SMED30019652

Overview
NameSMED30019652
Smed IDSMED30019652
Length (bp)1411
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30019652 (SMED30019652) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30019652 (SMED30019652) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30019652 (SMED30019652) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30019652 (SMED30019652) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019652

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30019652h1SMcG0008876 SmedASXL_001396SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30019652h1SMcG0008876 dd_Smed_v4_8438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019652h1SMcG0008876 dd_Smed_v4_8438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30019652h1SMcG0008876 dd_Smed_v4_8438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019652h1SMcG0008876 dd_Smed_v4_8438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30019652h1SMcG0008876 dd_Smed_v6_8438_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30019652 vs. Ensembl Human
Match: SYT17 (synaptotagmin 17 [Source:HGNC Symbol;Acc:HGNC:24119])

HSP 1 Score: 53.1434 bits (126), Expect = 6.545e-7
Identity = 49/220 (22.27%), Postives = 105/220 (47.73%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVT-TSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQ------INETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYW 1252
            +++ L P       T +  +++ P+++++  F     E + + L+L + + ++FSR   +      L EV    G H     + S   +V+  GE+ L+ +Y  ++ R+  D++ ++ LL   +++ ++ F+KIQ +   KL+K         + +S L+       NE+   KVP   L   ++  ++    M   +  +  +  GQ S +GP+E+ +W
Sbjct:  227 VKICLLPDQKNSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDKFSRHCVIGKVSVPLCEVDLVKGGHWWKALIPSSQNEVE-LGELLLSLNYLPSAGRLNVDVIRAKQLLQTDVSQGSDPFVKIQLVHGLKLVKT--------KKTSFLRGTIDPFYNESFSFKVPQEELENASLVFTVFGHNMKSSNDFIGRIVIGQYS-SGPSETNHW 436          
BLAST of SMED30019652 vs. Ensembl Human
Match: SYT17 (synaptotagmin 17 [Source:HGNC Symbol;Acc:HGNC:24119])

HSP 1 Score: 53.1434 bits (126), Expect = 6.642e-7
Identity = 49/220 (22.27%), Postives = 105/220 (47.73%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVT-TSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQ------INETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYW 1252
            +++ L P       T +  +++ P+++++  F     E + + L+L + + ++FSR   +      L EV    G H     + S   +V+  GE+ L+ +Y  ++ R+  D++ ++ LL   +++ ++ F+KIQ +   KL+K         + +S L+       NE+   KVP   L   ++  ++    M   +  +  +  GQ S +GP+E+ +W
Sbjct:  231 VKICLLPDQKNSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDKFSRHCVIGKVSVPLCEVDLVKGGHWWKALIPSSQNEVE-LGELLLSLNYLPSAGRLNVDVIRAKQLLQTDVSQGSDPFVKIQLVHGLKLVKT--------KKTSFLRGTIDPFYNESFSFKVPQEELENASLVFTVFGHNMKSSNDFIGRIVIGQYS-SGPSETNHW 440          
BLAST of SMED30019652 vs. Ensembl Human
Match: SYT17 (synaptotagmin 17 [Source:HGNC Symbol;Acc:HGNC:24119])

HSP 1 Score: 51.9878 bits (123), Expect = 1.500e-6
Identity = 49/220 (22.27%), Postives = 105/220 (47.73%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVT-TSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQ------INETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYW 1252
            +++ L P       T +  +++ P+++++  F     E + + L+L + + ++FSR   +      L EV    G H     + S   +V+  GE+ L+ +Y  ++ R+  D++ ++ LL   +++ ++ F+KIQ +   KL+K         + +S L+       NE+   KVP   L   ++  ++    M   +  +  +  GQ S +GP+E+ +W
Sbjct:  170 VKICLLPDQKNSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDKFSRHCVIGKVSVPLCEVDLVKGGHWWKALIPSSQNEVE-LGELLLSLNYLPSAGRLNVDVIRAKQLLQTDVSQGSDPFVKIQLVHGLKLVKT--------KKTSFLRGTIDPFYNESFSFKVPQEELENASLVFTVFGHNMKSSNDFIGRIVIGQYS-SGPSETNHW 379          
BLAST of SMED30019652 vs. Ensembl Fly
Match: Syt7 (gene:FBgn0039900 transcript:FBtr0089139)

