Microsomal glutathione S-transferase, putative

Overview
NameMicrosomal glutathione S-transferase, putative
Smed IDSMED30019657
Length (bp)644
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Microsomal glutathione S-transferase, putative (SMED30019657) t-SNE clustered cells

Violin plots show distribution of expression levels for Microsomal glutathione S-transferase, putative (SMED30019657) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Microsomal glutathione S-transferase, putative (SMED30019657) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Microsomal glutathione S-transferase, putative (SMED30019657) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019657

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30019657SMESG000078591.1 Contig4755newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019657SMESG000078591.1 Contig4755uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019657SMESG000020173.1 Contig4755newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019657SMESG000020173.1 Contig4755uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30019657SMESG000078591.1 dd_Smed_v4_2049_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019657SMESG000078591.1 dd_Smed_v4_2049_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30019657SMESG000078591.1 dd_Smed_v4_2049_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30019657SMESG000078591.1 dd_Smed_v4_2049_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Human
Match: MGST3 (microsomal glutathione S-transferase 3 [Source:HGNC Symbol;Acc:HGNC:7064])

HSP 1 Score: 85.1149 bits (209), Expect = 1.005e-20
Identity = 44/107 (41.12%), Postives = 67/107 (62.62%), Query Frame = 2
Query:  164 YGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSDSSVE---FNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIV 475
            YG VLL    ++++  +L I V KARK+Y +EYP MYS        FNCIQR+HQN LE    F+ FL   G+ +P++++  G  +++GRVLYA+ Y + ++  R+ 
Sbjct:    8 YGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEVSNRLA 114          
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Human
Match: MGST3 (microsomal glutathione S-transferase 3 [Source:HGNC Symbol;Acc:HGNC:7064])

HSP 1 Score: 85.5001 bits (210), Expect = 1.590e-20
Identity = 49/117 (41.88%), Postives = 71/117 (60.68%), Query Frame = 2
Query:  164 YGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSDSSVE---FNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVGF--RISLFG 499
            YG VLL    ++++  +L I V KARK+Y +EYP MYS        FNCIQR+HQN LE    F+ FL   G+ +P++++  G  +++GRVLYA+ Y + +  KR  G    I+L G
Sbjct:    8 YGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLG 124          
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Human
Match: MGST3 (microsomal glutathione S-transferase 3 [Source:HGNC Symbol;Acc:HGNC:7064])

HSP 1 Score: 85.5001 bits (210), Expect = 1.590e-20
Identity = 49/117 (41.88%), Postives = 71/117 (60.68%), Query Frame = 2
Query:  164 YGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSDSSVE---FNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVGF--RISLFG 499
            YG VLL    ++++  +L I V KARK+Y +EYP MYS        FNCIQR+HQN LE    F+ FL   G+ +P++++  G  +++GRVLYA+ Y + +  KR  G    I+L G
Sbjct:    8 YGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLG 124          
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Human
Match: MGST3 (microsomal glutathione S-transferase 3 [Source:HGNC Symbol;Acc:HGNC:7064])

HSP 1 Score: 85.5001 bits (210), Expect = 2.098e-20
Identity = 49/117 (41.88%), Postives = 71/117 (60.68%), Query Frame = 2
Query:  164 YGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSDSSVE---FNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVGF--RISLFG 499
            YG VLL    ++++  +L I V KARK+Y +EYP MYS        FNCIQR+HQN LE    F+ FL   G+ +P++++  G  +++GRVLYA+ Y + +  KR  G    I+L G
Sbjct:   22 YGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLG 138          
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Human
Match: MGST3 (microsomal glutathione S-transferase 3 [Source:HGNC Symbol;Acc:HGNC:7064])

HSP 1 Score: 85.5001 bits (210), Expect = 2.098e-20
Identity = 49/117 (41.88%), Postives = 71/117 (60.68%), Query Frame = 2
Query:  164 YGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSDSSVE---FNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVGF--RISLFG 499
            YG VLL    ++++  +L I V KARK+Y +EYP MYS        FNCIQR+HQN LE    F+ FL   G+ +P++++  G  +++GRVLYA+ Y + +  KR  G    I+L G
Sbjct:   22 YGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLG 138          
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Zebrafish
Match: mgst3b (microsomal glutathione S-transferase 3b [Source:ZFIN;Acc:ZDB-GENE-061215-48])

