH-SDNAIGVAATMAHELGHNFGMSHDAAGCCTAKPEEGGCIMAASTGHPFPKV-FNACNKQELDRFFRSGGGMC---LSNLPDTKTLFGGPR----------------CGNGFLEEGEQCDCGDPEQCNNPCCNATTCTLMAGADCAHGACCLR--CKLRPPGFPCRKPSRPCDLPEFCTGQSAVCPPNSFQLDGTLCQ---GEQAFCYNGRCLTHQQQCQQLWGARSRVAPDLCFELINVAGDQYGNCGRDMS---GTY---------RSCEGRDVMCGKIQCLSQASKPMESNAVAIDTTITIEGKRVQCRGTHIYKEEDDLMDPGLVLTGTKCGLNQICFDGQCRNTSFLQVDECAKKCHGNGMCNNNRNCHCFAGWRPPFCNQ 679          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Xenopus
Match: adam28.2 (ADAM metallopeptidase domain 28, gene 2 [Source:NCBI gene;Acc:100145537])

HSP 1 Score: 188.348 bits (477), Expect = 7.448e-50
Identity = 150/502 (29.88%), Postives = 231/502 (46.02%), Query Frame = 1
Query:  223 LYLIVDSNLYQQSQESTEN---RIQSIFILINKIYLPLGIQFQIICIEIW--KENLIEISQEEYILEELKIYKTKSV--NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCE--NCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPM-MK--SKRTXXXXXXXXXXXXVENGEQCDCGKRSDC-EKCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKS---CHCFNNGICTNQKKCQCFQQYLPPNCS 1680
            LY++ D +++ +   STEN   RI  I   +N +Y  + I   +  IE+W   +    +S  +  L+    ++TK++     HD        ++  +  G A   TMCS +S  G   D   Q+I   A TV+HE+ HN G+ HD + C C   +CIM   + F++ + ++S CS              H +   F       I ++ P+ MK   K+T      +CGN   E GE+CDCG  S+C   CCN  TCK  A +QCA G CC++  CK    GT+CR+    CDL E C+GQ   CP D FR +G  C    N + +C+ G C      C  LWG +S ++  SC++ N            +   N+    DS  +    PC++S+  CG L+C            S  YS       +    R E         +V +G  CG+ MVC  G+C  +   F  S     C  + +C ++ +C+C + + PP+C+
Sbjct:  201 LYMVADKSMFNKYGRSTENVKRRIFEIVNFVNVVYKQINIFVALTGIEVWDKSDGFTVVSSADEDLKLFSDWRTKNLLPRKAHDNAQFITHIDFDGSTVGLAYVGTMCSSTSSTGVIQDHSQQSIAIGA-TVAHEMGHNLGINHDEAHCTCSTGSCIMEPALSFNTPR-EFSLCS--------------HQNYQDF-------ILQKMPLCMKDVPKKTEIQTPPVCGNKFTELGEECDCGSISECTNPCCNATTCKLKAGAQCAEGQCCDS--CKWTKAGTVCRSKRHDCDLAEMCDGQSAECPSDRFRVNGFPCR---NGEGYCYNGLCPTLQGLCSALWGPSSVVADDSCFNYN------------LRGANNGYCQDSKGN--QVPCKQSDVKCGVLYC------------SGGYSTPNLGGYYI---RGECKTTLYPTFLVENGTKCGDNMVCFMGECTSIQTAFGPSDCDAKCPEHAVCDHENQCRCEEGWAPPDCA 645          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Xenopus
Match: adam28.2 (ADAM metallopeptidase domain 28, gene 2 [Source:NCBI gene;Acc:100145537])

HSP 1 Score: 188.348 bits (477), Expect = 7.702e-50
Identity = 150/502 (29.88%), Postives = 231/502 (46.02%), Query Frame = 1
Query:  223 LYLIVDSNLYQQSQESTEN---RIQSIFILINKIYLPLGIQFQIICIEIW--KENLIEISQEEYILEELKIYKTKSV--NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCE--NCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPM-MK--SKRTXXXXXXXXXXXXVENGEQCDCGKRSDC-EKCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKS---CHCFNNGICTNQKKCQCFQQYLPPNCS 1680
            LY++ D +++ +   STEN   RI  I   +N +Y  + I   +  IE+W   +    +S  +  L+    ++TK++     HD        ++  +  G A   TMCS +S  G   D   Q+I   A TV+HE+ HN G+ HD + C C   +CIM   + F++ + ++S CS              H +   F       I ++ P+ MK   K+T      +CGN   E GE+CDCG  S+C   CCN  TCK  A +QCA G CC++  CK    GT+CR+    CDL E C+GQ   CP D FR +G  C    N + +C+ G C      C  LWG +S ++  SC++ N            +   N+    DS  +    PC++S+  CG L+C            S  YS       +    R E         +V +G  CG+ MVC  G+C  +   F  S     C  + +C ++ +C+C + + PP+C+
Sbjct:  203 LYMVADKSMFNKYGRSTENVKRRIFEIVNFVNVVYKQINIFVALTGIEVWDKSDGFTVVSSADEDLKLFSDWRTKNLLPRKAHDNAQFITHIDFDGSTVGLAYVGTMCSSTSSTGVIQDHSQQSIAIGA-TVAHEMGHNLGINHDEAHCTCSTGSCIMEPALSFNTPR-EFSLCS--------------HQNYQDF-------ILQKMPLCMKDVPKKTEIQTPPVCGNKFTELGEECDCGSISECTNPCCNATTCKLKAGAQCAEGQCCDS--CKWTKAGTVCRSKRHDCDLAEMCDGQSAECPSDRFRVNGFPCR---NGEGYCYNGLCPTLQGLCSALWGPSSVVADDSCFNYN------------LRGANNGYCQDSKGN--QVPCKQSDVKCGVLYC------------SGGYSTPNLGGYYI---RGECKTTLYPTFLVENGTKCGDNMVCFMGECTSIQTAFGPSDCDAKCPEHAVCDHENQCRCEEGWAPPDCA 647          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Xenopus
Match: tbc1d32 (TBC1 domain family member 32 [Source:Xenbase;Acc:XB-GENE-5791257])

HSP 1 Score: 184.496 bits (467), Expect = 2.772e-49
Identity = 146/528 (27.65%), Postives = 236/528 (44.70%), Query Frame = 1
Query:  265 ESTENRIQSIFILINKIYLPLGIQFQIICIEIWKE-NLIEISQEEY-ILEELKIYKTKSV-NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCE------NCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDC-EKCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQ---IGLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSC--HCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPYTRNLDTEN-PID--KSNFTEKYFINIL 1794
            E T+ ++  +   I+K Y  L I+  ++ +E+W   +   +S+  Y  L     ++ K + +  HD   L  G +++ T  G A    MCS     G  +D  + N    A T++HEL HNFG++HD + C C        CIMA         + +++C+  ++    + G      L+  P T  +    R                CGNG +E GEQCDCG    C   CCN  TC   A + CA G+CC    CKL P G  CR  +  CDL E+C GQ   CP + F+ DGT C  +   +A C+ G+C  H  QC+ LWG  S ++   C++        + NCG  ++    TY         + C+  + +CG++ C+    K M+   + +  + +   K  Q      ++ + +  D G+V  G  CG   +C +G C     +    C   C  NG+C N + C CF  + PP C++      ++ + P   + ++   P+   KS+   +  I I 
Sbjct:   47 EETQRKMLEVMNYIDKFYRALNIRIALVGLEVWTAGDKCNVSENPYSTLRAFLSWRRKLLQHTPHDNAQLITGRSFYGTTIGLAPLQAMCSVYQSGGVNMDH-SDNAIGVAATMAHELGHNFGMSHDAAGC-CTAKPEEGGCIMAASTGGMGGPV-FNACNKQELDRFFRSGG--GMCLSNLPDTKTLFGGPR----------------CGNGFLEEGEQCDCGDPEQCNNPCCNATTCTLMAGADCAHGACCLR--CKLRPPGFPCRKPSRPCDLPEFCTGQSAVCPPNSFQLDGTLCQGE---QAFCYNGRCLTHQQQCQQLWGARSRVAPDLCFELINVAGDQYGNCGRDMS---GTY---------RSCEGRDVMCGKIQCLSQASKPMESNAVAIDTTITIEGKRVQCRGTHIYKEEDDLMDPGLVLTGTKCGLNQICFDGQCRNTSFLQVDECAKKCHGNGMCNNNRNCHCFAGWRPPFCNQTGN-GGSIDSGPVPEDGESHALPLKTRKSSLGSRELIQIF 535          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Mouse
Match: Adam20 (a disintegrin and metallopeptidase domain 20 [Source:MGI Symbol;Acc:MGI:2152342])

HSP 1 Score: 206.838 bits (525), Expect = 1.437e-56
Identity = 163/517 (31.53%), Postives = 251/517 (48.55%), Query Frame = 1
Query:  223 LYLIVDSNLYQQSQESTENRIQSIFI---LINKIYLPLGIQFQIICIEIWKE-NLIEISQEEYILEELKIYKTKSVNIN--HDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSIT-QNIKYTAYTVSHELAHNFGLTHDTSDCGCEN---CIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCEK--CCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYS---FTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSCH---CFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSP 1719
            L L+VD    +    +  + +  +F+   LINKIY  L I+  +I +E+W E NL+ + + + +LEE  ++KT S+NI   +D  HLF+ ++ F    G A   T+C  S   G  VD +   N+   A+ ++HE+ HN G+ HD+S C C     C+M++   F+    ++S+CS S                  F TT       R+  M      ++ I  CGNG+V++GEQCDCG R  CE+  CCN   C  +  + CA G CC    C++ P GT+CR     CDL E+CNG    CP D++  DG+ C     +  +C+  +C +   QC+ ++G+ +  +  SCY E   +   F NCG++         D++L      C  S+ +CGR+ C    E V +I   + +S   +T      C  + +       DIG+V DG  CG + VC N  CV    I+ + C    C   G+C N   C C + + PP+C E     S  S  P
Sbjct:  225 LALVVDCERIRYHNNNKSHVLVEVFLIISLINKIYFALDIEVVLIGLELWNEGNLVPVDRMQILLEEFCVWKTLSLNIRIPNDIAHLFV-NHSFGKFLGLAYVGTVCLPSHNCG--VDRLLGPNLFQFAHIIAHEIGHNLGMEHDSSSCTCGGINYCLMSSTYSFNP---EFSNCSYSN-----------------FWTTYATTNCLRKEKMS---IGNLQIQFCGNGVVDDGEQCDCGDRHMCERDQCCNS-RCALNDGAACAFGLCC--LYCQIMPAGTVCREEVNECDLPEWCNGHSHKCPNDVYLLDGSPC----RDGGYCYEKRCNNRDEQCKQIFGKEARSADHSCYRELNTQGDRFGNCGMIR--------DAYLR-----CHDSDILCGRVQC----ENVTRIPFLRDHSTVHWTHLNGVTCWGTDYHFGMTIPDIGIVKDGTDCGPEHVCINKKCVS-KPIWLEQCSSKTCTMKGVCNNLHHCHCNRGWDPPHCLESGFGGSVDSGPP 690          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Mouse
Match: Adam34 (a disintegrin and metallopeptidase domain 34 [Source:MGI Symbol;Acc:MGI:2181992])

HSP 1 Score: 195.667 bits (496), Expect = 6.159e-53
Identity = 155/552 (28.08%), Postives = 248/552 (44.93%), Query Frame = 1
Query:  226 YLIVDSNLYQQSQESTENRIQSIFILINKI---YLPLGIQFQIICIEIWKEN-LIEISQE-EYILEELKIYKTKSVN--INHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDS-ITQNIKYTAYTVSHELAHNFGLTHDTSDCGC--ENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDC--EKCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYS---FTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSCH---CFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPYTRNLDTENPIDKSNFTEKYFINILRENKILKIILG 1827
            ++++D N Y     +T   IQ +  ++N I   YL +     +  +E+W +N LI + QE   +L     +K  ++   + HD +HLF+  +Y  T  G A   T+C   +C    V+S ++ ++   A+ ++HE+ HN G+ HD S C C   +CIMA    + S    +S+CS  ++ S++       S L   P  +  K     P M                 VE GE+CDCG    C  + CC+   C     +QCA G CC    C+   TGT+CR     CDL E+CNG    CP D+++ DG  C    + + +C+  +C     QCR ++G  S  +   CY E       F NCG     ND + +        + C  ++ +CGR+ C    E V+Q+   +++    +T  +N  C  + +       D+G V DG  CG   +C +  CV    +  ++C    C   G+C N+  C C   + PP+C  R    S  S  P         P+  SN++  YF+       I+  +LG
Sbjct:  212 FVVIDHNRYVHRNNNTTTCIQDMLQVVNGINGYYLQIQTDVVLTKLEVWSQNNLINVEQEIRKVLGAFCNWKINAIGNRVRHDIIHLFVRRSYG-TYLGLANVGTVCLTLNCA---VNSFLSDSLSDMAFIIAHEMGHNLGMMHDGSSCTCGLSSCIMA---PYKSNSPKFSNCSYEEMFSVVTK----RSCLYDIPDAL--KTINLMPTMCGNNL------------VEEGEECDCGSTESCLQDPCCSS-DCVLKPGAQCAFGLCCKN--CQFLKTGTVCREEKNECDLPEWCNGTSAECPGDVYKADGIPC----SGEGYCYKMECHQRDEQCRKIFGNGSRSADEICYMEMNRRGDRFGNCG-----NDSSMY--------RRCNLADVLCGRIQC----ENVIQLPQRRNHETVHYTHFSNVTCWTTDYHFGITIDDVGAVSDGTTCGPDYLCVHRKCVS-KSVLVRNCTPQLCHMQGVCNNKDHCHCNNTWEPPDCQLRGHGGSIDSGPPPV-------PLSPSNWS-MYFLAF-----IIMYVLG 700          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Mouse
Match: Adam34 (a disintegrin and metallopeptidase domain 34 [Source:MGI Symbol;Acc:MGI:2181992])