HSP 1 Score: 48.1358 bits (113), Expect = 7.525e-6
Identity = 53/239 (22.18%), Postives = 103/239 (43.10%), Query Frame = 2
Query:  590 LSTAPSLMMRVSLDPASDQINFTSIHSRSKNPIWKDQLMF-NFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVTTSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKI--QFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYWSDFIRDIPASGRKQW 1297
            LS      +RV+L P       T I  R+ NP W +   F  F   + + + L L +++ +RFSR   +      L +V  +G  +    L+    D    GE+  +  Y+ ++S +   ++++R+L    +N K++ ++K+  QF +K+   +          P      NE+    VP   +   ++ + + D   I  +  +  +     +G+G +E+ +W D I   P     QW
Sbjct:   46 LSGTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLPLCQVDFAGKQSFWKALKPPAKD--KCGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPV----FNESFSFNVPWEKIRECSLDVMVMDFDNIGRNELIGRILLAGKNGSGASETKHWQDMISK-PRQTVVQW 277          
BLAST of SMED30019652 vs. Ensembl Zebrafish
Match: syt17 (synaptotagmin XVII [Source:ZFIN;Acc:ZDB-GENE-090527-1])

HSP 1 Score: 57.3806 bits (137), Expect = 2.383e-8
Identity = 51/214 (23.83%), Postives = 110/214 (51.40%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVT-TSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYW 1252
            +++SL P +     T +  +++NP+++++  F+    E + + L+L + + ++FSR   +      L EV    G H     + S   +V+  GE+ L+ +Y  ++ R+  DI+ ++ LL   + + ++ F+K+Q +   KL+K KK+S  +         NE+   +VP   L  +++ +++    +   +  +  +  GQ S +GP E+T+W
Sbjct:  231 VKMSLLPDNKNSRQTGVKRKTQNPVFEERFTFDLPFLEAQRRTLLLSVVDFDKFSRHCVIGKVALPLSEVDLVKGGHWWKALVPSSQNEVE-LGELLLSLNYLPSAGRLNVDIIRAKQLLQTDMCQGSDPFVKVQLVTGLKLMKSKKTSCMRGTIDPC--YNESFSFRVPQEDLCEVSLVLTVYGHNVKSSNDFVGRIVIGQFS-SGPQETTHW 440          
BLAST of SMED30019652 vs. Ensembl Zebrafish
Match: syt17 (synaptotagmin XVII [Source:ZFIN;Acc:ZDB-GENE-090527-1])

HSP 1 Score: 54.299 bits (129), Expect = 1.541e-7
Identity = 32/137 (23.36%), Postives = 73/137 (53.28%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVT-TSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFL 1021
            +++SL P +     T +  +++NP+++++  F+    E + + L+L + + ++FSR   +      L EV    G H     + S   +V+  GE+ L+ +Y  ++ R+  DI+ ++ LL   + + ++ F+K+Q +
Sbjct:  155 VKMSLLPDNKNSRQTGVKRKTQNPVFEERFTFDLPFLEAQRRTLLLSVVDFDKFSRHCVIGKVALPLSEVDLVKGGHWWKALVPSSQNEVE-LGELLLSLNYLPSAGRLNVDIIRAKQLLQTDMCQGSDPFVKVQLV 290          
BLAST of SMED30019652 vs. Ensembl Zebrafish
Match: syt17 (synaptotagmin XVII [Source:ZFIN;Acc:ZDB-GENE-090527-1])

HSP 1 Score: 54.299 bits (129), Expect = 1.600e-7
Identity = 32/137 (23.36%), Postives = 73/137 (53.28%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVT-TSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFL 1021
            +++SL P +     T +  +++NP+++++  F+    E + + L+L + + ++FSR   +      L EV    G H     + S   +V+  GE+ L+ +Y  ++ R+  DI+ ++ LL   + + ++ F+K+Q +
Sbjct:  171 VKMSLLPDNKNSRQTGVKRKTQNPVFEERFTFDLPFLEAQRRTLLLSVVDFDKFSRHCVIGKVALPLSEVDLVKGGHWWKALVPSSQNEVE-LGELLLSLNYLPSAGRLNVDIIRAKQLLQTDMCQGSDPFVKVQLV 306          
BLAST of SMED30019652 vs. Ensembl Zebrafish
Match: syt1a (synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-165])