HSP 1 Score: 91.2781 bits (225), Expect = 3.411e-23
Identity = 48/124 (38.71%), Postives = 74/124 (59.68%), Query Frame = 2
Query:  134 LAHRDIFPAGYGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSDSSVEFNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVGF--RISLFG 499
            +A   + PA +G  +LV V ++++ MYL ++V  ARK++ ++YP MYSD    FNCIQR+HQN LE    ++ F   + + YP  +++ G I++  R  YA  Y + D  KR+ G    I LFG
Sbjct:    1 MAIESVLPANFGYAILVYVYSFVMLMYLGMKVGAARKKFGVKYPTMYSDKDQIFNCIQRAHQNTLEVYPQWLLFQTIAALHYPSAASVLGAIWVTSRFSYAWGYYTGDPAKRMHGVYGYIGLFG 124          
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Zebrafish
Match: mgst3a (microsomal glutathione S-transferase 3a [Source:ZFIN;Acc:ZDB-GENE-040426-2767])

HSP 1 Score: 87.4261 bits (215), Expect = 1.742e-21
Identity = 45/105 (42.86%), Postives = 67/105 (63.81%), Query Frame = 2
Query:  164 YGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSDSSVE---FNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKR 469
            YG V L    ++++ ++L   VVKARK+Y++ YP MYSD       FNCIQRSHQN +E    F+  L   GI++P+L+++ G I+++ RVLYA  Y +   +KR
Sbjct:    8 YGYVALTGAASFLLMVHLAHGVVKARKKYNVPYPTMYSDDPETGRIFNCIQRSHQNTIEILSPFLFHLSVGGIQHPRLASVLGMIWIVSRVLYAQGYSTGKPQKR 112          
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Zebrafish
Match: mgst3a (microsomal glutathione S-transferase 3a [Source:ZFIN;Acc:ZDB-GENE-040426-2767])

HSP 1 Score: 87.4261 bits (215), Expect = 1.742e-21
Identity = 45/105 (42.86%), Postives = 67/105 (63.81%), Query Frame = 2
Query:  164 YGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSDSSVE---FNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKR 469
            YG V L    ++++ ++L   VVKARK+Y++ YP MYSD       FNCIQRSHQN +E    F+  L   GI++P+L+++ G I+++ RVLYA  Y +   +KR
Sbjct:    8 YGYVALTGAASFLLMVHLAHGVVKARKKYNVPYPTMYSDDPETGRIFNCIQRSHQNTIEILSPFLFHLSVGGIQHPRLASVLGMIWIVSRVLYAQGYSTGKPQKR 112          
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Zebrafish
Match: mgst3a (microsomal glutathione S-transferase 3a [Source:ZFIN;Acc:ZDB-GENE-040426-2767])

HSP 1 Score: 87.4261 bits (215), Expect = 1.742e-21
Identity = 45/105 (42.86%), Postives = 67/105 (63.81%), Query Frame = 2
Query:  164 YGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSDSSVE---FNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKR 469
            YG V L    ++++ ++L   VVKARK+Y++ YP MYSD       FNCIQRSHQN +E    F+  L   GI++P+L+++ G I+++ RVLYA  Y +   +KR
Sbjct:    8 YGYVALTGAASFLLMVHLAHGVVKARKKYNVPYPTMYSDDPETGRIFNCIQRSHQNTIEILSPFLFHLSVGGIQHPRLASVLGMIWIVSRVLYAQGYSTGKPQKR 112          
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Zebrafish
Match: mgst3a (microsomal glutathione S-transferase 3a [Source:ZFIN;Acc:ZDB-GENE-040426-2767])

HSP 1 Score: 82.8037 bits (203), Expect = 4.303e-20
Identity = 43/99 (43.43%), Postives = 64/99 (64.65%), Query Frame = 2
Query:  164 YGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSDSSVE---FNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKS 451
            YG V L    ++++ ++L   VVKARK+Y++ YP MYSD       FNCIQRSHQN +E    F+  L   GI++P+L+++ G I+++ RVLYA  Y +
Sbjct:    8 YGYVALTGAASFLLMVHLAHGVVKARKKYNVPYPTMYSDDPETGRIFNCIQRSHQNTIEILSPFLFHLSVGGIQHPRLASVLGMIWIVSRVLYAQGYST 106          
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Xenopus
Match: sigirr (single immunoglobulin and toll-interleukin 1 receptor (TIR) domain [Source:Xenbase;Acc:XB-GENE-492815])