HSP 1 Score: 195.667 bits (496), Expect = 6.159e-53
Identity = 155/552 (28.08%), Postives = 248/552 (44.93%), Query Frame = 1
Query:  226 YLIVDSNLYQQSQESTENRIQSIFILINKI---YLPLGIQFQIICIEIWKEN-LIEISQE-EYILEELKIYKTKSVN--INHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDS-ITQNIKYTAYTVSHELAHNFGLTHDTSDCGC--ENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDC--EKCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYS---FTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSCH---CFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPYTRNLDTENPIDKSNFTEKYFINILRENKILKIILG 1827
            ++++D N Y     +T   IQ +  ++N I   YL +     +  +E+W +N LI + QE   +L     +K  ++   + HD +HLF+  +Y  T  G A   T+C   +C    V+S ++ ++   A+ ++HE+ HN G+ HD S C C   +CIMA    + S    +S+CS  ++ S++       S L   P  +  K     P M                 VE GE+CDCG    C  + CC+   C     +QCA G CC    C+   TGT+CR     CDL E+CNG    CP D+++ DG  C    + + +C+  +C     QCR ++G  S  +   CY E       F NCG     ND + +        + C  ++ +CGR+ C    E V+Q+   +++    +T  +N  C  + +       D+G V DG  CG   +C +  CV    +  ++C    C   G+C N+  C C   + PP+C  R    S  S  P         P+  SN++  YF+       I+  +LG
Sbjct:  212 FVVIDHNRYVHRNNNTTTCIQDMLQVVNGINGYYLQIQTDVVLTKLEVWSQNNLINVEQEIRKVLGAFCNWKINAIGNRVRHDIIHLFVRRSYG-TYLGLANVGTVCLTLNCA---VNSFLSDSLSDMAFIIAHEMGHNLGMMHDGSSCTCGLSSCIMA---PYKSNSPKFSNCSYEEMFSVVTK----RSCLYDIPDAL--KTINLMPTMCGNNL------------VEEGEECDCGSTESCLQDPCCSS-DCVLKPGAQCAFGLCCKN--CQFLKTGTVCREEKNECDLPEWCNGTSAECPGDVYKADGIPC----SGEGYCYKMECHQRDEQCRKIFGNGSRSADEICYMEMNRRGDRFGNCG-----NDSSMY--------RRCNLADVLCGRIQC----ENVIQLPQRRNHETVHYTHFSNVTCWTTDYHFGITIDDVGAVSDGTTCGPDYLCVHRKCVS-KSVLVRNCTPQLCHMQGVCNNKDHCHCNNTWEPPDCQLRGHGGSIDSGPPPV-------PLSPSNWS-MYFLAF-----IIMYVLG 700          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Mouse
Match: Adam9 (a disintegrin and metallopeptidase domain 9 (meltrin gamma) [Source:MGI Symbol;Acc:MGI:105376])

HSP 1 Score: 194.897 bits (494), Expect = 4.823e-52
Identity = 155/524 (29.58%), Postives = 240/524 (45.80%), Query Frame = 1
Query:  205 QLQIFTLYLIVDSNLYQ---QSQESTENRIQSIFILINKIYLPLGIQFQIICIEIWKE-NLIEI-SQEEYILEELKIYKTKSV--NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTV-DSITQNIKYTAYTVSHELAHNFGLTHDTSD---CGCENCIMATGVEFSSRKLDWSSCSISQIKSL-LKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCE--KCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQI-GLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCV---PLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPY 1722
            Q +   L+++VD   Y    ++Q +    +  +   ++ +Y+ L I+  ++ +EIW + N I I      +L     ++ K +     HD   L L   +  T  G A   T+CS+S   G  V   IT  ++  A  V+HEL HN G+ HD      CG ++CIM +G   +S   ++SSCS    + L L  G  C   L   P                K   + +   CGN +V+ GE+CDCG   +CE   CC   TCK  + ++CA G CC    C+  P G++CR  T+ CD+ EYCNG  + CP D+F Q+G  C    N+KA+C+ G C+ +  QC+ ++G  +  +   C+ E   +   F NCG             F     K C   N++CG+L C  +N + M + G+  +   T      C    F++  +  D GMV +G  C    +C N  CV    L+   D    C  +G+C + K C C   + PP+C  +    S  S   Y
Sbjct:  210 QTRYVELFIVVDKERYDMMGRNQTAVREEMIRLANYLDSMYIMLNIRIVLVGLEIWTDRNPINIIGGAGDVLGNFVQWREKFLITRWRHDSAQLVLKKGFGGT-AGMAFVGTVCSRSHAGGINVFGQIT--VETFASIVAHELGHNLGMNHDDGRECFCGAKSCIMNSG---ASGSRNFSSCSAEDFEKLTLNKGGSC---LLNIP----------------KPDEAYSAPSCGNKLVDPGEECDCGTAKECEVDPCCEGSTCKLKSFAECAYGDCCKD--CQFLPGGSMCRGKTSECDVPEYCNGSSQFCPPDVFIQNGYPCQ---NSKAYCYNGMCQYYDAQCQVIFGSKAKAAPRDCFIEVNSKGDRFGNCG-------------FSGSEYKKCATGNALCGKLQC--ENVQDMPVFGIVPAIIQTPSRGTKCWGVDFQLGSDVPDPGMVNEGTKCDAGKICRNFQCVNASVLNYDCDIQGKCHGHGVCNSNKNCHCEDGWAPPHCDTKGYGGSVDSGPTY 688          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Mouse
Match: Adam9 (a disintegrin and metallopeptidase domain 9 (meltrin gamma) [Source:MGI Symbol;Acc:MGI:105376])

HSP 1 Score: 194.512 bits (493), Expect = 6.531e-52
Identity = 155/524 (29.58%), Postives = 240/524 (45.80%), Query Frame = 1
Query:  205 QLQIFTLYLIVDSNLYQ---QSQESTENRIQSIFILINKIYLPLGIQFQIICIEIWKE-NLIEI-SQEEYILEELKIYKTKSV--NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTV-DSITQNIKYTAYTVSHELAHNFGLTHDTSD---CGCENCIMATGVEFSSRKLDWSSCSISQIKSL-LKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCE--KCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQI-GLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCV---PLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPY 1722
            Q +   L+++VD   Y    ++Q +    +  +   ++ +Y+ L I+  ++ +EIW + N I I      +L     ++ K +     HD   L L   +  T  G A   T+CS+S   G  V   IT  ++  A  V+HEL HN G+ HD      CG ++CIM +G   +S   ++SSCS    + L L  G  C   L   P                K   + +   CGN +V+ GE+CDCG   +CE   CC   TCK  + ++CA G CC    C+  P G++CR  T+ CD+ EYCNG  + CP D+F Q+G  C    N+KA+C+ G C+ +  QC+ ++G  +  +   C+ E   +   F NCG             F     K C   N++CG+L C  +N + M + G+  +   T      C    F++  +  D GMV +G  C    +C N  CV    L+   D    C  +G+C + K C C   + PP+C  +    S  S   Y
Sbjct:  210 QTRYVELFIVVDKERYDMMGRNQTAVREEMIRLANYLDSMYIMLNIRIVLVGLEIWTDRNPINIIGGAGDVLGNFVQWREKFLITRWRHDSAQLVLKKGFGGT-AGMAFVGTVCSRSHAGGINVFGQIT--VETFASIVAHELGHNLGMNHDDGRECFCGAKSCIMNSG---ASGSRNFSSCSAEDFEKLTLNKGGSC---LLNIP----------------KPDEAYSAPSCGNKLVDPGEECDCGTAKECEVDPCCEGSTCKLKSFAECAYGDCCKD--CQFLPGGSMCRGKTSECDVPEYCNGSSQFCPPDVFIQNGYPCQ---NSKAYCYNGMCQYYDAQCQVIFGSKAKAAPRDCFIEVNSKGDRFGNCG-------------FSGSEYKKCATGNALCGKLQC--ENVQDMPVFGIVPAIIQTPSRGTKCWGVDFQLGSDVPDPGMVNEGTKCDAGKICRNFQCVNASVLNYDCDIQGKCHGHGVCNSNKNCHCEDGWAPPHCDTKGYGGSVDSGPTY 688          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. UniProt/SwissProt
Match: sp|Q13443|ADAM9_HUMAN (Disintegrin and metalloproteinase domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ADAM9 PE=1 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 6.173e-54
Identity = 154/530 (29.06%), Postives = 242/530 (45.66%), Query Frame = 1
Query:  205 QLQIFTLYLIVDSNLYQQSQESTENRIQSIFILIN---KIYLPLGIQFQIICIEIWKE-NLIEI-SQEEYILEELKIYKTKSV--NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTV-DSITQNIKYTAYTVSHELAHNFGLTHDTS---DCGCENCIMATGVEFSSRKLDWSSCSISQIKSL-LKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCE--KCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSC----HCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPYTRNLDT 1740
            Q +   L+++VD   Y     +     + + +L N    +Y+ L I+  ++ +EIW   NLI I      +L     ++ K +     HD   L L   +  T  G A   T+CS+S   G  V   IT  ++  A  V+HEL HN G+ HD      CG ++CIM +G   +S   ++SSCS    + L L  G  C  ++ + P   +       P   +K             +V+ GE+CDCG   +CE   CC   TCK  + ++CA G CC    C+  P GT+CR  T+ CD+ EYCNG  + C  D+F Q+G  C    NNKA+C+ G C+ +  QC+ ++G  +  +   C+ E   +   F NCG             F     K C   N++CG+L C  + +++   G+  +   T      C    F++  +  D GMV +G  CG   +C N  CV    + +  C     C  +G+C + K C C   + PPNC E +    ++ + P    ++T
Sbjct:  210 QTRYVELFIVVDKERYDMMGRNQTAVREEMILLANYLDSMYIMLNIRIVLVGLEIWTNGNLINIVGGAGDVLGNFVQWREKFLITRRRHDSAQLVLKKGFGGT-AGMAFVGTVCSRSHAGGINVFGQIT--VETFASIVAHELGHNLGMNHDDGRDCSCGAKSCIMNSG---ASGSRNFSSCSAEDFEKLTLNKGGNCLLNIPK-PDEAY-----SAPSCGNK-------------LVDAGEECDCGTPKECELDPCCEGSTCKLKSFAECAYGDCCKD--CRFLPGGTLCRGKTSECDVPEYCNGSSQFCQPDVFIQNGYPCQ---NNKAYCYNGMCQYYDAQCQVIFGSKAKAAPKDCFIEVNSKGDRFGNCG-------------FSGNEYKKCATGNALCGKLQC-ENVQEIPVFGIVPAIIQTPSRGTKCWGVDFQLGSDVPDPGMVNEGTKCGAGKICRNFQCVDAS-VLNYDCDVQKKCHGHGVCNSNKNCHCENGWAPPNC-ETKGYGGSVDSGPTYNEMNT 693          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. UniProt/SwissProt
Match: sp|Q9UKQ2|ADA28_HUMAN (Disintegrin and metalloproteinase domain-containing protein 28 OS=Homo sapiens OX=9606 GN=ADAM28 PE=1 SV=3)

HSP 1 Score: 199.904 bits (507), Expect = 2.956e-53
Identity = 144/503 (28.63%), Postives = 228/503 (45.33%), Query Frame = 1
Query:  226 YLIVDSN---LYQQSQESTENRIQSIFILINKIYLPLGIQFQIICIEIW--KENLIEISQEEYILEELKIYKTK--SVNINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCEN--CIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCEK-CCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDK---SCHCFNNGICTNQKKCQCFQQYLPPNCSERQTI 1695
            YL++D+     Y ++Q+    R+  +   +N +Y  L     ++ +EIW  K+ +       + LE    ++    S    HD   L   +    T  G A  +TMCS  S VG   D  + N+   A T++HE+ HNFG+ HD   C C +  C+M   + F     D+SSCS        +         A  PT I        P+  ++             +VE GE CDCG   +C   CC+  TCK  A  QCA G CC  E C+    G +CR +   CDL E CNG+  NCP D F+ +G  C    + K HC  G C     QC  LWG  + ++  SCY+ N E    +  C        +   D+ +     PC+ ++++CG+L+C          G S +  +  +   F     F+ +  +++IGMV +G  CG+  VC N +CV ++  +     S  C  + +C ++ +CQC + ++PP+C +   +
Sbjct:  209 YLVLDNGEFKRYNENQDEIRKRVFEMANYVNMLYKKLNTHVALVGMEIWTDKDKIKITPNASFTLENFSKWRGSVLSRRKRHDIAQLITATELAGTTVGLAFMSTMCSPYS-VGVVQDH-SDNLLRVAGTMAHEMGHNFGMFHDDYSCKCPSTICVMDKALSFYI-PTDFSSCSRLSYDKFFEDKLSNCLFNAPLPTDII-----STPICGNQ-------------LVEMGEDCDCGTSEECTNICCDAKTCKIKATFQCALGECC--EKCQFKKAGMVCRPAKDECDLPEMCNGKSGNCPDDRFQVNGFPC---HHGKGHCLMGTCPTLQEQCTELWGPGTEVADKSCYNRN-EGGSKYGYC--------RRVDDTLI-----PCKANDTMCGKLFC---------QGGSDNLPWKGRIVTFLTCKTFDPEDTSQEIGMVANGTKCGDNKVCINAECVDIEKAYKSTNCSSKCKGHAVCDHELQCQCEEGWIPPDCDDSSVV 662          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. UniProt/SwissProt
Match: sp|Q9XSL6|ADA28_MACFA (Disintegrin and metalloproteinase domain-containing protein 28 OS=Macaca fascicularis OX=9541 GN=ADAM28 PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 6.171e-53
Identity = 142/503 (28.23%), Postives = 227/503 (45.13%), Query Frame = 1
Query:  226 YLIVDSN---LYQQSQESTENRIQSIFILINKIYLPLGIQFQIICIEIW-KENLIEISQ-EEYILEELKIYKTKSV--NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCEN--CIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCEK-CCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDK---SCHCFNNGICTNQKKCQCFQQYLPPNCSERQTI 1695
            YL++D+     Y ++Q+    R+  +   +N +Y  L     ++ +EIW  E+ I I+    + LE    ++   +     HD   L   + +     G A  +TMCS    VG   D  + N+   A T++HE+ HNFG+ HD   C C +  C+M   + F     D+SSCS        +         A  PT I        P+  ++             +VE GE CDCG   +C   CC+  TCK  A  QC SG CC  E C+    G +CR +   CDL E C+G+  NCP D FR +G  C    + K +C  G C     QC  LWG  + ++  SCY+ N E    +  C        +   D+ +     PC+ ++++CG+L+C          G S +  +  +   F     F+ +  + +IGMV +G  CG+  VC N +CV ++  +     S  C  + +C ++ +CQC + + PP+C +   +
Sbjct:  209 YLVLDNGEFKKYNENQDEIRKRVFEMANYVNMLYKKLNTHVALVGMEIWTDEDKINITPNASFTLENFSKWRGSVLPRRKRHDIAQLITATEFAGMTVGLAFMSTMCSPYHSVGVVQDH-SDNLLRVAGTMAHEMGHNFGMFHDNYSCKCPSTICVMDKALSFYI-PTDFSSCSRVSYDKFFEDKLSNCLFNAPLPTDII-----STPICGNQ-------------MVEMGEDCDCGTSEECTNICCDAKTCKIKAGFQCTSGECC--EKCQFKKAGMVCRPAKDECDLPEMCDGKSGNCPDDRFRANGFPC---HHGKGYCLMGACPTLQEQCTELWGPGTKVADQSCYNRN-EGGSKYGYC--------RRVDDTLI-----PCKTNDTMCGKLFC---------QGGSDNLPWKGRIVTFLTCKTFDPEDTSEEIGMVANGTKCGHNKVCINAECVDIEKAYKSTNCSSKCKGHAVCDHELQCQCEEGWSPPDCDDSSVV 663          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. UniProt/SwissProt
Match: sp|Q61072|ADAM9_MOUSE (Disintegrin and metalloproteinase domain-containing protein 9 OS=Mus musculus OX=10090 GN=Adam9 PE=1 SV=2)