HSP 1 Score: 54.299 bits (129), Expect = 1.692e-7
Identity = 54/229 (23.58%), Postives = 109/229 (47.60%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVTTSGSHNLSLELESWNADVQ-AFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYWSDFIRDIPASGRKQW 1297
            ++V L P   +   T +H ++ NP++ +Q  F     E   + LV+ +Y+ +RFS+   +      + +V  S       +L+S   + Q   G+I  +  Y   + ++   +LE+++L    +   ++ ++KI  ++  K +K KK++  K   +     NE+   +VP   +  + V I++ D   I  + ++  +  G +S TG TE  +WSD + + P     QW
Sbjct:  178 VKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYY--NESFSFEVPFEQIQKVQVVITVLDYDKIGKNDAIGKVFVGLNS-TG-TELRHWSDMLAN-PRRPIAQW 401          
BLAST of SMED30019652 vs. Ensembl Zebrafish
Match: syt1a (synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-165])

HSP 1 Score: 54.299 bits (129), Expect = 1.692e-7
Identity = 54/229 (23.58%), Postives = 109/229 (47.60%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVTTSGSHNLSLELESWNADVQ-AFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYWSDFIRDIPASGRKQW 1297
            ++V L P   +   T +H ++ NP++ +Q  F     E   + LV+ +Y+ +RFS+   +      + +V  S       +L+S   + Q   G+I  +  Y   + ++   +LE+++L    +   ++ ++KI  ++  K +K KK++  K   +     NE+   +VP   +  + V I++ D   I  + ++  +  G +S TG TE  +WSD + + P     QW
Sbjct:  178 VKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYY--NESFSFEVPFEQIQKVQVVITVLDYDKIGKNDAIGKVFVGLNS-TG-TELRHWSDMLAN-PRRPIAQW 401          
BLAST of SMED30019652 vs. Ensembl Xenopus
Match: slc35e1 (solute carrier family 35 member E1 [Source:Xenbase;Acc:XB-GENE-996454])

HSP 1 Score: 56.9954 bits (136), Expect = 3.432e-8
Identity = 51/214 (23.83%), Postives = 103/214 (48.13%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVT-TSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYW 1252
            +++ L P       T +  +++NP+++++  F     E + + L+L + + ++FSR   +      L EV    G H     + S   +V+  GE+ L+ +Y  ++ R+  DI+ ++ LL   +++ ++ F+KIQ +   KL K KK+S  +         NE+   KVP   L  +++  ++    M   +  +  +  GQ   +G  ES +W
Sbjct:  222 VKICLLPDQKNSKQTGVKRKTQNPVFEERYTFEIQFLEAQRRTLLLTIVDFDKFSRHCVIGKVAMPLNEVDLVKGGHWWKAIIPSSQNEVE-LGELLLSLNYLPSAGRLNVDIIRAKQLLQTDMSQGSDPFVKIQLVHGLKLAKTKKTSCMRGTIDPFY--NESFSFKVPQEELENVSLVFTVYGHNMKTSNDFIGRIVIGQ-YASGSPESNHW 431          
BLAST of SMED30019652 vs. Ensembl Xenopus
Match: slc35e1 (solute carrier family 35 member E1 [Source:Xenbase;Acc:XB-GENE-996454])

HSP 1 Score: 56.9954 bits (136), Expect = 3.517e-8
Identity = 51/214 (23.83%), Postives = 103/214 (48.13%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVT-TSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYW 1252
            +++ L P       T +  +++NP+++++  F     E + + L+L + + ++FSR   +      L EV    G H     + S   +V+  GE+ L+ +Y  ++ R+  DI+ ++ LL   +++ ++ F+KIQ +   KL K KK+S  +         NE+   KVP   L  +++  ++    M   +  +  +  GQ   +G  ES +W
Sbjct:  231 VKICLLPDQKNSKQTGVKRKTQNPVFEERYTFEIQFLEAQRRTLLLTIVDFDKFSRHCVIGKVAMPLNEVDLVKGGHWWKAIIPSSQNEVE-LGELLLSLNYLPSAGRLNVDIIRAKQLLQTDMSQGSDPFVKIQLVHGLKLAKTKKTSCMRGTIDPFY--NESFSFKVPQEELENVSLVFTVYGHNMKTSNDFIGRIVIGQ-YASGSPESNHW 440          
BLAST of SMED30019652 vs. Ensembl Xenopus
Match: luzp2 (leucine zipper protein 2 [Source:Xenbase;Acc:XB-GENE-940667])