HSP 1 Score: 96.6709 bits (239), Expect = 5.660e-25
Identity = 48/108 (44.44%), Postives = 69/108 (63.89%), Query Frame = 2
Query:  164 YGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSDSSVE---FNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVG 478
            YG V+L    ++++  +L I V KARK+Y +EYP+MYSD       FNCIQR+HQN LES   F+ FL   G+ +P+ ++  G  +++GR LYAH Y + D  KR+ G
Sbjct:    8 YGYVVLTGAASFIMVTHLAINVGKARKQYKVEYPKMYSDDPENGNIFNCIQRAHQNTLESYPPFLFFLAVGGLTHPRATSALGVAWIVGRELYAHGYSTGDPSKRMRG 115          
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Xenopus
Match: post2 (posterior protein 2 [Source:Xenbase;Acc:XB-GENE-5867592])

HSP 1 Score: 79.337 bits (194), Expect = 1.185e-18
Identity = 35/88 (39.77%), Postives = 59/88 (67.05%), Query Frame = 2
Query:  209 MYLTIRVVKARKEYHIEYPQMYSDSSVEFNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRI 472
            MYL+++V+ ARK+Y ++YP+MYS   + FNC+QR+HQN +E    ++ F L +G+ +P  + + G I++  R  YA  Y + D +KR+
Sbjct:    3 MYLSMKVMGARKKYGVKYPEMYSKDQM-FNCVQRAHQNTMEVYPVWVIFQLIAGLAFPLAAAVLGAIWVTSRFSYAWGYYTGDPQKRM 89          
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Mouse
Match: Mgst3 (microsomal glutathione S-transferase 3 [Source:MGI Symbol;Acc:MGI:1913697])

HSP 1 Score: 88.5817 bits (218), Expect = 6.642e-22
Identity = 49/113 (43.36%), Postives = 72/113 (63.72%), Query Frame = 2
Query:  164 YGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYS---DSSVEFNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVGFRISL 493
            YG VLL    ++++ ++L I V KARK+Y +EYP MYS   ++   FNCIQR+HQN LE    F+ FL   G+ +P++++  G  +++GRVLYA+ Y + D  KR  G   SL
Sbjct:    8 YGFVLLTGAASFVMVLHLAINVGKARKKYKVEYPVMYSTDPENGHMFNCIQRAHQNTLEVYPPFLFFLTVGGVYHPRIASGLGLAWIIGRVLYAYGYYTGDPSKRYRGAVGSL 120          
BLAST of Microsomal glutathione S-transferase, putative vs. UniProt/SwissProt
Match: sp|Q9CPU4|MGST3_MOUSE (Microsomal glutathione S-transferase 3 OS=Mus musculus OX=10090 GN=Mgst3 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 4.646e-21
Identity = 49/113 (43.36%), Postives = 72/113 (63.72%), Query Frame = 2
Query:  164 YGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYS---DSSVEFNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVGFRISL 493
            YG VLL    ++++ ++L I V KARK+Y +EYP MYS   ++   FNCIQR+HQN LE    F+ FL   G+ +P++++  G  +++GRVLYA+ Y + D  KR  G   SL
Sbjct:    8 YGFVLLTGAASFVMVLHLAINVGKARKKYKVEYPVMYSTDPENGHMFNCIQRAHQNTLEVYPPFLFFLTVGGVYHPRIASGLGLAWIIGRVLYAYGYYTGDPSKRYRGAVGSL 120          
BLAST of Microsomal glutathione S-transferase, putative vs. UniProt/SwissProt
Match: sp|O14880|MGST3_HUMAN (Microsomal glutathione S-transferase 3 OS=Homo sapiens OX=9606 GN=MGST3 PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 7.638e-20
Identity = 49/117 (41.88%), Postives = 71/117 (60.68%), Query Frame = 2
Query:  164 YGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSDSSVE---FNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVGF--RISLFG 499
            YG VLL    ++++  +L I V KARK+Y +EYP MYS        FNCIQR+HQN LE    F+ FL   G+ +P++++  G  +++GRVLYA+ Y + +  KR  G    I+L G
Sbjct:    8 YGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLG 124          
BLAST of Microsomal glutathione S-transferase, putative vs. UniProt/SwissProt
Match: sp|Q3T100|MGST3_BOVIN (Microsomal glutathione S-transferase 3 OS=Bos taurus OX=9913 GN=MGST3 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.521e-19
Identity = 45/108 (41.67%), Postives = 67/108 (62.04%), Query Frame = 2
Query:  164 YGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSDSSVE---FNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVG 478
            YG V+L    ++++  +L I V KARK+Y +EYP MYS        FNCIQR+HQN LE    F+ FL   G+ +P++ +  G  +++GRVLYA+ Y + + +KR  G
Sbjct:    8 YGFVILTGAASFLMVTHLAINVSKARKKYKVEYPTMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIVSGLGLAWIVGRVLYAYGYYTGEPRKRQRG 115          
BLAST of Microsomal glutathione S-transferase, putative vs. UniProt/SwissProt
Match: sp|P73795|Y1147_SYNY3 (Uncharacterized protein sll1147 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1147 PE=3 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 8.453e-9
Identity = 35/103 (33.98%), Postives = 55/103 (53.40%), Query Frame = 2
Query:  200 MVNMYLTIRVVKARKEYHIEYPQMYSDSSVEFNCIQRSHQNFLESTLFFIPFL-LFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVGFRISLFGGM 505
            M+ + L I V +AR +Y +  P   +  + +F  + R   N LE   FF+P L LF+    P ++ + G ++LLGR+LYA  Y     +KR+VGF +     M
Sbjct:   18 MLYLVLVINVGRARAKYGVMPPA--TTGNEDFERVLRVQYNTLEQLAFFLPGLWLFAIYRDPTIAAILGAVWLLGRILYAWGYYQAA-EKRMVGFALGSLSSM 117          
BLAST of Microsomal glutathione S-transferase, putative vs. UniProt/SwissProt
Match: sp|Q99735|MGST2_HUMAN (Microsomal glutathione S-transferase 2 OS=Homo sapiens OX=9606 GN=MGST2 PE=1 SV=1)