HSP 1 Score: 194.897 bits (494), Expect = 3.374e-51
Identity = 155/524 (29.58%), Postives = 240/524 (45.80%), Query Frame = 1
Query:  205 QLQIFTLYLIVDSNLYQ---QSQESTENRIQSIFILINKIYLPLGIQFQIICIEIWKE-NLIEI-SQEEYILEELKIYKTKSV--NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTV-DSITQNIKYTAYTVSHELAHNFGLTHDTSD---CGCENCIMATGVEFSSRKLDWSSCSISQIKSL-LKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCE--KCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQI-GLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCV---PLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPY 1722
            Q +   L+++VD   Y    ++Q +    +  +   ++ +Y+ L I+  ++ +EIW + N I I      +L     ++ K +     HD   L L   +  T  G A   T+CS+S   G  V   IT  ++  A  V+HEL HN G+ HD      CG ++CIM +G   +S   ++SSCS    + L L  G  C   L   P                K   + +   CGN +V+ GE+CDCG   +CE   CC   TCK  + ++CA G CC    C+  P G++CR  T+ CD+ EYCNG  + CP D+F Q+G  C    N+KA+C+ G C+ +  QC+ ++G  +  +   C+ E   +   F NCG             F     K C   N++CG+L C  +N + M + G+  +   T      C    F++  +  D GMV +G  C    +C N  CV    L+   D    C  +G+C + K C C   + PP+C  +    S  S   Y
Sbjct:  210 QTRYVELFIVVDKERYDMMGRNQTAVREEMIRLANYLDSMYIMLNIRIVLVGLEIWTDRNPINIIGGAGDVLGNFVQWREKFLITRWRHDSAQLVLKKGFGGT-AGMAFVGTVCSRSHAGGINVFGQIT--VETFASIVAHELGHNLGMNHDDGRECFCGAKSCIMNSG---ASGSRNFSSCSAEDFEKLTLNKGGSC---LLNIP----------------KPDEAYSAPSCGNKLVDPGEECDCGTAKECEVDPCCEGSTCKLKSFAECAYGDCCKD--CQFLPGGSMCRGKTSECDVPEYCNGSSQFCPPDVFIQNGYPCQ---NSKAYCYNGMCQYYDAQCQVIFGSKAKAAPRDCFIEVNSKGDRFGNCG-------------FSGSEYKKCATGNALCGKLQC--ENVQDMPVFGIVPAIIQTPSRGTKCWGVDFQLGSDVPDPGMVNEGTKCDAGKICRNFQCVNASVLNYDCDIQGKCHGHGVCNSNKNCHCEDGWAPPHCDTKGYGGSVDSGPTY 688          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. UniProt/SwissProt
Match: sp|O43506|ADA20_HUMAN (Disintegrin and metalloproteinase domain-containing protein 20 OS=Homo sapiens OX=9606 GN=ADAM20 PE=2 SV=2)

HSP 1 Score: 191.43 bits (485), Expect = 1.658e-50
Identity = 158/537 (29.42%), Postives = 241/537 (44.88%), Query Frame = 1
Query:  223 LYLIVDSNLYQQSQESTENRIQSIFILINKI---YLPLGIQFQIICIEIW-KENLIEISQE-EYILEELKIYKTKSVN--INHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCE--NCIMATGVEFSSRKLDWSSCSISQ-----IKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCEK--CCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQF------CEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSCH---CFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPYTRNLDTENPIDK 1758
            L ++VD+  Y  SQ +       +F ++N +   Y PL +   +  I+IW   N +  S + + +LE+  I+K  ++N  + HD  HLF+       + G A    +C      G  V    + + + A T+ HEL HN G+ HDT  C CE   CIM    + +++   +S+CS +Q     I S L +  P       +P  IF                   +  CGN +VE GE+CDCG    C K  CC  L C     + CA G CC    CK  P+GT+CR     CDL E+CNG    CP D++ QDG  C    N  A C+   C +H  QC+ ++GQ +  +  SCY E   + + F +CG++ T    TY           C   + +CGR+ C         +G+  +    +   QF      C  + + +     DIG V DG VCG + +C    C  +  +  ++C    C   GIC N++ C C  ++ PP C ++    S  S  P   N++  N + K
Sbjct:  211 LVVVVDNIRYLFSQSNATTVQHEVFNVVNIVDSFYHPLEVDVILTGIDIWTASNPLPTSGDLDNVLEDFSIWKNYNLNNRLQHDVAHLFIKDTQGM-KLGVAYVKGICQNPFNTGVDVFEDNRLVVF-AITLGHELGHNLGMQHDTQWCVCELQWCIMHAYRKVTTK---FSNCSYAQYWDSTISSGLCIQPP------PYPGNIF------------------RLKYCGNLVVEEGEECDCGTIRQCAKDPCC-LLNCTLHPGAACAFGICCKD--CKFLPSGTLCRQQVGECDLPEWCNGTSHQCPDDVYVQDGISC----NVNAFCYEKTCNNHDIQCKEIFGQDARSASQSCYQEINTQGNRFGHCGIVGT----TYVK---------CWTPDIMCGRVQC-------ENVGVIPNLIEHSTVQQFHLNDTTCWGTDYHLGMAIPDIGEVKDGTVCGPEKICIRKKCASMVHL-SQACQPKTCNMRGICNNKQHCHCNHEWAPPYCKDKGYGGSADSGPPPKNNMEGLNVMGK 690          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. TrEMBL
Match: A0A564YGG3 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5673 PE=4 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 1.248e-99
Identity = 200/579 (34.54%), Postives = 286/579 (49.40%), Query Frame = 1
Query:  196 NKNQLQIFTLYLIVDSNL---YQQSQESTENRIQSIFILINKIYLPLGIQFQIICIEIWKENLIEISQEEYILEELKIYKTKSVNINHDCLHLFLGSN-YFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGF-------PCHSHLAQFP---------------TTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCEK----CCNFLTCKFSANSQCASGSCCNTE---------ICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCY------DENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQK-SNSICGRLWCIHDNEKVMQIGLSKS-YSFTTKTNQFCEASRFE------------------VDWNN-----RDIGMVPDGAVCGNKMVCSNGDCVPLDG-IFDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSP 1719
             +N   I  LY++ D      +         R+ +IF ++N ++    +QF I+ +EIW++N + +  E++ L  L  +K   VN  HDCL   LG +    T +GRA    MC  SSCV +  DS+   +  TA T +HEL H FGL HDT DC C+ CIMATGVEF +  ++WS CSI  + +LL+ G        P  SH +  P               T   +   R  P +      S+ +S+CGNG ++ GE+CDCG R  C K    CC+  TCKF   ++CASG CC+ +         ICKL  +GT+CR+    CDL EYC+GQ E CP D+F+ DG  C TK   +++C  G C      CR LWG T   +   C       D N++      NCG +   +D+ +      WP+KPC    ++ CGRLWC+H NEK M +G  +S       T + C A  ++                    W++     +D GM PDG  C  + +C NG C+  D  +F K+C+C +NG+C N   C C   Y PP+C ++    S  S  P
Sbjct:  101 GENAPYIVELYVVTDEKFISSFSHDIAQVVTRVNNIFKVVNSLFSRFNVQFVIVGLEIWEKNRVNLEAEDHFLRTLASFKRTEVNTRHDCLFAILGDDDQTSTTRGRANSQVMCKYSSCVSFVRDSLYMEVNDTARTAAHELGHTFGLRHDTEDCECQGCIMATGVEFGTATMEWSPCSIRDMPNLLRFGMGACLHDIPVQSHTSLLPRQLRLIDVNGPSSIHTYTVINTQRGTPELLQSTPLSLKMSLCGNGKLDPGEECDCGTRETCPKEVRACCDVTTCKFREGAECASGPCCDIQTVSGDPSKTICKLKASGTVCRDVGNSCDLPEYCDGQSEWCPADVFKTDGETCYTKEGYRSNCIRGGCNAPDEWCRVLWGPTGTAAGPGCIGYNLIRDPNSQSIDEVANCGRLRPRSDERW-KEIDQWPSKPCYDWPDAECGRLWCMHRNEKAMLLGWQESQRRVDPHTQRTCVALVYDPLDPLQHAEITSQTGFPGPGWDHTASVTQDAGMTPDGTPC-QRGLCYNGSCISRDELLFRKTCNCNSNGVCNNLGHCHCNIGYAPPDCVKKGNGGSIDSGPP 677          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. TrEMBL
Match: A0A564YET5 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5673 PE=4 SV=1)

HSP 1 Score: 337.421 bits (864), Expect = 1.953e-99
Identity = 200/579 (34.54%), Postives = 286/579 (49.40%), Query Frame = 1
Query:  196 NKNQLQIFTLYLIVDSNL---YQQSQESTENRIQSIFILINKIYLPLGIQFQIICIEIWKENLIEISQEEYILEELKIYKTKSVNINHDCLHLFLGSN-YFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGF-------PCHSHLAQFP---------------TTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCEK----CCNFLTCKFSANSQCASGSCCNTE---------ICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCY------DENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQK-SNSICGRLWCIHDNEKVMQIGLSKS-YSFTTKTNQFCEASRFE------------------VDWNN-----RDIGMVPDGAVCGNKMVCSNGDCVPLDG-IFDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSP 1719
             +N   I  LY++ D      +         R+ +IF ++N ++    +QF I+ +EIW++N + +  E++ L  L  +K   VN  HDCL   LG +    T +GRA    MC  SSCV +  DS+   +  TA T +HEL H FGL HDT DC C+ CIMATGVEF +  ++WS CSI  + +LL+ G        P  SH +  P               T   +   R  P +      S+ +S+CGNG ++ GE+CDCG R  C K    CC+  TCKF   ++CASG CC+ +         ICKL  +GT+CR+    CDL EYC+GQ E CP D+F+ DG  C TK   +++C  G C      CR LWG T   +   C       D N++      NCG +   +D+ +      WP+KPC    ++ CGRLWC+H NEK M +G  +S       T + C A  ++                    W++     +D GM PDG  C  + +C NG C+  D  +F K+C+C +NG+C N   C C   Y PP+C ++    S  S  P
Sbjct:  101 GENAPYIVELYVVTDEKFISSFSHDIAQVVTRVNNIFKVVNSLFSRFNVQFVIVGLEIWEKNRVNLEAEDHFLRTLASFKRTEVNTRHDCLFAILGDDDQTSTTRGRANSQVMCKYSSCVSFVRDSLYMEVNDTARTAAHELGHTFGLRHDTEDCECQGCIMATGVEFGTATMEWSPCSIRDMPNLLRFGMGACLHDIPVQSHTSLLPRQLRLIDVNGPSSIHTYTVINTQRGTPELLQSTPLSLKMSLCGNGKLDPGEECDCGTRETCPKEVRACCDVTTCKFREGAECASGPCCDIQTVSGDPSKTICKLKASGTVCRDVGNSCDLPEYCDGQSEWCPADVFKTDGETCYTKEGYRSNCIRGGCNAPDEWCRVLWGPTGTAAGPGCIGYNLIRDPNSQSIDEVANCGRLRPRSDERW-KEIDQWPSKPCYDWPDAECGRLWCMHRNEKAMLLGWQESQRRVDPHTQRTCVALVYDPLDPLQHAEITSQTGFPGPGWDHTASVTQDAGMTPDGTPC-QRGLCYNGSCISRDELLFRKTCNCNSNGVCNNLGHCHCNIGYAPPDCVKKGNGGSIDSGPP 677          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. TrEMBL
Match: A0A068WBY2 (Subfamily M12B unassigned peptidase OS=Echinococcus granulosus OX=6210 GN=EgrG_000832900 PE=4 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 1.897e-95
Identity = 199/572 (34.79%), Postives = 277/572 (48.43%), Query Frame = 1
Query:  214 IFTLYLIVDSNL---YQQSQESTENRIQSIFILINKIYLPLGIQFQIICIEIWKENLIEISQEEYILEELKIYKTKSVNINHDCLHLFLG-SNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGF-------PCHSHLAQFP---------------TTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCEK----CCNFLTCKFSANSQCASGSCCNTE---------ICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSC--YDENTEENHA---FKNCGLMVTLNDKTYFDSFLDWPTKPCQK-SNSICGRLWCIHDNEKVMQIGLSK------------------------SYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGI-FDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSP 1719
            I  LY++VD      +         R+ SIF  +N ++    +Q  I+ +EIW++N + +  EE+ L+ L  +K   VN+ HDCL   LG ++     +GRA    MC  SSCV +  DS    +  TA T +HEL HNFGL HDT +C C+ CIMATGVEF +   +WS CSI  + +LL  G        P HSH +  P               T   +   R  P +     +S+  S+CGNG ++ GE+CDCG    C K    CC+  TC   A ++CA+G CC+ +         ICKL  +G++CR +   CDL EYC+G  E CP D+F+ DG  C TK   K+HC  G C      CR LWG T   +   C  Y+   ++NHA     NCG +    D+ + +    WP+K C   +++ CGRLWC H NEK M +G  +                         +S TT    F      +     +D GM PDG  C  + +C NG C+  D + F K C+C  NG+C N   C C   Y PP+C+E     S  S  P
Sbjct:  147 IVELYVVVDEKFVSSFSHDVVQIVTRVNSIFQAVNGLFAQFNVQLIIVGLEIWEKNRVNLEAEEHFLKTLASFKRTEVNVRHDCLFALLGDTDQASNTRGRANREVMCKHSSCVSFVRDSQYMEVNETARTAAHELGHNFGLRHDTENCECQGCIMATGVEFGTATTEWSPCSIRDMPNLLHYGMGACLHDVPVHSHTSLLPRQTRLLEVNGPSVIHTYTAMNTRRGTPELFQSTPTSLKRSLCGNGKLDPGEECDCGTADTCPKEVQACCDVKTCSLLAGAECATGPCCDIQSAFGDPSHTICKLKQSGSVCREAGNSCDLPEYCDGGSEWCPADVFKTDGEVCYTKEGYKSHCIRGGCNAPDEWCRVLWGPTGTAAGPGCVAYNMMRDDNHAVDKVANCGRLRPRGDERWRE-MDQWPSKACSDWADAECGRLWCTHRNEKAMLLGWQEQQPRMEPHSQRTCVALVYDPPDPLQHSETTPETGFFGPGWGDAASVTQDAGMTPDGTPC-QRGLCYNGTCIRRDQLPFRKMCNCNYNGVCNNLGHCHCNIGYAPPDCTESGNGGSVDSGPP 716          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. TrEMBL
Match: A0A068Y7H4 (Subfamily M12B unassigned peptidase OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000832900 PE=4 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 2.247e-95
Identity = 198/572 (34.62%), Postives = 278/572 (48.60%), Query Frame = 1
Query:  214 IFTLYLIVDSNL---YQQSQESTENRIQSIFILINKIYLPLGIQFQIICIEIWKENLIEISQEEYILEELKIYKTKSVNINHDCLHLFLG-SNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGF-------PCHSHLAQFP---------------TTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCEK----CCNFLTCKFSANSQCASGSCCNTE---------ICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSC--YDENTEENHA---FKNCGLMVTLNDKTYFDSFLDWPTKPCQK-SNSICGRLWCIHDNEKVMQIGLSK------------------------SYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGI-FDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSP 1719
            I  LY++VD      +         R+ SIF  +N ++    +Q  I+ +EIW++N + +  EE+ L+ L  +K   VN+ HDCL   LG ++     +GRA    MC  SSCV +  DS    +  TA T +HEL HNFGL HDT +C C+ CIMATGVEF +  ++WS CS+  + +LL  G        P HSH +  P               T   +   R  P +     +S+  S+CGNG ++ GE+CDCG    C K    CC+  TC   A ++CA+G CC+ +         ICKL  +G++CR +   CDL EYC+G  E CP D+F+ DG  C TK   K+HC  G C      CR LWG T   +   C  Y+   ++NHA     NCG +    D+ + +    WP+K C   +++ CGRLWC H NEK M +G  +                         +S TT    F      +     +D GM PDG  C  + +C NG C+  D + F K C+C  NG+C N   C C   Y PP+C+E     S  S  P
Sbjct:  147 IVELYVVVDEKFVSSFSHDVVQIVTRVNSIFQAVNALFAQFNVQLIIVGLEIWEKNRVNLEAEEHFLKTLASFKRTEVNVRHDCLFALLGDTDQASNTRGRANREVMCKYSSCVSFVRDSQYMEVNETARTAAHELGHNFGLRHDTENCECQGCIMATGVEFGTATMEWSLCSVRDMPNLLHYGMGACLHDVPVHSHTSLLPRQTRLLEVNGPSVIHTYTAMNTRRGTPELFQSTPTSLKRSLCGNGKLDPGEECDCGTADTCPKEVQACCDVKTCSLLAGAECATGPCCDIQSAFGDPSHAICKLKQSGSVCREAGNSCDLPEYCDGGSEWCPADVFKTDGEVCYTKEGYKSHCIRGGCNAPDEWCRVLWGPTGTAAGPGCVAYNMMRDDNHAVDKVANCGRLRPRGDERWRE-MDQWPSKACSDWADAECGRLWCTHQNEKAMLLGWQEQQPRMEPHSQRTCVALVYDPPDPLQHSETTPETGFFGPGWGDAASVTQDAGMTPDGTPC-QRGLCYNGTCIRRDQLPFRKMCNCNYNGVCNNLGHCHCNIGYAPPDCTESGNGGSVDSGPP 716          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. TrEMBL
Match: A0A0R3W144 (Uncharacterized protein OS=Taenia asiatica OX=60517 PE=4 SV=2)