HSP 1 Score: 52.373 bits (124), Expect = 1.033e-6
Identity = 52/240 (21.67%), Postives = 110/240 (45.83%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVTTS-GSHNLSLELESWNADVQA--------FGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYWSDFIRDIPASGRKQWFPF 1306
            ++V   P   + + T +H ++ NPI+ +   F     E   + L + +Y+ +RFS+       H  + EV     + +L   +E W  D+Q+         G+I ++  Y   + ++   ILE+++L    +   ++ ++KI  ++  K +K KK++  K   +     NE+   ++P   +  + V I++ D   +  + ++  +  G ++    TE  +WSD + + P     QW P 
Sbjct:  185 VKVFFLPDKKKKHETKVHRKTLNPIFNETFTFKIPYQELGGKTLCMSIYDFDRFSK-------HDIIGEVKVPMNTVDLGQPIEEWR-DLQSAEKEEPEKLGDICISLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYF--NESFSFEIPFEQIQKVQVVITVLDYDKLGKNEAIGKIFVGCNASG--TELRHWSDMLAN-PRRPIAQWHPL 411          
BLAST of SMED30019652 vs. Ensembl Xenopus
Match: e2f4 (E2F transcription factor 4 [Source:Xenbase;Acc:XB-GENE-482721])

HSP 1 Score: 50.447 bits (119), Expect = 4.246e-6
Identity = 53/219 (24.20%), Postives = 101/219 (46.12%), Query Frame = 2
Query:  656 TSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRW-----TPVKMAHHSLKEVTTSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYWSDFIRDIPASGRKQW 1297
            T +H ++ NP++ +Q  F     E   + LVL +Y+ +RFS+        V M       VT      +S E E    + +  G+I  +  Y   + ++   ILE+++L    +   ++ ++KI  ++  K +K KK++  K   +     NE+   +VP   +  + V +++ D   I  + ++  +  G +S TG  E  +WSD + + P     QW
Sbjct:  199 TKVHRKTLNPVFNEQFTFKVPYAELGGKTLVLTVYDFDRFSKHDVIGDVKVPMNTVDFGHVTEEWRDLVSAEKE----EQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYY--NESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNS-TG-AELRHWSDMLAN-PRRPIAQW 408          
BLAST of SMED30019652 vs. Ensembl Mouse
Match: Syt17 (synaptotagmin XVII [Source:MGI Symbol;Acc:MGI:104966])

HSP 1 Score: 54.6842 bits (130), Expect = 1.462e-7
Identity = 51/220 (23.18%), Postives = 105/220 (47.73%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVT-TSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQ------INETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYW 1252
            +++ L P       T +  +++ P+++++  F     E + + L+L + + ++FSR   +      L EV    G H     + S   +V+  GE+ L+ +Y  ++ R+  DI+ ++ LL   +++ ++ F+KIQ +   KL+K         + +S L+       NE+   KVP   L   ++  ++    M   +  +  +  GQ S +GP+ES +W
Sbjct:  226 VKICLLPDQKNSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDKFSRHCVIGKVAVPLCEVDLVKGGHWWKALIPSSQNEVE-LGELLLSLNYLPSAGRLNVDIIRAKQLLQTDVSQGSDPFVKIQLVHGLKLVKT--------KKTSFLRGTIDPFYNESFSFKVPQEELENASLVFTVFGHNMKSSNDFIGRIVIGQYS-SGPSESNHW 435          
BLAST of SMED30019652 vs. Ensembl Mouse
Match: Syt17 (synaptotagmin XVII [Source:MGI Symbol;Acc:MGI:104966])

HSP 1 Score: 54.6842 bits (130), Expect = 1.626e-7
Identity = 51/220 (23.18%), Postives = 105/220 (47.73%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVT-TSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQ------INETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYW 1252
            +++ L P       T +  +++ P+++++  F     E + + L+L + + ++FSR   +      L EV    G H     + S   +V+  GE+ L+ +Y  ++ R+  DI+ ++ LL   +++ ++ F+KIQ +   KL+K         + +S L+       NE+   KVP   L   ++  ++    M   +  +  +  GQ S +GP+ES +W
Sbjct:  227 VKICLLPDQKNSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDKFSRHCVIGKVAVPLCEVDLVKGGHWWKALIPSSQNEVE-LGELLLSLNYLPSAGRLNVDIIRAKQLLQTDVSQGSDPFVKIQLVHGLKLVKT--------KKTSFLRGTIDPFYNESFSFKVPQEELENASLVFTVFGHNMKSSNDFIGRIVIGQYS-SGPSESNHW 436          
BLAST of SMED30019652 vs. Ensembl Mouse
Match: Syt17 (synaptotagmin XVII [Source:MGI Symbol;Acc:MGI:104966])