HSP 1 Score: 48.1358 bits (113), Expect = 4.653e-6
Identity = 35/94 (37.23%), Postives = 51/94 (54.26%), Query Frame = 2
Query:  212 YLTIRVVKARKEYHIEYPQMYSDSSVEFNCIQRSHQNFLESTLFFIPFLLFSGIEYPKL-STLAGNIYLLGRVLYAHKYKSTDIKKRIVGFRIS 490
            Y  ++V KAR +Y +  P +    S EF  + R+ QN +E    FI  L  +G  + ++ +T  G +Y+ GR LY   Y S   KKRI GFR+S
Sbjct:   21 YFALQVGKARLKYKVTPPAV--TGSPEFERVFRAQQNCVEFYPIFIITLWMAGWYFNQVFATCLGLVYIYGRHLYFWGY-SEAAKKRITGFRLS 111          
BLAST of Microsomal glutathione S-transferase, putative vs. TrEMBL
Match: A0A131YGX4 (Glutathione S-transferase OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 1.441e-32
Identity = 60/116 (51.72%), Postives = 81/116 (69.83%), Query Frame = 2
Query:  131 ALAHRDIFPAGYGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSDSSVEFNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVG 478
            A A+  + P  YG V+LV V + +VNM+L  RV +ARK++ I+YP MYSD++V FNC+QRSHQNFLES   F+  L   G+EYPKL+  AG +YL GR++YA  Y + D  KR+ G
Sbjct:    2 AAAYSLVVPKEYGYVVLVGVGSAIVNMWLAFRVGRARKQFDIKYPTMYSDTNVVFNCVQRSHQNFLESYPQFLMTLFLGGVEYPKLAACAGVVYLAGRIVYAIGYSTGDPSKRMRG 117          
BLAST of Microsomal glutathione S-transferase, putative vs. TrEMBL
Match: A0A131XKS3 (Putative microsomal glutathione s-transferase OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 3.631e-31
Identity = 58/114 (50.88%), Postives = 78/114 (68.42%), Query Frame = 2
Query:  137 AHRDIFPAGYGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSDSSVEFNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVG 478
            A+  + P  YG VL V V + +VNM+L  RV +ARK + ++YP MYSD++V FNCIQRSHQNFLES   F+  L   G+EYP+L+  AG +YL GR++YA  Y + D  KR+ G
Sbjct:    3 AYSLVVPKEYGYVLFVGVGSAIVNMWLAFRVGRARKRFDVKYPAMYSDTNVVFNCIQRSHQNFLESYPQFLMMLFLGGLEYPRLAACAGVVYLAGRIVYAIGYSTGDPSKRMRG 116          
BLAST of Microsomal glutathione S-transferase, putative vs. TrEMBL
Match: A0A267GFD9 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010869g3 PE=4 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 9.004e-31
Identity = 56/112 (50.00%), Postives = 75/112 (66.96%), Query Frame = 2
Query:  143 RDIFPAGYGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSDSSVEFNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVG 478
            ++  P  YG V+L     ++VNM+L  +V  ARK++ +EYP MYSDSS EFNC+QRSHQN+LE+  FF   L F G++ P+ S   G +YLLGR+ YA  Y S D KKR+ G
Sbjct:   20 QNGLPKDYGWVVLAGTGGFVVNMHLARQVGLARKKFGVEYPTMYSDSSKEFNCVQRSHQNYLENAPFFYFLLAFGGLQAPRCSAACGALYLLGRIAYARGYSSGDPKKRMRG 131          
BLAST of Microsomal glutathione S-transferase, putative vs. TrEMBL
Match: A0A1I8H3B2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 9.276e-31
Identity = 56/112 (50.00%), Postives = 75/112 (66.96%), Query Frame = 2
Query:  143 RDIFPAGYGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSDSSVEFNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVG 478
            ++  P  YG V+L     ++VNM+L  +V  ARK++ +EYP MYSDSS EFNC+QRSHQN+LE+  FF   L F G++ P+ S   G +YLLGR+ YA  Y S D KKR+ G
Sbjct:   15 QNGLPKDYGWVVLAGTGGFVVNMHLARQVGLARKKFGVEYPTMYSDSSKEFNCVQRSHQNYLENAPFFYFLLAFGGLQAPRCSAACGALYLLGRIAYARGYSSGDPKKRMRG 126          
BLAST of Microsomal glutathione S-transferase, putative vs. TrEMBL
Match: A0A023GEX8 (Putative microsomal glutathione s-transferase ixodes scapularis microsomal glutathione s-transferase OS=Amblyomma triste OX=251400 PE=2 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.614e-30
Identity = 56/110 (50.91%), Postives = 78/110 (70.91%), Query Frame = 2
Query:  149 IFPAGYGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSDSSVEFNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVG 478
            + P  YG V+LV V + +VNM+L  RV +ARK+Y ++YP MYSD+++ FNCIQRSHQNFLES   F+  L   G E+PK++ +AG ++L GRV+YA  Y + D  KR+ G
Sbjct:    7 VIPKEYGYVVLVGVGSSLVNMWLAFRVGRARKQYGVKYPAMYSDNNIVFNCIQRSHQNFLESYPQFLMTLFLGGFEFPKVAAIAGVVFLAGRVVYALGYSTGDPAKRMRG 116          
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Cavefish
Match: mgst3b (microsomal glutathione S-transferase 3-like [Source:NCBI gene;Acc:111189777])