HSP 1 Score: 315.464 bits (807), Expect = 1.330e-91
Identity = 195/600 (32.50%), Postives = 283/600 (47.17%), Query Frame = 1
Query:  214 IFTLYLIVDSNL---YQQSQESTENRIQSIFILINKIYLPLGIQFQIICIEIWKENLIEISQEEYILEELKIYKTKSVNINHDCLHLFLG-SNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGF-------PCHSHLAQFP---------------TTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCEK----CCNFLTCKFSANSQCASGSCCNTE---------ICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSC--YDENTEENHAF---KNCGLMVTLNDKTYFDSFLDWPTKPC-------------------------QKSNSICGRLWCIHDNEKVMQIGLSK------------------------SYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVC----GNKMVCSNGDCVPLDGI-FDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSP 1719
            I  LY+++D      +         R+ SIF ++N ++    +QF I+ +EIW++N + +  EE+ L+ L  +K   VN+ HDCL   LG ++     +GRA    MC  SSCV +  DS    +  TA T +HEL HNFGL HDT +C C+ C+MATGVEF +  ++WS CSI  + +LL  G        P HSH +  P               T   +   R  P +     +S+  S+CGNG ++ GE CDCG    C K    CC+  TC   A ++CA+G CC+ +          CK+  +G++CR +   CDL EYC+G+ E CP D+F+ DG  C T+   K+HC  G+C      CR LWG T + +   C  Y+   ++NHA     NCG +   +D+ + +    WP+K C                          ++++ CGRLWC H NEK M IG  +                         +S TT    F      +     +D GM PDGA C    G+    S  +  P D + F K+C+C  NG+C N   C C   Y PP+C++     S  S  P
Sbjct:   61 IVELYVVIDEKFVSSFSHDVVQIVTRVNSIFQIVNALFSQFNVQFVIVGLEIWEKNRVNLEAEEHFLKTLASFKRTEVNVRHDCLFALLGDTDQTSNTRGRANREVMCKYSSCVSFVRDSQYMEVNETARTAAHELGHNFGLRHDTENCECQGCVMATGVEFGTATMEWSPCSIRDMPNLLHYGMGACLHDAPVHSHASLLPRQTRLLEVNGPSVIRTYTAMNTRRGTPELFQSTPASLKRSLCGNGKLDPGEDCDCGTVDTCPKEVQACCDVKTCSLLAGAECATGPCCDIQSVFGDPSHTTCKIKQSGSVCRKAGNSCDLPEYCSGESEWCPADVFKTDGEVCYTQEGYKSHCIRGRCNAPDEWCRVLWGPTGSAAGPGCVGYNVMRDDNHAIDKVANCGRLRPRDDERWRE-MDQWPSKACNDWQVPFTTSHHAYPAVLACNTFCLSQADAECGRLWCTHRNEKAMLIGWQEQQPRVDPHSQRTCVALVYDPLDPLQHSETTPETGFVGPGWGDAASVTQDAGMTPDGAPCQRGVGSPSCMSGFNASPRDDLPFRKTCNCNYNGVCNNLGHCHCNIGYAPPDCTKSGNGGSIDSGPP 659          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Cavefish
Match: adam28 (zinc metalloproteinase-disintegrin-like batroxstatin-3 [Source:NCBI gene;Acc:103039670])

HSP 1 Score: 202.986 bits (515), Expect = 2.691e-55
Identity = 156/532 (29.32%), Postives = 249/532 (46.80%), Query Frame = 1
Query:  163 NANEFSIKIDRNK---------NQLQIFTLYLIVDSNLYQQSQ---ESTENRIQSIFILINKIYLPLGIQFQIICIEIWKEN--LIEISQEEYILEELKIYKTKSV--NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCEN--CIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCE-KCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDK---SCHCFNNGICTNQKKCQCFQQYLPPNCSERQT 1692
            N  +F  ++ +++          Q +   L+++ D+ +YQ+S    +  + RI  I   +N +Y P+     +  +EIW ++  ++  +     L++   ++   +     +D  HL  G ++  +  G A   T+CS  S  G   D  +  I   A T+SHE+ HN G+ HDTS C C +  CIMA  + ++  K  +SSCS+S ++  L          ++ P  +  K     P+ KS     +   +CGNG +E+GEQCDCG  ++C   CCN  TC+ +  SQCA G+CC    CK+     +CR     CDL EYC G    CP D+F  +G  C +      +CF GQC     QC  +WG  + +    C+++N          G+      +   D ++      CQK + +CG+L+C    +        +  SF T     C A+ F  D +N D G V  G  CG   VCS   CV L+  +     S  C  +G+C ++ +C C   +LPP+C ERQ 
Sbjct:  173 NTGDFPPRVSKSRARGAGPTMFQQQKYNELFIVADNRMYQKSDSNVDKVKKRIYEIINFVNAVYKPVNTFIALTGLEIWSDSDKIVVTAPAGETLDKFTTWRNDVLMKRQPNDNAHLITGIDFEGSTVGLAFIGTLCSGHS-TGVIQDHSSNAIAVGA-TLSHEMGHNLGMNHDTSSCTCPDSSCIMAPALSYTIPK-QFSSCSVSNLEQYLN---------SRNPNCLLNK-----PLQKS----LLQPPVCGNGFLESGEQCDCGSVTECSNPCCNATTCRLTEGSQCADGACCRD--CKIIDAYNMCRAKQDECDLPEYCTGDSNLCPEDVFAVNGLPCKS---GSGYCFNGQCPKKEDQCIKMWGSGAVLGTEYCFNQNAR--------GVYYAYCSRPTTDQYIG-----CQKQDVMCGKLFCEKGQDNP---NYGRMVSFGT-----CRAT-FYSDRDN-DFGQVDTGTKCGEDRVCSQNQCVTLEVAYRAINCSAKCRGHGVCNHKLECACEPGWLPPDC-ERQA 654          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Cavefish
Match: adam28 (zinc metalloproteinase-disintegrin-like batroxstatin-3 [Source:NCBI gene;Acc:103039670])

HSP 1 Score: 202.986 bits (515), Expect = 2.691e-55
Identity = 156/532 (29.32%), Postives = 249/532 (46.80%), Query Frame = 1
Query:  163 NANEFSIKIDRNK---------NQLQIFTLYLIVDSNLYQQSQ---ESTENRIQSIFILINKIYLPLGIQFQIICIEIWKEN--LIEISQEEYILEELKIYKTKSV--NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCEN--CIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCE-KCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDK---SCHCFNNGICTNQKKCQCFQQYLPPNCSERQT 1692
            N  +F  ++ +++          Q +   L+++ D+ +YQ+S    +  + RI  I   +N +Y P+     +  +EIW ++  ++  +     L++   ++   +     +D  HL  G ++  +  G A   T+CS  S  G   D  +  I   A T+SHE+ HN G+ HDTS C C +  CIMA  + ++  K  +SSCS+S ++  L          ++ P  +  K     P+ KS     +   +CGNG +E+GEQCDCG  ++C   CCN  TC+ +  SQCA G+CC    CK+     +CR     CDL EYC G    CP D+F  +G  C +      +CF GQC     QC  +WG  + +    C+++N          G+      +   D ++      CQK + +CG+L+C    +        +  SF T     C A+ F  D +N D G V  G  CG   VCS   CV L+  +     S  C  +G+C ++ +C C   +LPP+C ERQ 
Sbjct:  173 NTGDFPPRVSKSRARGAGPTMFQQQKYNELFIVADNRMYQKSDSNVDKVKKRIYEIINFVNAVYKPVNTFIALTGLEIWSDSDKIVVTAPAGETLDKFTTWRNDVLMKRQPNDNAHLITGIDFEGSTVGLAFIGTLCSGHS-TGVIQDHSSNAIAVGA-TLSHEMGHNLGMNHDTSSCTCPDSSCIMAPALSYTIPK-QFSSCSVSNLEQYLN---------SRNPNCLLNK-----PLQKS----LLQPPVCGNGFLESGEQCDCGSVTECSNPCCNATTCRLTEGSQCADGACCRD--CKIIDAYNMCRAKQDECDLPEYCTGDSNLCPEDVFAVNGLPCKS---GSGYCFNGQCPKKEDQCIKMWGSGAVLGTEYCFNQNAR--------GVYYAYCSRPTTDQYIG-----CQKQDVMCGKLFCEKGQDNP---NYGRMVSFGT-----CRAT-FYSDRDN-DFGQVDTGTKCGEDRVCSQNQCVTLEVAYRAINCSAKCRGHGVCNHKLECACEPGWLPPDC-ERQA 654          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Cavefish
Match: adam9 (ADAM metallopeptidase domain 9 [Source:NCBI gene;Acc:103021525])

HSP 1 Score: 199.519 bits (506), Expect = 8.569e-54
Identity = 147/495 (29.70%), Postives = 235/495 (47.47%), Query Frame = 1
Query:  304 INKIYLPLGIQFQIICIEIWK--ENLIEISQEEYILEELKIYKTKSV--NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSIT-QNIKYTAYTVSHELAHNFGLTHDTS-DCGCE--NCIMATGVEFSSRKLDWSSCSISQI-KSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCEK--CCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTK-TNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSC----HCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPYTRNLDT 1740
            ++ +Y+PL I+  ++ +EIW     +  +     +L     ++ K +     HD   L L   +  T  G A   T CS+S   G  +++ T +N+   A  V+HEL HN G+ HD    C C+  NCIM +G   S    ++SSCS     K +L  G  C  ++ + P   +       P   +K             +V+ GE+CDCG   +C K  CC   TCK  A ++CA G CC  + C+  P GT+CR+ST  CDL EYCNG    C  D+F+Q+G  C     ++A+C+ GQC+ + TQC+ ++G  + ++  +C+ +   +   F NCG             +  +  K C+  N++CG+L C +    V+  G+  S   T +     C    F +  +  D GMV +G  CG+  VC N +C   D + +  C     C  +G+C + K C C   + PP C E+     ++ + P   + DT
Sbjct:  251 VDSMYIPLNIRVVLVGLEIWSVMNPINTVGSAGEVLGRFTQWREKELVPRRRHDSAQLILKKGFGGT-AGMAFVGTACSRSH--GGGINAFTNKNVMSFASIVAHELGHNLGMNHDDGRSCKCDVGNCIMNSGATGSQ---NFSSCSADDFEKMILNAGGRCLLNIPR-PDEAY-----SAPFCGNK-------------LVDVGEECDCGSEEECRKDPCCEPKTCKLRAGAECAFGVCC--KHCRFLPGGTVCRSSTDECDLAEYCNGSSSLCQSDVFKQNGHPCK---QDQAYCYNGQCQHYDTQCQAIFGPKARVAPEACFKDVNSKGDRFGNCG-------------YQSYGFKRCESRNAMCGKLQCKNVQSNVI-FGIKPSIIQTPEIGGTTCWGVDFLLGSDVPDPGMVNEGTKCGDNKVCMNFECRSAD-VLNYDCDVQNKCHGHGVCNSNKNCHCDNGWEPPFC-EKAGYGGSIDSGPTWNDKDT 699          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Cavefish
Match: adam9 (ADAM metallopeptidase domain 9 [Source:NCBI gene;Acc:103021525])

HSP 1 Score: 199.134 bits (505), Expect = 8.978e-54
Identity = 147/495 (29.70%), Postives = 235/495 (47.47%), Query Frame = 1
Query:  304 INKIYLPLGIQFQIICIEIWK--ENLIEISQEEYILEELKIYKTKSV--NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSIT-QNIKYTAYTVSHELAHNFGLTHDTS-DCGCE--NCIMATGVEFSSRKLDWSSCSISQI-KSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCEK--CCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTK-TNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSC----HCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPYTRNLDT 1740
            ++ +Y+PL I+  ++ +EIW     +  +     +L     ++ K +     HD   L L   +  T  G A   T CS+S   G  +++ T +N+   A  V+HEL HN G+ HD    C C+  NCIM +G   S    ++SSCS     K +L  G  C  ++ + P   +       P   +K             +V+ GE+CDCG   +C K  CC   TCK  A ++CA G CC  + C+  P GT+CR+ST  CDL EYCNG    C  D+F+Q+G  C     ++A+C+ GQC+ + TQC+ ++G  + ++  +C+ +   +   F NCG             +  +  K C+  N++CG+L C +    V+  G+  S   T +     C    F +  +  D GMV +G  CG+  VC N +C   D + +  C     C  +G+C + K C C   + PP C E+     ++ + P   + DT
Sbjct:  251 VDSMYIPLNIRVVLVGLEIWSVMNPINTVGSAGEVLGRFTQWREKELVPRRRHDSAQLILKKGFGGT-AGMAFVGTACSRSH--GGGINAFTNKNVMSFASIVAHELGHNLGMNHDDGRSCKCDVGNCIMNSGATGSQ---NFSSCSADDFEKMILNAGGRCLLNIPR-PDEAY-----SAPFCGNK-------------LVDVGEECDCGSEEECRKDPCCEPKTCKLRAGAECAFGVCC--KHCRFLPGGTVCRSSTDECDLAEYCNGSSSLCQSDVFKQNGHPCK---QDQAYCYNGQCQHYDTQCQAIFGPKARVAPEACFKDVNSKGDRFGNCG-------------YQSYGFKRCESRNAMCGKLQCKNVQSNVI-FGIKPSIIQTPEIGGTTCWGVDFLLGSDVPDPGMVNEGTKCGDNKVCMNFECRSAD-VLNYDCDVQNKCHGHGVCNSNKNCHCDNGWEPPFC-EKAGYGGSIDSGPTWNDKDT 699          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Cavefish
Match: adam15 (ADAM metallopeptidase domain 15 [Source:NCBI gene;Acc:103046159])