HSP 1 Score: 53.5286 bits (127), Expect = 3.488e-7
Identity = 51/220 (23.18%), Postives = 105/220 (47.73%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVT-TSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQ------INETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYW 1252
            +++ L P       T +  +++ P+++++  F     E + + L+L + + ++FSR   +      L EV    G H     + S   +V+  GE+ L+ +Y  ++ R+  DI+ ++ LL   +++ ++ F+KIQ +   KL+K         + +S L+       NE+   KVP   L   ++  ++    M   +  +  +  GQ S +GP+ES +W
Sbjct:  170 VKICLLPDQKNSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDKFSRHCVIGKVAVPLCEVDLVKGGHWWKALIPSSQNEVE-LGELLLSLNYLPSAGRLNVDIIRAKQLLQTDVSQGSDPFVKIQLVHGLKLVKT--------KKTSFLRGTIDPFYNESFSFKVPQEELENASLVFTVFGHNMKSSNDFIGRIVIGQYS-SGPSESNHW 379          
BLAST of SMED30019652 vs. Ensembl Mouse
Match: Syt17 (synaptotagmin XVII [Source:MGI Symbol;Acc:MGI:104966])

HSP 1 Score: 50.0618 bits (118), Expect = 4.805e-6
Identity = 31/137 (22.63%), Postives = 70/137 (51.09%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVT-TSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFL 1021
            +++ L P       T +  +++ P+++++  F     E + + L+L + + ++FSR   +      L EV    G H     + S   +V+  GE+ L+ +Y  ++ R+  DI+ ++ LL   +++ ++ F+KIQ +
Sbjct:  231 VKICLLPDQKNSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDKFSRHCVIGKVAVPLCEVDLVKGGHWWKALIPSSQNEVE-LGELLLSLNYLPSAGRLNVDIIRAKQLLQTDVSQGSDPFVKIQLV 366          
BLAST of SMED30019652 vs. Ensembl Mouse
Match: Syt2 (synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666])