HSP 1 Score: 91.2781 bits (225), Expect = 3.429e-23
Identity = 49/122 (40.16%), Postives = 75/122 (61.48%), Query Frame = 2
Query:  146 DIFPAGYGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSDSSVEFNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVGF--RISLFGGM 505
            DI PA +G V+L  + ++++  YL ++V  ARK+Y+I+YP MYSD    FNCIQR+HQN LE    ++ F   + + YP ++++ G I++  R  YA  Y + +  KR+ G    I LFG M
Sbjct:    5 DILPANFGYVILTYLYSWIMLTYLAVKVGGARKKYNIKYPTMYSDKEDVFNCIQRAHQNTLEVYPQWLVFQTIAALVYPTVASVLGVIWVTSRFSYAWGYYTGNPVKRMNGSYGYIGLFGVM 126          
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Cavefish
Match: mgst3b (microsomal glutathione S-transferase 3b [Source:ZFIN;Acc:ZDB-GENE-061215-48])

HSP 1 Score: 91.2781 bits (225), Expect = 3.887e-23
Identity = 49/122 (40.16%), Postives = 75/122 (61.48%), Query Frame = 2
Query:  146 DIFPAGYGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSDSSVEFNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVGF--RISLFGGM 505
            DI PA +G V+L  + ++++  YL ++V  ARK+Y+I+YP MYSD    FNCIQR+HQN LE    ++ F   + + YP ++++ G I++  R  YA  Y + +  KR+ G    I LFG M
Sbjct:    5 DILPANFGYVILTYLYSWIMLTYLAVKVGGARKKYNIKYPTMYSDKEDVFNCIQRAHQNTLEVYPQWLVFQTIAALVYPTVASVLGVIWVTSRFSYAWGYYTGNPVKRMNGSYGYIGLFGVM 126          
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Sea Lamprey
Match: mgst3a (microsomal glutathione S-transferase 3a [Source:ZFIN;Acc:ZDB-GENE-040426-2767])

HSP 1 Score: 96.2857 bits (238), Expect = 1.026e-25
Identity = 46/106 (43.40%), Postives = 70/106 (66.04%), Query Frame = 2
Query:  164 YGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSDSSVE---FNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRI 472
            YG V+L  V + ++  YL IRV  ARK+Y + YP+MYS+       FNCIQR+HQN LE    F+  L+  G+++P++S+  G +++LGR +YAH Y + D +KR+
Sbjct:    8 YGCVVLTGVASTLLVTYLGIRVGMARKKYKVLYPEMYSNDPEHGHIFNCIQRAHQNTLEGYPVFLFLLMTGGLQHPRISSALGGVWILGRFVYAHGYSTGDPRKRM 113          
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Nematostella
Match: EDO44678 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV33])