HSP 1 Score: 185.652 bits (470), Expect = 8.625e-49
Identity = 140/515 (27.18%), Postives = 233/515 (45.24%), Query Frame = 1
Query:  202 NQLQIFTLYLIVDSNLYQQSQESTENRIQSIFILINKI---YLPLGIQFQIICIEIW--KENLIEISQEEYILEELKIYKTKSV--NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSD--CGCEN------CIMATGVEFSSRKLDWSSCSISQIK-SLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDC-EKCCNFLTCKFSANSQCAS-GSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQ---FCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDC--VPLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNC 1677
            ++ +   L L+ D   Y   Q + +  I  +  + N++   Y  L ++  ++ +EIW  ++ ++        L     ++T+ +   + HD   L +G ++  T  G A  ++MC+K    G  VD +  ++   A TV+HEL HN G++HDTSD  C C+N      CIM         +L +SSCS   +  SLL  G  C              + + + ++   R  ++         VE GE+CDCG   +C + CCN  TCK    +QC+S G CC  E C+L   G +CR     CDL E+C G    CP ++F Q+G  C    +  ++C+ G C     QC+ LWG  +  +   C+    +E + + NCG       +T   S++     PC  ++  CGR+ C    ++ +    ++  +   + N     C    F++     D  MV  G  C    VC +  C  V + G+ +    C  +G+C + K C C   + PP+C
Sbjct:  271 SETKYIELVLVADHKEYLNYQRNNKTIIYRMLDVANQVDWFYRTLNVRVALLGLEIWSDQDKILVDKNPTDTLNRFLEWRTRDLLPRLRHDNAQLVMGESFDGTTVGMASQSSMCTKDRSGGVNVDHLV-SVLGVASTVAHELGHNLGMSHDTSDRHCECQNEPRLGGCIMEPSTGSMPGQL-FSSCSERDLSLSLLHGGGMC-----------LFNVPQPEKLLGGPRCGNLY--------VEKGEECDCGLLDECNDPCCNASTCKLVPGAQCSSDGICC--ENCRLRVAGWMCREPLGECDLPEFCTGTSPFCPPNVFLQNGEPCQ---DGVSYCYSGVCASLDDQCQQLWGANATRAPPVCFSSVNKEGNKYGNCG-------QTANGSYI-----PCSNADVHCGRIQCQGGGDRPLLGSNAQIRTARVRLNLKNFTCRGLYFDLGDGVSDPAMVAQGTACAPGKVCLDQRCQDVSVFGVEECRDKCNGHGVCNSNKNCHCDVGWAPPHC 747          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004527.1 (pep scaffold:Pmarinus_7.0:GL476950:296064:347055:1 gene:ENSPMAG00000004117.1 transcript:ENSPMAT00000004527.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 177.563 bits (449), Expect = 1.636e-48
Identity = 138/477 (28.93%), Postives = 215/477 (45.07%), Query Frame = 1
Query:  208 LQIFTLYLIVDSNLYQQSQES---TENRIQSIFILINKIYLPLGIQFQIICIEIWKEN---LIEISQEEYILEELKIYKTKSVN-INHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSD--CGCE------NCIMA--TGVEFSSRKLDWSSCSISQI-KSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCE-KCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVM----QIGLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDC 1569
            ++   L ++ D+  Y +  +    T+ R+  +   ++K Y  L I+  ++ +E+W E+    + +     + E L   K + +    HD   L  G ++  T  G A   +MCS     G  +D     +   A T++HE+ HNFG+ HDT +  C C+       CIMA  TG  F S+   +SSCSI  +  SL K G  C   L   P    +   +R                CGNG VE+GEQCDCG+  +C+  CCN   C   A ++CA G CC  + C+L P+GT CR+ T  CDL EYCNG   +CP +++  DG  C  K   +A+C+ G C  H  QC  LWG  S  +   C+         + NCG     + K  +          C+ S+  CG++ C   + + +     + +  + +        C  +   +  +  D G+V  G  CG   +C N  C
Sbjct:   75 MKYVELIIVADNAKYNRESKDLTRTKQRMIDVANHVDKYYRSLNIRIALVGVEVWTESDRSAVTVDASSTLYEFLDWRKKQLLTRKKHDNAQLVTGISFQGTTIGMAPLMSMCSAEQSGGVNMDHAVNPVGLAA-TMAHEMGHNFGMNHDTPERRCHCQANSEQGGCIMAPSTGHPFPSK---FSSCSIRDLDSSLSKGGGMC---LYNMPDVRDLYGGKR----------------CGNGYVEDGEQCDCGEIEECDNPCCNANNCTLRAGAECAHGMCC--QDCQLKPSGTRCRDPTNTCDLPEYCNGGSPHCPPNVYLLDGYPCHGK---EAYCYNGMCLTHEQQCVTLWGSGSKPAPEICFANVNSAGDQYGNCG----KDSKAVY--------MKCKASDVKCGKIQCQGGSTRPVIGTNAVSIDTNIAVPGGGTVLCRGTHVYLGDDMLDPGLVLTGTKCGEGKICYNRHC 511          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004524.1 (pep scaffold:Pmarinus_7.0:GL476950:296055:347085:1 gene:ENSPMAG00000004117.1 transcript:ENSPMAT00000004524.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.088 bits (427), Expect = 2.147e-45
Identity = 138/504 (27.38%), Postives = 219/504 (43.45%), Query Frame = 1
Query:  208 LQIFTLYLIVDSNLYQQSQES---TENRIQSIFILINKIYLPLGIQFQIICIEIWKEN---LIEISQEEYILEELKIYKTKSVN-INHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSD--CGCE------NCIMATGVEFSSRKLDWSSCSISQI-KSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCE-KCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVM----QIGLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSCHCFNNGICTNQKKCQCFQ 1656
            ++   L ++ D+  Y +  +    T+ R+  +   ++K Y  L I+  ++ +E+W E+    + +     + E L   K + +    HD   L        T  G A   +MCS     G  +D     +   A T++HE+ HNFG+ HDT +  C C+       CIMA     + +   +SSCSI  +  SL K G  C   L   P    +   +R                CGNG VE+GEQCDCG+  +C+  CCN   C   A ++CA G CC  + C+L P+GT CR+ T  CDL EYCNG   +CP +++  DG  C  K   +A+C+ G C  H  QC  LWG  S  +   C+         + NCG     + K  +          C+ S+  CG++ C   + + +     + +  + +        C  +   +  +  D G+V  G  CG   +C N  C  +  +   +C    NG   + + C C  
Sbjct:   78 MKYVELIIVADNAKYNRESKDLTRTKQRMIDVANHVDKYYRSLNIRIALVGVEVWTESDRSAVTVDASSTLYEFLDWRKKQLLTRKKHDNAQLVT-KKRVSTTIGMAPLMSMCSAEQSGGVNMDHAVNPVGLAA-TMAHEMGHNFGMNHDTPERRCHCQANSEQGGCIMAPSTGGNDK---FSSCSIRDLDSSLSKGGGMC---LYNMPDVRDLYGGKR----------------CGNGYVEDGEQCDCGEIEECDNPCCNANNCTLRAGAECAHGMCC--QDCQLKPSGTRCRDPTNTCDLPEYCNGGSPHCPPNVYLLDGYPCHGK---EAYCYNGMCLTHEQQCVTLWGSGSKPAPEICFANVNSAGDQYGNCG----KDSKAVY--------MKCKASDVKCGKIQCQGGSTRPVIGTNAVSIDTNIAVPGGGTVLCRGTHVYLGDDMLDPGLVLTGTKCGEGKICYNRHCQNVSILKTGNCDTKCNGHGVSLQSCTCLH 540          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007858.1 (pep scaffold:Pmarinus_7.0:GL476347:375920:389428:1 gene:ENSPMAG00000007065.1 transcript:ENSPMAT00000007858.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 166.777 bits (421), Expect = 4.751e-44
Identity = 140/526 (26.62%), Postives = 231/526 (43.92%), Query Frame = 1
Query:  181 IKIDRNKNQL---QIFTLYLIVDSNLYQQSQESTE-----------NRIQSIFILINKIYLPLGIQFQIICIEIWKENLIEISQEEYILEELKIYKTKSVNIN----HDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHD---TSDCGCEN-CIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCE-KCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVP---LDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCS 1680
            + + R +N L   +   L  I+D+ LY    +S +           N + S + +++   +P+G+      +   +E  +    +       K  K +  N++    HD   L   +  F +  G A   T+C +++  G     +  ++  TA  +SHEL HN G++HD   T  C  E+ CIM   V  S     +S CS   ++ L+  G  C   L   P       + R P+   K             +++ GE+CDCG   +C+ KCC+  TC+  + ++CA GSCC    C+    G +CR +   CDL E+C+G   +CP D F Q+G  C    N  A+C+ G C+ + +QC  +WG  SN +   C+     + + F NCG   T+    Y         K C + +  CG+L C   N + +      +++F  +    C A  + +  +  D  +V  G  C + MVC N  C     L+   D +  C  +G   N K C C + + PP+CS
Sbjct:  136 VLLQRKRNVLPSTRYVELLFILDNTLYTGQYQSNKTLAVHDMAELANLVDSYYRVLDIRVVPVGVHV----LSAQEEAAVMAEGDSAGTVLGKFLKWRESNLDSMKRHDNAQLIT-ARQFQSILGMAYVGTVCLRATSGGINT-LVGSSVLMTASVLSHELGHNLGMSHDDNRTCSCAAEHGCIMGA-VMGSPPATVFSGCSEDDLEGLVN-GATC---LLNVPK---ADEALRPPVCGDK-------------MLDAGEECDCGSPEECDNKCCDARTCRLRSGARCAYGSCCKD--CQFVGQGEVCRAAQGVCDLPEFCSGSAASCPDDSFLQNGHPCQ---NAAAYCYNGVCQTYTSQCEAIWGPESNPASDECFLTVNTKGNEFGNCG---TVPSGKY---------KSCSRRDVKCGKLICESKNNQPLIGHTVPNFAFYGQ----CRAVDYNLGSDVPDPALVQSGTKCADGMVCFNQQCQDARVLNYSIDYTSICNGHGEHNNHKHCHCAEGWAPPDCS 613          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007654.1 (pep scaffold:Pmarinus_7.0:GL476707:60529:77379:-1 gene:ENSPMAG00000006905.1 transcript:ENSPMAT00000007654.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.925 bits (411), Expect = 7.229e-43
Identity = 147/519 (28.32%), Postives = 225/519 (43.35%), Query Frame = 1
Query:  229 LIVDSNLYQ----QSQESTENRIQSIFILINKIYLPLGIQFQIICIEIW--KENLIEISQEEY---ILEELKIYKTKSVNI--NHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCEN-CIMATGVEFSSRKLDWSSCSISQIKSLLKL--GFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCE-KCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDC----VPLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPYTR 1728
            L+V + LY+     ++ S    + +I  L++  Y  + I+  ++ + +   +E  + +   +    ++ +   ++  + NI   HDC HL    +Y     G A   T+CS+SS  G      T+ I   A  V+HE+ HN G++HD S C C   CIM  G+  +     +S CS    ++L+ +  G  C   L   PT        RQP+                 IV+ GE CDCG   +C   CC   TC+   N++CA G CC    CK+   G  CR S   CDL EYCNG  + C  D F Q+G  C    N+ A+C+ G C     QCR +WG  +     +CY     + + F NCG           + ++      C  +N  CG+L C +   K + +      S+     Q C A  F    +  D G+V  G  CG+  VC +  C    V +  + + +  C  +G+C N   C C   Y PP+C       S  S + Y R
Sbjct:   81 LVVGATLYKNRYNSNRSSMVTDVAAIVNLVDLDYKTINIRVVLVGLHLMTTEEQALVVQDGDAAGSVVGKFAKWRQTNYNILGRHDCGHLLTWESYGAI-VGMAYVGTICSRSSSAG-IASMPTRQIPSVAAVVAHEMGHNLGMSHDRSPCQCSTPCIMNAGL-VNPPPTAFSQCSTDDFENLILVQHGGSC---LLNVPTP---NEEFRQPVCGDS-------------IVDKGEDCDCGSPQECNNPCCEASTCRLKVNAECAYGLCCKE--CKIMGQGESCRPSVGACDLPEYCNGSSQFCYTDTFIQNGYPCQ---NSSAYCYNGVCLTLDYQCRSIWGGNAVSGSDNCYLIVNTKGNEFGNCGQGT--------NGYIT-----CTTANIKCGKLVCENTPSKPLIVDAPNFASY-----QGCNAVSFNYGTDIPDPGLVQPGTKCGSNSVCMDNQCQNATVVMGTLCNTTQKCSGHGVCNNNLNCHCNDGYAPPDCYYSGYGGSIESGNSYKR 554          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Sea Lamprey
Match: adam22 (ADAM metallopeptidase domain 22 [Source:ZFIN;Acc:ZDB-GENE-070810-1])