HSP 1 Score: 49.6766 bits (117), Expect = 5.707e-6
Identity = 53/237 (22.36%), Postives = 109/237 (45.99%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVTTS-GSHNLSLELESWNADVQA--------FGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYWSDFIRDIPASGRKQW 1297
            ++V L P   +   T +H ++ NP + +   F     E   + LV+ +Y+ +RFS+       H  + EV     + +L   +E W  D+Q          G+I  +  Y   + ++   ILE+++L    +   ++ ++KI  ++  K +K KK++  K   +     NE+   ++P   +  + V +++ D   +  + ++  +  G ++ TG TE  +WSD + + P     QW
Sbjct:  182 VKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSK-------HDIIGEVKVPMNTVDLGQPIEEWR-DLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYF--NESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNA-TG-TELRHWSDMLAN-PRRPIAQW 405          
BLAST of SMED30019652 vs. UniProt/SwissProt
Match: sp|A4IJ05|SYT17_XENTR (Synaptotagmin-17 OS=Xenopus tropicalis OX=8364 GN=syt17 PE=2 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 1.863e-7
Identity = 51/214 (23.83%), Postives = 103/214 (48.13%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVT-TSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYW 1252
            +++ L P       T +  +++NP+++++  F     E + + L+L + + ++FSR   +      L EV    G H     + S   +V+  GE+ L+ +Y  ++ R+  DI+ ++ LL   +++ ++ F+KIQ +   KL K KK+S  +         NE+   KVP   L  +++  ++    M   +  +  +  GQ   +G  ES +W
Sbjct:  231 VKICLLPDQKNSKQTGVKRKTQNPVFEERYTFEIQFLEAQRRTLLLTIVDFDKFSRHCVIGKVAMPLNEVDLVKGGHWWKAIIPSSQNEVE-LGELLLSLNYLPSAGRLNVDIIRAKQLLQTDMSQGSDPFVKIQLVHGLKLAKTKKTSCMRGTIDPFY--NESFSFKVPQEELENVSLVFTVYGHNMKTSNDFIGRIVIGQ-YASGSPESNHW 440          
BLAST of SMED30019652 vs. UniProt/SwissProt
Match: sp|Q920M7|SYT17_MOUSE (Synaptotagmin-17 OS=Mus musculus OX=10090 GN=Syt17 PE=1 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.138e-6
Identity = 51/220 (23.18%), Postives = 105/220 (47.73%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVT-TSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQ------INETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYW 1252
            +++ L P       T +  +++ P+++++  F     E + + L+L + + ++FSR   +      L EV    G H     + S   +V+  GE+ L+ +Y  ++ R+  DI+ ++ LL   +++ ++ F+KIQ +   KL+K         + +S L+       NE+   KVP   L   ++  ++    M   +  +  +  GQ S +GP+ES +W
Sbjct:  227 VKICLLPDQKNSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDKFSRHCVIGKVAVPLCEVDLVKGGHWWKALIPSSQNEVE-LGELLLSLNYLPSAGRLNVDIIRAKQLLQTDVSQGSDPFVKIQLVHGLKLVKT--------KKTSFLRGTIDPFYNESFSFKVPQEELENASLVFTVFGHNMKSSNDFIGRIVIGQYS-SGPSESNHW 436          
BLAST of SMED30019652 vs. UniProt/SwissProt
Match: sp|Q62807|SYT17_RAT (Synaptotagmin-17 OS=Rattus norvegicus OX=10116 GN=Syt17 PE=1 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.165e-6
Identity = 51/220 (23.18%), Postives = 105/220 (47.73%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVT-TSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQ------INETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYW 1252
            +++ L P       T +  +++ P+++++  F     E + + L+L + + ++FSR   +      L EV    G H     + S   +V+  GE+ L+ +Y  ++ R+  DI+ ++ LL   +++ ++ F+KIQ +   KL+K         + +S L+       NE+   KVP   L   ++  ++    M   +  +  +  GQ S +GP+ES +W
Sbjct:  231 VKICLLPDQKNSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDKFSRHCVIGKVAVPLCEVDLVKGGHWWKALIPSSQNEVE-LGELLLSLNYLPSAGRLNVDIIRAKQLLQTDVSQGSDPFVKIQLVHGLKLVKT--------KKTSFLRGTIDPFYNESFSFKVPQEELENASLVFTVFGHNMKSSNDFIGRIVIGQYS-SGPSESNHW 440          
BLAST of SMED30019652 vs. UniProt/SwissProt
Match: sp|Q5R8Q5|SYT17_PONAB (Synaptotagmin-17 OS=Pongo abelii OX=9601 GN=SYT17 PE=2 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 1.698e-6
Identity = 50/220 (22.73%), Postives = 105/220 (47.73%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVT-TSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQ------INETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYW 1252
            +++ L P       T +  +++ P+++++  F     E + + L+L + + ++FSR   +      L EV    G H     + S   +V+  GE+ L+ +Y  ++ R+  D++ ++ LL   +++ ++ F+KIQ +   KL+K         + +S L+       NE+   KVP   L   ++  ++    M   +  +  +  GQ S +GP+ES +W
Sbjct:  231 VKICLLPDQKNSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDKFSRHCVIGKVSVPLCEVDLVKGGHWWKALIPSSQNEVE-LGELLLSLNYLPSAGRLNVDVIRAKQLLQTDVSQGSDPFVKIQLVHGLKLVKT--------KKTSFLRGTIDPFYNESFSFKVPQEELENASLVFTVFGHNMKSSNDFIGRIVIGQYS-SGPSESNHW 440          
BLAST of SMED30019652 vs. UniProt/SwissProt
Match: sp|Q9BSW7|SYT17_HUMAN (Synaptotagmin-17 OS=Homo sapiens OX=9606 GN=SYT17 PE=1 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 3.190e-6
Identity = 49/220 (22.27%), Postives = 105/220 (47.73%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVT-TSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQ------INETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYW 1252