HSP 1 Score: 89.3521 bits (220), Expect = 7.888e-23
Identity = 47/105 (44.76%), Postives = 70/105 (66.67%), Query Frame = 2
Query:  164 YGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSDSSVEFNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVG 478
            YG V+L  + +  +  YL IRV  ARK++ I+YP+MY D  + FNC+QR+HQN LE+   F+  L   G+E+P + +LAG +++LGR++YAH Y + D  KR  G
Sbjct:   10 YGYVVLTGISSAFMLTYLGIRVGVARKKFKIQYPKMYDDKEIVFNCVQRAHQNTLENYPQFLMLLFLGGLEHPIVCSLAGLVWILGRIVYAHGYYTGDPSKRSRG 114          
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Medaka
Match: ENSORLT00000045035.1 (microsomal glutathione S-transferase 3 [Source:NCBI gene;Acc:101173739])

HSP 1 Score: 89.7373 bits (221), Expect = 1.690e-22
Identity = 46/108 (42.59%), Postives = 70/108 (64.81%), Query Frame = 2
Query:  164 YGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSD---SSVEFNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVG 478
            YG V+L    + ++  +L ++V KARK+Y++ YP+MYSD   + V FNCIQR+HQN LE    F+  L   G+  P+L +  G ++++GR +YAH Y + D KKR+ G
Sbjct:    8 YGYVVLTGFASMIMVGHLAVKVGKARKKYNVPYPKMYSDDPETGVIFNCIQRAHQNTLELYPAFLFCLAVGGLHCPRLVSGLGMVWIVGREVYAHGYATGDPKKRMRG 115          
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Medaka
Match: ENSORLT00000042109.1 (microsomal glutathione S-transferase 3 [Source:NCBI gene;Acc:101173739])

HSP 1 Score: 89.7373 bits (221), Expect = 2.172e-22
Identity = 46/108 (42.59%), Postives = 70/108 (64.81%), Query Frame = 2
Query:  164 YGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSD---SSVEFNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVG 478
            YG V+L    + ++  +L ++V KARK+Y++ YP+MYSD   + V FNCIQR+HQN LE    F+  L   G+  P+L +  G ++++GR +YAH Y + D KKR+ G
Sbjct:   15 YGYVVLTGFASMIMVGHLAVKVGKARKKYNVPYPKMYSDDPETGVIFNCIQRAHQNTLELYPAFLFCLAVGGLHCPRLVSGLGMVWIVGREVYAHGYATGDPKKRMRG 122          
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Medaka
Match: ENSORLT00000012768.2 (microsomal glutathione S-transferase 3 [Source:NCBI gene;Acc:101173739])

HSP 1 Score: 89.7373 bits (221), Expect = 2.346e-21
Identity = 46/108 (42.59%), Postives = 70/108 (64.81%), Query Frame = 2
Query:  164 YGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSD---SSVEFNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVG 478
            YG V+L    + ++  +L ++V KARK+Y++ YP+MYSD   + V FNCIQR+HQN LE    F+  L   G+  P+L +  G ++++GR +YAH Y + D KKR+ G
Sbjct:  122 YGYVVLTGFASMIMVGHLAVKVGKARKKYNVPYPKMYSDDPETGVIFNCIQRAHQNTLELYPAFLFCLAVGGLHCPRLVSGLGMVWIVGREVYAHGYATGDPKKRMRG 229          
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Medaka
Match: mgst3b (microsomal glutathione S-transferase 3 [Source:NCBI gene;Acc:101161354])

HSP 1 Score: 84.7297 bits (208), Expect = 1.191e-20
Identity = 40/109 (36.70%), Postives = 66/109 (60.55%), Query Frame = 2
Query:  152 FPAGYGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSDSSVEFNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVG 478
             P+ +G V+   + ++++  YL ++V  ARK+Y ++YP MYSD    FNCIQR+HQN LE    ++ F   + + YP  +++ G I++  R  YA  Y + D +KR+ G
Sbjct:    7 LPSDFGYVIFTYLYSWIMMAYLAVKVGAARKKYGVKYPAMYSDKDQVFNCIQRAHQNTLEVYPQWLVFQTIAALVYPLTASVLGAIWVTSRFSYAWGYYTGDPEKRMKG 115          
BLAST of Microsomal glutathione S-transferase, putative vs. Planmine SMEST
Match: SMESG000078591.1 (SMESG000078591.1)