HSP 1 Score: 155.606 bits (392), Expect = 9.462e-40
Identity = 142/537 (26.44%), Postives = 231/537 (43.02%), Query Frame = 1
Query:  175 FSIKIDRNKN-QLQIFTLYLIVDSNLYQQSQE---STENRIQSIFILINKIYLP-LGIQFQIICIEIW-KENLIEISQEEY-ILEELKIYKTKSVNINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDC-----GCE------NCIM-ATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDC----EKCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIG--LSKSYSFTTKTNQF---CEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSC-------HCFNNGICTNQKKCQCFQQYLPPNCS 1680
            F +++ R    +++   L ++ D  ++++ ++    T N  +SI  +++ IY   L  +  ++ +E W  EN I +S +    L     Y+ +S   + D  HL  G  +  +  G A F  +CS     G  V+    N+     T++  +  N G+    S       GC+       CIM  TG     R   +S CSI + +  L+ G    + L   PT +F      QP   +               VE GE+CDCG  ++C    +KCC    C F+  + C+SG CC    C+    G  CR++   CDL E C G    CP ++ +QDG  C     ++  C+ GQCK    QC+++WG     S   CYD+   E     NCG           DS+L      C K + +CG L C + + +  Q+G     S   + + N     C      +  +  D+G V DG  CG  ++C +  C PL  +    C        C  +G+C+N+ +C C + ++  +CS
Sbjct:  123 FLVRVRREAEVEMKYVELTIVNDHIMFKKHRQILGLTNNYAKSIVNMVDAIYKEQLNTRVVLVSMETWTDENRITVSTDPLQTLRAFMKYRRQSPRTDGDTAHLLSGLMFESSHSGVAYFGGVCSLQR--GGGVNEYG-NVGAMVVTLAQGIGQNLGMLWHNSKAAARGGGCQCTDIWYGCIMEVTGQMLPMR---FSQCSIDEYQEFLQAGG--GACLFNKPTQLF-----EQPECGNG-------------FVELGEECDCGSPTECSEGWDKCCK--KCTFTHGAICSSGLCCAPNSCQFITRGEECRHAVGECDLPETCPGDSVQCPPNVHKQDGYSC---NKDQGRCYIGQCKTREKQCKYIWGDKGMSSERQCYDKLNIEGTEKGNCGRKE--------DSWLQ-----CSKHDVLCGFLLCTNVSREP-QLGELQGDSVKVSIRHNGHLLECSGGHIMLA-DGSDLGYVEDGTPCGPDVICLDHKCQPLQALNLSGCPSVIQGTACSGHGVCSNEARCVCERHWVGNDCS 613          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Nematostella
Match: EDO37129 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGQ0])

HSP 1 Score: 103.605 bits (257), Expect = 4.352e-25
Identity = 82/235 (34.89%), Postives = 108/235 (45.96%), Query Frame = 1
Query:  607 LAHNFGLTHDTSDCGC--------ENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGF-PCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCEK----CCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHA 1272
            + HN G++HD S  GC        + CIM +GV  S     WS CS    K  ++ G  PC          +F      QP+M          +ICGNG  E GE+CDCG   +C++    CCN  TCK +A S+C  G CC    CKL P G  CR   + CDL E C+G+ E CP + +  +G  C    + K  CF G C     QC  LWG         CY  N +  ++
Sbjct:    1 MGHNLGMSHDESVVGCTCEDKDVNKGCIM-SGVARSIPATKWSKCSEDSFKEFMERGLDPC----------LF-----NQPLM------LFGDAICGNGFKEEGEECDCGTAEECKRYSDDCCNSTTCKLTAGSECMDGPCCFK--CKLSPAGKECREKVSECDLPEVCDGKSELCPANRYVYNGKSC---GDGKGFCFNGVCPTLDNQCETLWGLGVTSGPEVCYTINMKGTYS 208          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Nematostella
Match: EDO37131 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGQ4])

HSP 1 Score: 81.6481 bits (200), Expect = 4.370e-18
Identity = 52/133 (39.10%), Postives = 66/133 (49.62%), Query Frame = 1
Query:  883 ENGEQCDCG---KRSDCEKCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHA 1272
            E GE+CDCG   + SD   CCN  TCK +A S+C  G CC    CKL P G  CR   + CDL E C+G+ E CP + +  +G  C    + K  CF G C     QC  LWG         CY  N +  ++
Sbjct:    8 EEGEECDCGTAERYSD--DCCNSTTCKLTAGSECMDGPCCFK--CKLSPAGKECREKVSECDLPEVCDGKSELCPANRYVYNGKSC---GDGKGFCFNGVCPTLDNQCETLWGLGVTSGPEVCYTINMKGTYS 133          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Nematostella
Match: EDO30803 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZR7])

HSP 1 Score: 61.6178 bits (148), Expect = 8.013e-10
Identity = 78/312 (25.00%), Postives = 123/312 (39.42%), Query Frame = 1
Query:  313 IYLPLGIQFQIICIEIWKENLIEISQEEYILEELKIYKTKSVNINHDCLHLFLGSNYFFTRQ-------GRAEFTT-MCSKSSCVG-----YTVDSITQNI-------KYTAYTVSHELAHNFGLTHDTSDCGCE------NCIMATGVEFSSRKLD--WSSCSISQIKSLL--KLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCEK---CCNFL----TCKFSANSQCAS--GSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTEC 1131
            +Y P GI F++  + I+ E  +    ++  L    +    S + + D    F+ ++  F          G+  F   +CS+ S VG     Y    +T  +       K +  T +HEL H FG  HD  D  C       N +M +      R  +  +SSCS+  I+  +  K G P +S            IS   P+  ++             I+E  EQCDCG  + C+    CCN       C+ +  + C+   G CC  + C+       CRN T   D    C+G    CP  +++ D T C
Sbjct:  242 LYSPYGITFRVKKMVIYDEQDVPDKYKDDNLAIDVMLNLLSSDDHSDVCEAFMFTDRDFDNGILGLAWIGKPNFLGGICSRYSKVGGQYISYNTGVVTLKLYRLFTPPKVSEVTFAHELGHGFGSEHDPEDGDCSPGGKDGNYVMYSKATSGDRPNNDVFSSCSLKAIRDNINDKRGDPKYSGCF---------ISADTPICGNR-------------IIEGNEQCDCGDENSCKAEGGCCNPPGHPQACRLTLPATCSPSQGPCCGRD-CRYVGNDISCRNKTDCLD-KAMCSGSSVECPKSVYQPDNTVC 529          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Nematostella
Match: EDO33983 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQN0])

HSP 1 Score: 51.6026 bits (122), Expect = 9.367e-7
Identity = 28/80 (35.00%), Postives = 40/80 (50.00%), Query Frame = 1
Query:  583 TAYTVSHELAHNFGLTHDTSDCGCENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQP 822
            TA++++HE+AHN G+ HDT DC     IM +G         WS CS  ++K     G  C+ +L        +KI  R P
Sbjct:  376 TAFSIAHEMAHNLGVDHDTGDCSGH--IMTSGQPSGPDAFTWSKCSRKELKQSFA-GHECYDNLP----PKLIKIPSRPP 448          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Nematostella
Match: EDO41812 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S393])

HSP 1 Score: 50.8322 bits (120), Expect = 1.729e-6
Identity = 63/225 (28.00%), Postives = 91/225 (40.44%), Query Frame = 1
Query:  577 KYTAYTVSHELAHNFGLTHD---TSDCGC----ENCIM---ATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSD----CEKCC------NFLTCKFSANSQCAS--GSCCNTEICKLYPTGT--ICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCK 1179
            K +  T +HE  HNFG  HD   TS C       N IM   AT  E S+ +  +S+CS  ++  +L+    C      F  +        Q  +   R             VE GE CDCG + D     +KCC          C +   + C+   G CCN + C  YP  +  +C+N T  C    +CNG +  CP+   +   T C    + +  C  G C+
Sbjct:  356 KVSEITFAHEAGHNFGSPHDPEITSACSPGDSDGNYIMFPRATSGEKSNNR-KFSTCSRDKMYLVLQAKGICDQEKCCFKDS--------QEAICGNRV------------VEEGESCDCGYQDDASCTADKCCLGSNVQAKTGCTYKNGATCSPSQGLCCNGDTCSPYPGNSTFLCQNETE-CRNQSFCNGINATCPLGEPKPHHTICE---DGRKLCINGTCQ 555          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Medaka
Match: adam8a (disintegrin and metalloproteinase domain-containing protein 8 [Source:NCBI gene;Acc:101166736])

HSP 1 Score: 208.379 bits (529), Expect = 8.983e-57
Identity = 156/517 (30.17%), Postives = 238/517 (46.03%), Query Frame = 1
Query:  202 NQLQIFTLYLIVDSNLYQQ--SQESTENRIQSIFILINKIYLPLGIQFQIICIEIWK-ENLIEISQ-EEYILEELKIYKTKSV--NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGC------ENCIMAT--GVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDC-EKCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDC-----VPLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQT 1692
            ++ +   L ++VD++ Y++  S+++ E+R+  I   ++K+Y P+G++  ++ + IW   + IE+S   +  L     ++ +++   I HD   L  G ++  T  G A    MC+ +S  G   +    N    A T++HE+ HN GLTHDT +C C        CIMA   G+ +  +   +SSCS  Q++  L+   P  + L   P+T  +                    +CGN  +E GE+CDCG   +C   CCN  TCK +A +QCA G CC+   C+L PTG ICR     CDL EYC G    CP D F Q+G  C +    K +C+ G C      CR LWG  + ++   C+  +          G     + +             C   +  CG L+C         +   KSY          EA+    D    D+GMVP G  CGN MVC N  C     +   G  D S  C N+G+C ++ KC C   + PP C  +Q+
Sbjct:  204 DKPRTVELVVVVDNSEYKKYGSKKTIESRVLEIANHVDKLYRPVGVRVMLVGLIIWSNRDQIEVSSNSDTTLIRFIEWRQRNLVQKIKHDNAQLITGIDFEGTTVGLANTNAMCTSNS--GAINEDHNTNAIGVASTIAHEMGHNLGLTHDTENCVCGSYTSKRGCIMAESLGIVYPEQ---FSSCSKLQLRRFLEEYNP--ACLLDTPSTSRI----------------FGGPVCGNAFLEPGEECDCGSAKECTNPCCNATTCKLNAGAQCAEGECCHN--CQLKPTGIICRPKAGDCDLAEYCTGFSAACPADTFAQNGLRCNS---GKGYCYNGNCPSRQEHCRRLWGPDAEVAADECFSRH----------GSCRKFSQR-------------CAAKDQFCGTLFC--SGGWTFPVTSMKSYYIVGNGVTCNEATMKPEDNYPSDLGMVPTGTKCGNNMVCYNNRCEDIRNIKAYGKNDCSSKCNNHGVCNHESKCHCDPGWAPPFCDVQQS 667          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Medaka
Match: adam8a (disintegrin and metalloproteinase domain-containing protein 8 [Source:NCBI gene;Acc:101166736])

HSP 1 Score: 207.994 bits (528), Expect = 1.629e-56
Identity = 156/517 (30.17%), Postives = 238/517 (46.03%), Query Frame = 1
Query:  202 NQLQIFTLYLIVDSNLYQQ--SQESTENRIQSIFILINKIYLPLGIQFQIICIEIWK-ENLIEISQ-EEYILEELKIYKTKSV--NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGC------ENCIMAT--GVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDC-EKCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDC-----VPLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQT 1692
            ++ +   L ++VD++ Y++  S+++ E+R+  I   ++K+Y P+G++  ++ + IW   + IE+S   +  L     ++ +++   I HD   L  G ++  T  G A    MC+ +S  G   +    N    A T++HE+ HN GLTHDT +C C        CIMA   G+ +  +   +SSCS  Q++  L+   P  + L   P+T  +                    +CGN  +E GE+CDCG   +C   CCN  TCK +A +QCA G CC+   C+L PTG ICR     CDL EYC G    CP D F Q+G  C +    K +C+ G C      CR LWG  + ++   C+  +          G     + +             C   +  CG L+C         +   KSY          EA+    D    D+GMVP G  CGN MVC N  C     +   G  D S  C N+G+C ++ KC C   + PP C  +Q+
Sbjct:  239 DKPRTVELVVVVDNSEYKKYGSKKTIESRVLEIANHVDKLYRPVGVRVMLVGLIIWSNRDQIEVSSNSDTTLIRFIEWRQRNLVQKIKHDNAQLITGIDFEGTTVGLANTNAMCTSNS--GAINEDHNTNAIGVASTIAHEMGHNLGLTHDTENCVCGSYTSKRGCIMAESLGIVYPEQ---FSSCSKLQLRRFLEEYNP--ACLLDTPSTSRI----------------FGGPVCGNAFLEPGEECDCGSAKECTNPCCNATTCKLNAGAQCAEGECCHN--CQLKPTGIICRPKAGDCDLAEYCTGFSAACPADTFAQNGLRCNS---GKGYCYNGNCPSRQEHCRRLWGPDAEVAADECFSRH----------GSCRKFSQR-------------CAAKDQFCGTLFC--SGGWTFPVTSMKSYYIVGNGVTCNEATMKPEDNYPSDLGMVPTGTKCGNNMVCYNNRCEDIRNIKAYGKNDCSSKCNNHGVCNHESKCHCDPGWAPPFCDVQQS 702          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Medaka
Match: adam15 (ADAM metallopeptidase domain 15 [Source:NCBI gene;Acc:101172106])

HSP 1 Score: 202.216 bits (513), Expect = 1.809e-54
Identity = 149/547 (27.24%), Postives = 247/547 (45.16%), Query Frame = 1
Query:  223 LYLIVDSNLYQQSQESTENRIQSIFILINKI---YLPLGIQFQIICIEIWKEN---LIEISQEEYILEELKIYKTKSV--NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSD--CGCEN------CIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCE-KCCNFLTCKFSANSQCAS-GSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQF------CEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDC--VPLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPYTRNLDTENPIDKSNFTEKYFI 1785
            L L+ D   +   Q++ +  I  +  + N++   Y PL ++  +  +EIW +     +E S  +  L     ++T+ +   + HD   L +G ++  T  G A  ++MCS+    G  VD +  ++   A T++HEL HN G+ HDT++  C C+N      CIM     F   +  +SSCSI+ +   L+ G                 + +   ++   R  ++         VE GE+CDCG   +CE  CCN  TC+    +QC+S G CC    CKL P G++CR     CDL E+C G   +CP ++F Q+G  C    N+ ++C+ G C +  TQC+ LWG  +  + + C+    ++ + + NCG    L + +Y          PC  ++  CGR+ C    E+ +   L  +    T T +F      C  + F +  +  D   V  G  CG    C N  C  V + G+ +    C  +G+C + K C C   + PP+C  R +       S   R     +P+  +     +FI
Sbjct:  250 LVLVADHQEFLNYQKNNKTIIYRMLDVANQVDWFYRPLNVRVALTGLEIWSDRDKIRVEKSATD-TLNNFLDWRTRDLLPRLRHDNAQLVMGESFDGTTVGMASQSSMCSRDRSGGVNVDHLV-SVLGVASTIAHELGHNLGMRHDTAERRCSCQNEPRLGGCIMEPSTGFLPGQ-QFSSCSITDLTLSLQHGG----------GMCLFNVPQPDQLLGGPRCGNLY--------VEKGEECDCGLLQECEDPCCNASTCQLVPGAQCSSDGICCQN--CKLRPAGSMCRGPLGDCDLPEFCTGSSPHCPPNVFLQNGEVC---ENSTSYCYEGVCANMDTQCQMLWGPNATSAPAVCFSSVNKQGNKYGNCG---QLANGSYI---------PCGNADVHCGRIQCQGGRERPL---LGSNAQILTTTVRFNDSDLTCRGTFFHLGDDVSDPATVAQGTACGPGKACLNHKCREVSMFGVDECRRKCNGHGVCNSNKNCHCDVGWAPPDC--RYSGHGGSVDSGPARAAGGSDPVRVALLVIFFFI 753          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Medaka
Match: adam15 (ADAM metallopeptidase domain 15 [Source:NCBI gene;Acc:101172106])