            +++ L P       T +  +++ P+++++  F     E + + L+L + + ++FSR   +      L EV    G H     + S   +V+  GE+ L+ +Y  ++ R+  D++ ++ LL   +++ ++ F+KIQ +   KL+K         + +S L+       NE+   KVP   L   ++  ++    M   +  +  +  GQ S +GP+E+ +W
Sbjct:  231 VKICLLPDQKNSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDKFSRHCVIGKVSVPLCEVDLVKGGHWWKALIPSSQNEVE-LGELLLSLNYLPSAGRLNVDVIRAKQLLQTDVSQGSDPFVKIQLVHGLKLVKT--------KKTSFLRGTIDPFYNESFSFKVPQEELENASLVFTVFGHNMKSSNDFIGRIVIGQYS-SGPSETNHW 440          
BLAST of SMED30019652 vs. TrEMBL
Match: A0A556UZP9 (Synaptotagmin-17 OS=Bagarius yarrelli OX=175774 GN=Baya_11579 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 9.009e-7
Identity = 53/219 (24.20%), Postives = 111/219 (50.68%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVT-TSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYWSDFIR 1267
            +++SL P       T +  +++NP+++++  F     E + + L+L + + ++FSR   +      L EV    G H     + S   +V+  GE+ L+ +Y  ++ R+  D++ ++ LL   +++ ++ F+K+Q +   KL+K KK+S  +         NE+   +VP   L+ +++  ++    M   +  +  +  GQ S TGP E+T+W   +R
Sbjct:  299 VKMSLLPDHKNSRQTGVKRKTQNPVFEERFTFELPFLEAQRRTLLLSMLDFDKFSRHCVIGKVALPLSEVDLVKGGHWWKALVPSSQNEVE-LGELLLSLNYLPSAGRLNVDVIRAKQLLQTDMSQGSDPFVKVQLVAGLKLVKTKKTSCMRGTIDPYF--NESFSFRVPQEELSEVSLVFTVYGHNMKSSNDFVGRVVIGQFS-TGPAETTHWRRLLR 513          
BLAST of SMED30019652 vs. TrEMBL
Match: A0A210Q1H4 (Synaptotagmin-17 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07950 PE=4 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 3.958e-6
Identity = 53/216 (24.54%), Postives = 103/216 (47.69%), Query Frame = 2
Query:  617 RVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVTTSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYWSDFI 1264
            +V L P       TS+  +++NP W +  MF    +E + + L +++ + +RFSR   +   +  L  +      ++   L     + Q  GEI L+ +Y  ++ R+  D+++++ LL   +   ++ F+K+  +  +K IK KK++  K     V   NE+V   V    L   ++ I++ D      D  +  +  G+  GTGP E T+W+  +
Sbjct:  211 KVCLLPDQKNSQQTSVQRKTQNPTWNEYFMFEIPFHEAQMRTLEILIKDFDRFSRHCIIGQVYLPLANINLIKGGHMWKPLMPSTKERQDLGEILLSLNYLPSAGRLNIDVIKAKQLLQTDMVGGSDPFVKVTMVHFEKPIKTKKTTCKKNNIDPVF--NESVSFNVTPQQLENTSIVITVWDYNSKSRDDFVGRVVIGK-YGTGPHEFTHWNRML 423          
BLAST of SMED30019652 vs. TrEMBL
Match: A0A5N5MH89 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00040090 PE=4 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 4.047e-6
Identity = 53/219 (24.20%), Postives = 110/219 (50.23%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVT-TSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYWSDFIR 1267
            +++SL P       T +  +++NP+++++  F     E + + L+L + + ++FSR   +      L EV    G H     + S   +V+  GE+ L+ +Y  ++ R+  D++ ++ LL   + + ++ F+K+Q +   KL+K KK+S  +         NE+   +VP   L+ +++  ++    M   +  +  +  GQ S TGP E+T+W   +R
Sbjct:  234 VKMSLLPDHKNSRQTGVKRKTQNPVFEERFTFELPFLEAQRRTLLLSVLDFDKFSRHCVIGKVTLPLSEVDLVKGGHWWKALVPSSQNEVE-LGELLLSLNYLPSAGRLNVDVIRAKQLLQTDMCQGSDPFVKVQLVAGLKLVKTKKTSCMRGTIDPYF--NESFSFRVPHEELSEVSLVFTVYGHNMKSSNDFVGRVVIGQFS-TGPAETTHWRRLLR 448          
BLAST of SMED30019652 vs. TrEMBL
Match: E4X9B7 (Uncharacterized protein OS=Oikopleura dioica OX=34765 GN=GSOID_T00004465001 PE=4 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 5.298e-6
Identity = 55/228 (24.12%), Postives = 109/228 (47.81%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVTTSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYWSDFIRDIPASGRKQW 1297
            ++V L P   + + T +H ++ NP + +Q +FN N NE   + L+L LY+ +RFS+   +   H  L  V     H    +LE  N +++  G++  +  Y   + ++  ++LE+++L    +   ++ ++KI  ++  K +K KK++  K   S     NE    +VP   +  + + +++ D   +  +  +  +  G   G   TE  +WSD +   P     QW
Sbjct:   11 VKVYLLPDRKKKHETKVHRKTLNPTFDEQFIFNVNYNEIGGKTLLLALYDFDRFSKHDMLGQIHVPLSSVDFGQVHLEWRDLEPKNNELR--GDLCFSLRYVPTAGKLTVNVLEAKNLKKMDVGGLSDPYVKISLMQNGKRLKKKKTTIKKNTLSPYY--NEGFTFEVPFEQVQKVTMILTVLDHDKLGNNDPIGRVVVG--CGASGTELRHWSDMLAS-PRRPIAQW 231          
BLAST of SMED30019652 vs. TrEMBL
Match: A0A2B4RXD2 (Synaptotagmin-7 OS=Stylophora pistillata OX=50429 GN=SYT7 PE=4 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 6.010e-6
Identity = 51/233 (21.89%), Postives = 103/233 (44.21%), Query Frame = 2
Query:  611 MMRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVTTSGS----HNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYWSDFIRDIPASGRKQW 1297
            M+ + L P    +  +  H  +++P + +   F     E  E+ L   ++++ R  R TP+    +SLK     G+     NL L  + +       GEI L+  YN A + +   I+++R+L+HF  +   E+F+KI  +     +K K++     E   +   + T+  +VP+  L+Y ++ +++     +    ++     G       +E ++W   I   P    +QW
Sbjct:   60 MVEICLLPEEKPVFESYTHFGNQDPQFNENFSFKLTSAEVNEKTLRFTVFDNKRRHRLTPIGHTLYSLKGQELDGAMTMERNLKLNSQPYG---HTRGEILLSLDYNPAMNTIMVGIIKARNLIHFDAHSNKEFFVKITEVFSGHKVKTKRTPTTDGEKHPIF--HSTLSFQVPVQRLSYTSLVLTLLGRGKMRSKKTVGRAILGPGIYECDSERSHWGRMIMS-PLMRVEQW 286          
BLAST of SMED30019652 vs. Ensembl Cavefish
Match: syt17 (synaptotagmin 17 [Source:NCBI gene;Acc:103039203])