HSP 1 Score: 283.878 bits (725), Expect = 1.007e-98
Identity = 154/156 (98.72%), Postives = 156/156 (100.00%), Query Frame = 2
Query:  101 MGSDISKEIRALAHRDIFPAGYGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSDSSVEFNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVGFRISLFGGMXXXXXXXXXXXXXXXKRSRLG 568
            MGSDISKEIRALAHRDIFPAGYGGVLLVLVETYMVNMYLTIRVVKARKEYH+EYPQMYSDSSVEFNCIQRSHQNFLESTLFFIPFLLFSGIEYP+LSTLAGNIYLLGRVLYAHKYKSTDIKKRIVGFRISLFGGMLPLISLTSLLAITTLKRSRLG
Sbjct:    1 MGSDISKEIRALAHRDIFPAGYGGVLLVLVETYMVNMYLTIRVVKARKEYHVEYPQMYSDSSVEFNCIQRSHQNFLESTLFFIPFLLFSGIEYPRLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVGFRISLFGGMLPLISLTSLLAITTLKRSRLG 156          
BLAST of Microsomal glutathione S-transferase, putative vs. Planmine SMEST
Match: SMESG000078588.1 (SMESG000078588.1)

HSP 1 Score: 182.956 bits (463), Expect = 5.360e-59
Identity = 82/135 (60.74%), Postives = 108/135 (80.00%), Query Frame = 2
Query:  101 MGSDISKEIRALAHRDIFPAGYGGVLLVLVETYMVNMYLTIRVVKARKEYHIEYPQMYSDSSVEFNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVGFRISLFGGM 505
            MGS ISK+   + HR+IF   YGGVLLVLVE+Y++NMYL IRVV+ARK+Y +E+P +YSD S++FNCIQR HQN+LESTLFFIPFLL SG++YP+ + L G  YLLGR+ YAH Y + ++ KR  G ++S+FGG+
Sbjct:    1 MGSFISKDCYEIVHRNIFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMDFNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCGMKMSMFGGL 135          
The following BLAST results are available for this feature:
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MGST31.005e-2041.12microsomal glutathione S-transferase 3 [Source:HGN... [more]
MGST31.590e-2041.88microsomal glutathione S-transferase 3 [Source:HGN... [more]
MGST31.590e-2041.88microsomal glutathione S-transferase 3 [Source:HGN... [more]
MGST32.098e-2041.88microsomal glutathione S-transferase 3 [Source:HGN... [more]
MGST32.098e-2041.88microsomal glutathione S-transferase 3 [Source:HGN... [more]
back to top
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mgst3b3.411e-2338.71microsomal glutathione S-transferase 3b [Source:ZF... [more]
mgst3a1.742e-2142.86microsomal glutathione S-transferase 3a [Source:ZF... [more]
mgst3a1.742e-2142.86microsomal glutathione S-transferase 3a [Source:ZF... [more]
mgst3a1.742e-2142.86microsomal glutathione S-transferase 3a [Source:ZF... [more]
mgst3a4.303e-2043.43microsomal glutathione S-transferase 3a [Source:ZF... [more]
back to top
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sigirr5.660e-2544.44single immunoglobulin and toll-interleukin 1 recep... [more]
post21.185e-1839.77posterior protein 2 [Source:Xenbase;Acc:XB-GENE-58... [more]
back to top
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Mgst36.642e-2243.36microsomal glutathione S-transferase 3 [Source:MGI... [more]
back to top
BLAST of Microsomal glutathione S-transferase, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CPU4|MGST3_MOUSE4.646e-2143.36Microsomal glutathione S-transferase 3 OS=Mus musc... [more]
sp|O14880|MGST3_HUMAN7.638e-2041.88Microsomal glutathione S-transferase 3 OS=Homo sap... [more]
sp|Q3T100|MGST3_BOVIN1.521e-1941.67Microsomal glutathione S-transferase 3 OS=Bos taur... [more]
sp|P73795|Y1147_SYNY38.453e-933.98Uncharacterized protein sll1147 OS=Synechocystis s... [more]
sp|Q99735|MGST2_HUMAN4.653e-637.23Microsomal glutathione S-transferase 2 OS=Homo sap... [more]
back to top
BLAST of Microsomal glutathione S-transferase, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A131YGX41.441e-3251.72Glutathione S-transferase OS=Rhipicephalus appendi... [more]
A0A131XKS33.631e-3150.88Putative microsomal glutathione s-transferase OS=H... [more]
A0A267GFD99.004e-3150.00Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8H3B29.276e-3150.00Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A023GEX81.614e-3050.91Putative microsomal glutathione s-transferase ixod... [more]
back to top
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mgst3b3.429e-2340.16microsomal glutathione S-transferase 3-like [Sourc... [more]
mgst3b3.887e-2340.16microsomal glutathione S-transferase 3b [Source:ZF... [more]
back to top
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mgst3a1.026e-2543.40microsomal glutathione S-transferase 3a [Source:ZF... [more]
back to top
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO446787.888e-2344.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Microsomal glutathione S-transferase, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000045035.11.690e-2242.59microsomal glutathione S-transferase 3 [Source:NCB... [more]
ENSORLT00000042109.12.172e-2242.59microsomal glutathione S-transferase 3 [Source:NCB... [more]
ENSORLT00000012768.22.346e-2142.59microsomal glutathione S-transferase 3 [Source:NCB... [more]
mgst3b1.191e-2036.70microsomal glutathione S-transferase 3 [Source:NCB... [more]
back to top
BLAST of Microsomal glutathione S-transferase, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000078591.11.007e-9898.72SMESG000078591.1[more]
SMESG000078588.15.360e-5960.74SMESG000078588.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019657 ID=SMED30019657|Name=Microsomal glutathione S-transferase, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=644bp
CTCAAAATATTTATAGTAAATGTATCAATTAAAAGAATTTGAAAATTTGT
TGTTGATTGATTCTAAAAAAACTAATTTGTAAACAATATTAATTTTTAAT
ATGGGGAGTGATATTTCTAAAGAGATTCGTGCCTTAGCTCATAGAGATAT
TTTTCCAGCCGGCTATGGTGGAGTACTATTGGTATTAGTAGAAACATATA
TGGTTAATATGTATTTGACAATTAGAGTAGTAAAGGCTCGAAAAGAATAT
CATATTGAGTATCCACAAATGTATTCCGATTCTAGTGTGGAATTTAATTG
CATTCAACGTTCTCATCAAAATTTCTTAGAATCCACTTTATTTTTCATTC
CTTTTCTTTTATTTAGTGGGATTGAATATCCTAAATTGTCTACACTGGCT
GGAAATATTTATTTATTGGGCAGAGTGCTTTATGCTCATAAATATAAGTC
TACTGATATTAAAAAACGAATTGTGGGGTTTAGAATCAGTTTATTTGGTG
GAATGCTTCCGTTGATCAGTTTAACGAGTCTTTTGGCTATAACCACGCTA
AAGCGCTCACGTTTGGGATAAACAATTAAAAAATATAGTTATAGTGTCTA
GGTTTTCATAATAAATTATATTCTTTCTTTTTAAAAAAAAAGAT
back to top