HSP 1 Score: 202.216 bits (513), Expect = 1.977e-54
Identity = 149/547 (27.24%), Postives = 247/547 (45.16%), Query Frame = 1
Query:  223 LYLIVDSNLYQQSQESTENRIQSIFILINKI---YLPLGIQFQIICIEIWKEN---LIEISQEEYILEELKIYKTKSV--NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSD--CGCEN------CIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCE-KCCNFLTCKFSANSQCAS-GSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQF------CEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDC--VPLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPYTRNLDTENPIDKSNFTEKYFI 1785
            L L+ D   +   Q++ +  I  +  + N++   Y PL ++  +  +EIW +     +E S  +  L     ++T+ +   + HD   L +G ++  T  G A  ++MCS+    G  VD +  ++   A T++HEL HN G+ HDT++  C C+N      CIM     F   +  +SSCSI+ +   L+ G                 + +   ++   R  ++         VE GE+CDCG   +CE  CCN  TC+    +QC+S G CC    CKL P G++CR     CDL E+C G   +CP ++F Q+G  C    N+ ++C+ G C +  TQC+ LWG  +  + + C+    ++ + + NCG    L + +Y          PC  ++  CGR+ C    E+ +   L  +    T T +F      C  + F +  +  D   V  G  CG    C N  C  V + G+ +    C  +G+C + K C C   + PP+C  R +       S   R     +P+  +     +FI
Sbjct:  250 LVLVADHQEFLNYQKNNKTIIYRMLDVANQVDWFYRPLNVRVALTGLEIWSDRDKIRVEKSATD-TLNNFLDWRTRDLLPRLRHDNAQLVMGESFDGTTVGMASQSSMCSRDRSGGVNVDHLV-SVLGVASTIAHELGHNLGMRHDTAERRCSCQNEPRLGGCIMEPSTGFLPGQ-QFSSCSITDLTLSLQHGG----------GMCLFNVPQPDQLLGGPRCGNLY--------VEKGEECDCGLLQECEDPCCNASTCQLVPGAQCSSDGICCQN--CKLRPAGSMCRGPLGDCDLPEFCTGSSPHCPPNVFLQNGEVC---ENSTSYCYEGVCANMDTQCQMLWGPNATSAPAVCFSSVNKQGNKYGNCG---QLANGSYI---------PCGNADVHCGRIQCQGGRERPL---LGSNAQILTTTVRFNDSDLTCRGTFFHLGDDVSDPATVAQGTACGPGKACLNHKCREVSMFGVDECRRKCNGHGVCNSNKNCHCDVGWAPPDC--RYSGHGGSVDSGPARAAGGSDPVRVALLVIFFFI 753          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Medaka
Match: adam15 (ADAM metallopeptidase domain 15 [Source:NCBI gene;Acc:101172106])

HSP 1 Score: 201.83 bits (512), Expect = 2.178e-54
Identity = 149/547 (27.24%), Postives = 247/547 (45.16%), Query Frame = 1
Query:  223 LYLIVDSNLYQQSQESTENRIQSIFILINKI---YLPLGIQFQIICIEIWKEN---LIEISQEEYILEELKIYKTKSV--NINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSD--CGCEN------CIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCE-KCCNFLTCKFSANSQCAS-GSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQF------CEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDC--VPLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPYTRNLDTENPIDKSNFTEKYFI 1785
            L L+ D   +   Q++ +  I  +  + N++   Y PL ++  +  +EIW +     +E S  +  L     ++T+ +   + HD   L +G ++  T  G A  ++MCS+    G  VD +  ++   A T++HEL HN G+ HDT++  C C+N      CIM     F   +  +SSCSI+ +   L+ G                 + +   ++   R  ++         VE GE+CDCG   +CE  CCN  TC+    +QC+S G CC    CKL P G++CR     CDL E+C G   +CP ++F Q+G  C    N+ ++C+ G C +  TQC+ LWG  +  + + C+    ++ + + NCG    L + +Y          PC  ++  CGR+ C    E+ +   L  +    T T +F      C  + F +  +  D   V  G  CG    C N  C  V + G+ +    C  +G+C + K C C   + PP+C  R +       S   R     +P+  +     +FI
Sbjct:  250 LVLVADHQEFLNYQKNNKTIIYRMLDVANQVDWFYRPLNVRVALTGLEIWSDRDKIRVEKSATD-TLNNFLDWRTRDLLPRLRHDNAQLVMGESFDGTTVGMASQSSMCSRDRSGGVNVDHLV-SVLGVASTIAHELGHNLGMRHDTAERRCSCQNEPRLGGCIMEPSTGFLPGQ-QFSSCSITDLTLSLQHGG----------GMCLFNVPQPDQLLGGPRCGNLY--------VEKGEECDCGLLQECEDPCCNASTCQLVPGAQCSSDGICCQN--CKLRPAGSMCRGPLGDCDLPEFCTGSSPHCPPNVFLQNGEVC---ENSTSYCYEGVCANMDTQCQMLWGPNATSAPAVCFSSVNKQGNKYGNCG---QLANGSYI---------PCGNADVHCGRIQCQGGRERPL---LGSNAQILTTTVRFNDSDLTCRGTFFHLGDDVSDPATVAQGTACGPGKACLNHKCREVSMFGVDECRRKCNGHGVCNSNKNCHCDVGWAPPDC--RYSGHGGSVDSGPARAAGGSDPVRVALLVIFFFI 753          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Planmine SMEST
Match: SMESG000079144.1 (SMESG000079144.1)

HSP 1 Score: 1197.96 bits (3098), Expect = 0.000e+0
Identity = 636/657 (96.80%), Postives = 638/657 (97.11%), Query Frame = 1
Query:   85 MLYEMHXXXXXXXXXXXXXXXXXGSVNANEFSIKIDRNKNQLQIFTLYLIVDSNLYQQSQESTENRIQSIFILINKIYLPLGIQFQIICIEIWKENLIEISQEEYILEELKIYKTKSVNINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCEKCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPYTRNLDTENPIDKSNFTEKYFINILRENKILKIILGVXXXXXXXXXXXXNRRKLKTSIHILFQRPNLEIIDQITSKLYFIKENPINKITEDIGNRKNTDEDQELLQLSKIAT 2055
            MLYEMHFWLFNDLNFIILILFMIGSVNANEFSIKIDRNKNQLQIFTLYLIVDSNLYQQSQESTENRIQSIFILINKIYLPLGIQFQIICIEIWKENLIEISQEEYILEELKIYK KSVNINHDCLHLFLGS YFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQF TTIFVKISRRQPMMKSKRTSSINISICGNGIVENGEQCDCGKRSDCEKCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSN+SHSSCYDENTEENHAFKNCGL+VTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNE               KTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPYTRNLDTENPIDKSNFTEKYFINILRENKILKIILGVLLPICFLIILILNRRKLKTSIHILFQRPNLEIIDQITSKLYFIKENPINKITEDIGN KNTDEDQELLQLSKIAT
Sbjct:    1 MLYEMHFWLFNDLNFIILILFMIGSVNANEFSIKIDRNKNQLQIFTLYLIVDSNLYQQSQESTENRIQSIFILINKIYLPLGIQFQIICIEIWKENLIEISQEEYILEELKIYKKKSVNINHDCLHLFLGSTYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFSTTIFVKISRRQPMMKSKRTSSINISICGNGIVENGEQCDCGKRSDCEKCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNVSHSSCYDENTEENHAFKNCGLIVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNE---------------KTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPYTRNLDTENPIDKSNFTEKYFINILRENKILKIILGVLLPICFLIILILNRRKLKTSIHILFQRPNLEIIDQITSKLYFIKENPINKITEDIGNWKNTDEDQELLQLSKIAT 642          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Planmine SMEST
Match: SMESG000079144.1 (SMESG000079144.1)

HSP 1 Score: 1191.79 bits (3082), Expect = 0.000e+0
Identity = 613/634 (96.69%), Postives = 615/634 (97.00%), Query Frame = 1
Query:  154 GSVNANEFSIKIDRNKNQLQIFTLYLIVDSNLYQQSQESTENRIQSIFILINKIYLPLGIQFQIICIEIWKENLIEISQEEYILEELKIYKTKSVNINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCEKCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPYTRNLDTENPIDKSNFTEKYFINILRENKILKIILGVXXXXXXXXXXXXNRRKLKTSIHILFQRPNLEIIDQITSKLYFIKENPINKITEDIGNRKNTDEDQELLQLSKIAT 2055
            GSVNANEFSIKIDRNKNQLQIFTLYLIVDSNLYQQSQESTENRIQSIFILINKIYLPLGIQFQIICIEIWKENLIEISQEEYILEELKIYK KSVNINHDCLHLFLGS YFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQF TTIFVKISRRQPMMKSKRTSSINISICGNGIVENGEQCDCGKRSDCEKCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSN+SHSSCYDENTEENHAFKNCGL+VTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNE               KTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPYTRNLDTENPIDKSNFTEKYFINILRENKILKIILGVLLPICFLIILILNRRKLKTSIHILFQRPNLEIIDQITSKLYFIKENPINKITEDIGN KNTDEDQELLQLSKIAT
Sbjct:   20 GSVNANEFSIKIDRNKNQLQIFTLYLIVDSNLYQQSQESTENRIQSIFILINKIYLPLGIQFQIICIEIWKENLIEISQEEYILEELKIYKKKSVNINHDCLHLFLGSTYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFSTTIFVKISRRQPMMKSKRTSSINISICGNGIVENGEQCDCGKRSDCEKCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNVSHSSCYDENTEENHAFKNCGLIVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNE---------------KTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPYTRNLDTENPIDKSNFTEKYFINILRENKILKIILGVLLPICFLIILILNRRKLKTSIHILFQRPNLEIIDQITSKLYFIKENPINKITEDIGNWKNTDEDQELLQLSKIAT 638          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Planmine SMEST
Match: SMESG000079144.1 (SMESG000079144.1)

HSP 1 Score: 1176 bits (3041), Expect = 0.000e+0
Identity = 608/634 (95.90%), Postives = 610/634 (96.21%), Query Frame = 1
Query:  154 GSVNANEFSIKIDRNKNQLQIFTLYLIVDSNLYQQSQESTENRIQSIFILINKIYLPLGIQFQIICIEIWKENLIEISQEEYILEELKIYKTKSVNINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCEKCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPYTRNLDTENPIDKSNFTEKYFINILRENKILKIILGVXXXXXXXXXXXXNRRKLKTSIHILFQRPNLEIIDQITSKLYFIKENPINKITEDIGNRKNTDEDQELLQLSKIAT 2055
            GSVNANEFSIKIDRNKNQLQIFTLYLIVDSNLYQQSQESTENRIQSIFILINKIYLPLGIQFQIICIEIWKENLIEISQEEYILEELKIYK KSVNINHDCLHLFLGS YFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQF TTIFVKISRRQPMMKSKRTSSINISICGNGIVENGEQCDCGKRSDCEKCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSN+SHSSCYDENTEENHAFKNCGL+VTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNE               KTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPY     TENPIDKSNFTEKYFINILRENKILKIILGVLLPICFLIILILNRRKLKTSIHILFQRPNLEIIDQITSKLYFIKENPINKITEDIGN KNTDEDQELLQLSKIAT
Sbjct:   20 GSVNANEFSIKIDRNKNQLQIFTLYLIVDSNLYQQSQESTENRIQSIFILINKIYLPLGIQFQIICIEIWKENLIEISQEEYILEELKIYKKKSVNINHDCLHLFLGSTYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFSTTIFVKISRRQPMMKSKRTSSINISICGNGIVENGEQCDCGKRSDCEKCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNKAHCFGGQCKDHGTQCRFLWGQTSNVSHSSCYDENTEENHAFKNCGLIVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNE---------------KTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPY-----TENPIDKSNFTEKYFINILRENKILKIILGVLLPICFLIILILNRRKLKTSIHILFQRPNLEIIDQITSKLYFIKENPINKITEDIGNWKNTDEDQELLQLSKIAT 633          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Planmine SMEST
Match: SMESG000076089.1 (SMESG000076089.1)

HSP 1 Score: 365.54 bits (937), Expect = 6.690e-115
Identity = 209/514 (40.66%), Postives = 288/514 (56.03%), Query Frame = 1
Query:  214 IFTLYLIVDSNLYQQSQESTEN----RIQSIFILINKIYLPLGIQFQIICIEIWKENLIEISQEEYILEELKIYKTKSVNINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIF-VKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCE----KCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRN-STTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNK-AHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQF-CEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSP 1719
            +  LY+IVDS +         N    RI  I   IN  +    I F +I +EIW+ + I+++ E +IL EL++YK + +N  HDCLH  LG N    R+G++E  +MC  + CVGYT D  +QN    ++ V HE+ HNFGL HDT  C C  CIMATG+E  S   +WS+CS  +IKSLLK G      L + P+ I  +     +P    +   S+  S CGNG+V+ GEQCDCG R  CE    KCCN  TC F+  + CA GSCC+ + C L  +GTICRN     CDL EYCNG+ E CP D+++QDG  C  K   + +HC+ G+C     +C+ LWG T+ +S+  CYD N +      NCGL +   +        +W TKPC K  SICGRLWC H+NE+V++  LS+ +      N + C A RF++DW   D GMVP+G  CG+  +C   +CV ++ I    C+C  +G C N+  C C   +  PNC+      S  S  P
Sbjct:  232 LVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDENHILMELQLYKRRFINKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGM-ADCLLDEPPSNIGKMNAVAMEPNGAPRYIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMN-KRGDLVANCGLEIP-READRDRQPKNWNTKPCSKETSICGRLWCRHENERVLR--LSEQFLNDEIVNGYHCSAVRFDMDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRCNCHEHGDCNNRGNCHCHPGFSAPNCTTNGDGGSIDSGPP 740          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Planmine SMEST
Match: SMESG000076089.1 (SMESG000076089.1)

HSP 1 Score: 366.311 bits (939), Expect = 1.227e-112
Identity = 209/514 (40.66%), Postives = 288/514 (56.03%), Query Frame = 1
Query:  214 IFTLYLIVDSNLYQQSQESTEN----RIQSIFILINKIYLPLGIQFQIICIEIWKENLIEISQEEYILEELKIYKTKSVNINHDCLHLFLGSNYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIF-VKISRRQPMMKSKRTXXXXXXXXXXXXVENGEQCDCGKRSDCE----KCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRN-STTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNK-AHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNCGLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKSYSFTTKTNQF-CEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSP 1719
            +  LY+IVDS +         N    RI  I   IN  +    I F +I +EIW+ + I+++ E +IL EL++YK + +N  HDCLH  LG N    R+G++E  +MC  + CVGYT D  +QN    ++ V HE+ HNFGL HDT  C C  CIMATG+E  S   +WS+CS  +IKSLLK G      L + P+ I  +     +P    +   S+  S CGNG+V+ GEQCDCG R  CE    KCCN  TC F+  + CA GSCC+ + C L  +GTICRN     CDL EYCNG+ E CP D+++QDG  C  K   + +HC+ G+C     +C+ LWG T+ +S+  CYD N +      NCGL +   +        +W TKPC K  SICGRLWC H+NE+V++  LS+ +      N + C A RF++DW   D GMVP+G  CG+  +C   +CV ++ I    C+C  +G C N+  C C   +  PNC+      S  S  P
Sbjct:  232 LVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDENHILMELQLYKRRFINKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGM-ADCLLDEPPSNIGKMNAVAMEPNGAPRYIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMN-KRGDLVANCGLEIP-READRDRQPKNWNTKPCSKETSICGRLWCRHENERVLR--LSEQFLNDEIVNGYHCSAVRFDMDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRCNCHEHGDCNNRGNCHCHPGFSAPNCTTNGDGGSIDSGPP 740          
The following BLAST results are available for this feature:
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADAM91.252e-5428.98ADAM metallopeptidase domain 9 [Source:HGNC Symbol... [more]
ADAM91.285e-5429.06ADAM metallopeptidase domain 9 [Source:HGNC Symbol... [more]
ADAM286.156e-5428.63ADAM metallopeptidase domain 28 [Source:HGNC Symbo... [more]
ADAM203.453e-5129.42ADAM metallopeptidase domain 20 [Source:HGNC Symbo... [more]
ADAM206.139e-5129.42ADAM metallopeptidase domain 20 [Source:HGNC Symbo... [more]
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
adm-28.374e-5128.81ADAM (Disintegrin plus metalloprotease) family [S... [more]
adm-28.507e-5128.81ADAM (Disintegrin plus metalloprotease) family [S... [more]
unc-711.536e-3325.96Disintegrin and metalloproteinase domain-containin... [more]
sup-171.890e-828.45Disintegrin and metalloproteinase domain-containin... [more]
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Meltrin3.217e-6632.71gene:FBgn0265140 transcript:FBtr0301499[more]
Meltrin7.219e-6633.40gene:FBgn0265140 transcript:FBtr0301498[more]
mmd2.496e-4727.71gene:FBgn0259110 transcript:FBtr0299534[more]
mmd5.341e-4727.71gene:FBgn0259110 transcript:FBtr0307542[more]
mmd6.164e-4727.71gene:FBgn0259110 transcript:FBtr0307540[more]
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adam153.784e-5728.54ADAM metallopeptidase domain 15 [Source:ZFIN;Acc:Z... [more]
adam94.074e-5729.70ADAM metallopeptidase domain 9 [Source:ZFIN;Acc:ZD... [more]
adam156.015e-5728.93ADAM metallopeptidase domain 15 [Source:ZFIN;Acc:Z... [more]
adam8a6.743e-5429.11ADAM metallopeptidase domain 8a [Source:ZFIN;Acc:Z... [more]
adam23a5.031e-5028.86ADAM metallopeptidase domain 23a [Source:ZFIN;Acc:... [more]
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adam122.712e-5227.76ADAM metallopeptidase domain 12 [Source:NCBI gene;... [more]
tbc1d325.499e-5128.91TBC1 domain family member 32 [Source:Xenbase;Acc:X... [more]
adam28.27.448e-5029.88ADAM metallopeptidase domain 28, gene 2 [Source:NC... [more]
adam28.27.702e-5029.88ADAM metallopeptidase domain 28, gene 2 [Source:NC... [more]
tbc1d322.772e-4927.65TBC1 domain family member 32 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adam201.437e-5631.53a disintegrin and metallopeptidase domain 20 [Sour... [more]
Adam346.159e-5328.08a disintegrin and metallopeptidase domain 34 [Sour... [more]
Adam346.159e-5328.08a disintegrin and metallopeptidase domain 34 [Sour... [more]
Adam94.823e-5229.58a disintegrin and metallopeptidase domain 9 (meltr... [more]
Adam96.531e-5229.58a disintegrin and metallopeptidase domain 9 (meltr... [more]
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q13443|ADAM9_HUMAN6.173e-5429.06Disintegrin and metalloproteinase domain-containin... [more]
sp|Q9UKQ2|ADA28_HUMAN2.956e-5328.63Disintegrin and metalloproteinase domain-containin... [more]
sp|Q9XSL6|ADA28_MACFA6.171e-5328.23Disintegrin and metalloproteinase domain-containin... [more]
sp|Q61072|ADAM9_MOUSE3.374e-5129.58Disintegrin and metalloproteinase domain-containin... [more]
sp|O43506|ADA20_HUMAN1.658e-5029.42Disintegrin and metalloproteinase domain-containin... [more]
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564YGG31.248e-9934.54Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A564YET51.953e-9934.54Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A068WBY21.897e-9534.79Subfamily M12B unassigned peptidase OS=Echinococcu... [more]
A0A068Y7H42.247e-9534.62Subfamily M12B unassigned peptidase OS=Echinococcu... [more]
A0A0R3W1441.330e-9132.50Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adam282.691e-5529.32zinc metalloproteinase-disintegrin-like batroxstat... [more]
adam282.691e-5529.32zinc metalloproteinase-disintegrin-like batroxstat... [more]
adam98.569e-5429.70ADAM metallopeptidase domain 9 [Source:NCBI gene;A... [more]
adam98.978e-5429.70ADAM metallopeptidase domain 9 [Source:NCBI gene;A... [more]
adam158.625e-4927.18ADAM metallopeptidase domain 15 [Source:NCBI gene;... [more]
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004527.11.636e-4828.93pep scaffold:Pmarinus_7.0:GL476950:296064:347055:1... [more]
ENSPMAT00000004524.12.147e-4527.38pep scaffold:Pmarinus_7.0:GL476950:296055:347085:1... [more]
ENSPMAT00000007858.14.751e-4426.62pep scaffold:Pmarinus_7.0:GL476347:375920:389428:1... [more]
ENSPMAT00000007654.17.229e-4328.32pep scaffold:Pmarinus_7.0:GL476707:60529:77379:-1 ... [more]
adam229.462e-4026.44ADAM metallopeptidase domain 22 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO371294.352e-2534.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371314.370e-1839.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308038.013e-1025.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339839.367e-735.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418121.729e-628.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adam8a8.983e-5730.17disintegrin and metalloproteinase domain-containin... [more]
adam8a1.629e-5630.17disintegrin and metalloproteinase domain-containin... [more]
adam151.809e-5427.24ADAM metallopeptidase domain 15 [Source:NCBI gene;... [more]
adam151.977e-5427.24ADAM metallopeptidase domain 15 [Source:NCBI gene;... [more]
adam152.178e-5427.24ADAM metallopeptidase domain 15 [Source:NCBI gene;... [more]
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079144.10.000e+096.80SMESG000079144.1[more]
SMESG000079144.10.000e+096.69SMESG000079144.1[more]
SMESG000079144.10.000e+095.90SMESG000079144.1[more]
SMESG000076089.16.690e-11540.66SMESG000076089.1[more]
SMESG000076089.11.227e-11240.66SMESG000076089.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019659 ID=SMED30019659|Name=Disintegrin and metalloproteinase domain-containing protein 15|organism=Schmidtea mediterranea sexual|type=transcript|length=2099bp
ATATAAATCTTATATGATTTATGGCAAATTTTCAGTATAAATTCTAAAAG
AAAAATAAAAATTCCATTGCGACATTTTTTATTCATGCTTTACGAAATGC
ATTTTTGGTTATTCAATGATCTCAATTTTATAATATTGATTCTCTTCATG
ATCGGTTCAGTGAACGCCAATGAATTCAGCATAAAAATTGATCGTAATAA
AAATCAGTTACAGATTTTTACGTTGTATTTGATCGTGGATTCAAACTTGT
ACCAGCAGAGCCAAGAATCAACTGAAAATAGAATTCAATCTATATTCATA
TTAATTAATAAGATTTATCTACCATTGGGAATTCAATTTCAAATAATTTG
CATAGAAATTTGGAAGGAAAACTTAATTGAAATTTCGCAAGAGGAATATA
TTTTGGAAGAACTGAAAATATACAAGACAAAATCTGTAAATATAAATCAT
GACTGCCTTCATTTATTTCTCGGATCAAACTATTTTTTTACAAGACAAGG
CCGTGCAGAATTTACGACCATGTGCTCCAAGAGCTCATGCGTTGGATATA
CAGTAGATTCAATCACACAGAACATAAAATACACGGCTTATACAGTTTCG
CATGAATTAGCTCACAATTTCGGATTGACGCACGACACATCAGACTGCGG
ATGCGAAAACTGTATAATGGCTACTGGAGTTGAATTTTCAAGTAGAAAAT
TGGATTGGTCATCATGTTCTATTTCCCAAATCAAAAGTTTATTAAAACTA
GGATTCCCCTGCCACAGTCACTTAGCCCAATTTCCAACGACAATTTTTGT
CAAAATTAGCAGAAGGCAGCCCATGATGAAATCAAAAAGAACAAGTTCAA
TTAATATTTCAATTTGTGGAAATGGAATTGTAGAAAATGGTGAACAGTGC
GATTGTGGAAAAAGGTCAGACTGTGAAAAGTGTTGTAATTTTCTTACATG
TAAATTCTCTGCAAACTCTCAATGCGCTTCAGGATCTTGTTGCAACACTG
AGATATGCAAATTATATCCAACTGGAACAATCTGTAGAAATTCCACAACC
TTTTGTGATTTAACAGAATACTGTAATGGTCAAGATGAAAATTGTCCAAT
AGACATTTTTAGACAAGATGGAACTGAATGTTTGACAAAATTTAATAATA
AAGCACACTGCTTTGGAGGACAGTGCAAAGATCATGGAACTCAATGTCGA
TTTTTATGGGGTCAAACTTCAAATATGTCACACTCGTCATGTTACGACGA
GAATACTGAAGAAAATCATGCATTTAAAAATTGTGGACTGATGGTGACAC
TCAATGACAAAACATATTTTGATTCGTTTTTAGATTGGCCTACAAAGCCT
TGTCAAAAAAGCAATTCCATTTGTGGACGTTTGTGGTGCATTCATGACAA
TGAAAAAGTAATGCAAATTGGTCTAAGTAAATCATATTCATTTACCACAA
AGACAAATCAGTTTTGTGAGGCTAGTCGATTTGAGGTCGACTGGAATAAC
CGTGATATAGGCATGGTCCCAGATGGAGCAGTTTGCGGAAATAAAATGGT
ATGTTCAAATGGTGACTGCGTGCCCCTTGACGGTATATTTGACAAATCTT
GTCATTGTTTTAATAATGGAATCTGTACAAATCAAAAGAAATGTCAATGC
TTTCAACAATATCTTCCACCAAACTGCAGTGAAAGGCAAACTATTAAGTC
AACTATGTCTACCAGTCCATATACGAGAAATTTAGATACGGAAAATCCGA
TAGATAAATCAAATTTTACAGAAAAATATTTTATCAATATATTACGAGAA
AATAAGATTTTGAAGATTATTTTAGGAGTTTTATTACCCATTTGTTTTTT
AATTATTTTAATTTTAAATCGTAGAAAACTGAAGACTAGTATTCATATTC
TTTTCCAAAGACCTAACTTAGAAATAATAGATCAAATCACAAGCAAACTG
TATTTTATTAAAGAAAATCCCATCAACAAAATAACAGAAGACATTGGTAA
CCGGAAAAACACTGATGAAGATCAAGAATTACTTCAACTATCAAAGATTG
CTACGTGAACATATTTATTGAGAGGATTTAAGAAAAAATTCCATTATTT
back to top

protein sequence of SMED30019659-orf-1

>SMED30019659-orf-1 ID=SMED30019659-orf-1|Name=SMED30019659-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=658bp
MLYEMHFWLFNDLNFIILILFMIGSVNANEFSIKIDRNKNQLQIFTLYLI
VDSNLYQQSQESTENRIQSIFILINKIYLPLGIQFQIICIEIWKENLIEI
SQEEYILEELKIYKTKSVNINHDCLHLFLGSNYFFTRQGRAEFTTMCSKS
SCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCENCIMATGVE
FSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFPTTIFVKISRRQPMMKS
KRTSSINISICGNGIVENGEQCDCGKRSDCEKCCNFLTCKFSANSQCASG
SCCNTEICKLYPTGTICRNSTTFCDLTEYCNGQDENCPIDIFRQDGTECL
TKFNNKAHCFGGQCKDHGTQCRFLWGQTSNMSHSSCYDENTEENHAFKNC
GLMVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEKVMQIGLSKS
YSFTTKTNQFCEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDG
IFDKSCHCFNNGICTNQKKCQCFQQYLPPNCSERQTIKSTMSTSPYTRNL
DTENPIDKSNFTEKYFINILRENKILKIILGVLLPICFLIILILNRRKLK
TSIHILFQRPNLEIIDQITSKLYFIKENPINKITEDIGNRKNTDEDQELL
QLSKIAT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036436Disintegrin_dom_sf
IPR001762Disintegrin_dom
IPR006586ADAM_Cys-rich
IPR024079MetalloPept_cat_dom_sf
IPR001590Peptidase_M12B
Vocabulary: molecular function
TermDefinition
GO:0004222metalloendopeptidase activity
GO:0008237metallopeptidase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0007229integrin-mediated signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001762Disintegrin domainSMARTSM00050DISIN_2coord: 267..343
e-value: 2.8E-26
score: 103.3
IPR001762Disintegrin domainPFAMPF00200Disintegrincoord: 267..340
e-value: 4.4E-17
score: 62.7
IPR001762Disintegrin domainPROSITEPS50214DISINTEGRIN_2coord: 258..345
score: 17.1
IPR006586ADAM, cysteine-rich domainSMARTSM00608acrcoord: 344..498
e-value: 5.6E-20
score: 82.4
IPR006586ADAM, cysteine-rich domainPFAMPF08516ADAM_CRcoord: 345..475
e-value: 3.6E-18
score: 66.0
IPR024079Metallopeptidase, catalytic domain superfamilyGENE3DG3DSA:3.40.390.10coord: 43..226
e-value: 1.3E-33
score: 118.4
IPR036436Disintegrin domain superfamilyGENE3DG3DSA:4.10.70.10coord: 257..340
e-value: 6.6E-22
score: 79.6
IPR036436Disintegrin domain superfamilySUPERFAMILYSSF57552Blood coagulation inhibitor (disintegrin)coord: 267..343
IPR001590Peptidase M12B, ADAM/reprolysinPFAMPF01421Reprolysincoord: 46..221
e-value: 1.4E-29
score: 103.5
IPR001590Peptidase M12B, ADAM/reprolysinPROSITEPS50215ADAM_MEPROcoord: 43..220
score: 22.965
NoneNo IPR availablePANTHERPTHR11905ADAM A DISINTEGRIN AND METALLOPROTEASE DOMAINcoord: 41..591
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..28
score: 0.512
NoneNo IPR availableSUPERFAMILYSSF55486Metalloproteases ("zincins"), catalytic domaincoord: 46..221
NoneNo IPR availableTMHMMTMhelixcoord: 575..594
NoneNo IPR availableTMHMMTMhelixcoord: 7..29