protein sequence of SMED30019657-orf-1

>SMED30019657-orf-1 ID=SMED30019657-orf-1|Name=SMED30019657-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=157bp
MGSDISKEIRALAHRDIFPAGYGGVLLVLVETYMVNMYLTIRVVKARKEY
HIEYPQMYSDSSVEFNCIQRSHQNFLESTLFFIPFLLFSGIEYPKLSTLA
GNIYLLGRVLYAHKYKSTDIKKRIVGFRISLFGGMLPLISLTSLLAITTL
KRSRLG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR023352MAPEG-like_dom_sf
IPR001129Membr-assoc_MAPEG
Vocabulary: molecular function
TermDefinition
GO:0004364glutathione transferase activity
GO:0004602glutathione peroxidase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005635nuclear envelope
GO:0005783endoplasmic reticulum
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0098869cellular oxidant detoxification
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR023352Membrane associated eicosanoid/glutathione metabolism-like domain superfamilyGENE3DG3DSA:1.20.120.550coord: 19..154
e-value: 2.5E-33
score: 116.8
IPR023352Membrane associated eicosanoid/glutathione metabolism-like domain superfamilySUPERFAMILYSSF161084MAPEG domain-likecoord: 18..137
IPR001129Membrane-associated, eicosanoid/glutathione metabolism (MAPEG) proteinPFAMPF01124MAPEGcoord: 28..133
e-value: 6.4E-19
score: 68.1
NoneNo IPR availablePANTHERPTHR10250MICROSOMAL GLUTATHIONE S-TRANSFERASEcoord: 18..151
NoneNo IPR availablePANTHERPTHR10250:SF17MICROSOMAL GLUTATHIONE S-TRANSFERASE 3coord: 18..151
NoneNo IPR availableTMHMMTMhelixcoord: 20..39
NoneNo IPR availableTMHMMTMhelixcoord: 124..146