HSP 1 Score: 54.299 bits (129), Expect = 1.893e-7
Identity = 50/219 (22.83%), Postives = 109/219 (49.77%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVT-TSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYWSDFIR 1267
            +++SL P       T +  +++NP+++++  F     E + + L+L + + ++FSR   +      L EV    G H     + S   +V+  GE+ L+ +Y  ++ R+  D++ ++ LL   + + ++ F+K+Q +   KL+K KK+S  +         NE+   +V    L+ +++  ++    +   +  +  +  GQ S +GP E+T+W   +R
Sbjct:  238 VKMSLLPDHKNSRQTGVKRKTQNPVFEERFTFELPFLEAQRRTLLLSVVDFDKFSRHCVIGKVVLPLSEVDLVKGGHWWKALVPSSQNEVE-LGELLLSLNYLPSAGRLNVDVIRAKQLLQTDMCQGSDPFVKVQLVAGLKLVKTKKTSCMRGTIDPY--YNESFSFRVSHEELSEVSLVFTVYGHNVKTSNDFVGRIVIGQFS-SGPAETTHWRRLLR 452          
BLAST of SMED30019652 vs. Ensembl Cavefish
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:103044539])

HSP 1 Score: 50.8322 bits (120), Expect = 2.110e-6
Identity = 52/229 (22.71%), Postives = 105/229 (45.85%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVTTSGSHNLSLELESWNADVQ-AFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYWSDFIRDIPASGRKQW 1297
            ++V L P   +   T +H ++ NP + +Q  F     E   + LV+ +Y+ +RFS+   +      + +V  S       +L+S   + Q   G+I  +  Y   + ++   ILE+++L    +   ++ + KI  ++  K +K KK++  K   +     NE+   +VP   +  + + I++ D   I  + ++  +  G +S    TE  +WSD + + P     QW
Sbjct:  178 VKVYLLPDKKKKFETKVHRKTLNPTFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYAKIHLMQNGKRLKKKKTTIKKNTLNPYY--NESFSFEVPFEQIQKVQIVITVLDYDKIGKNDAIGKVFVGLNSSG--TELRHWSDMLAN-PRRPIAQW 401          
BLAST of SMED30019652 vs. Ensembl Cavefish
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:103044539])

HSP 1 Score: 50.447 bits (119), Expect = 2.331e-6
Identity = 52/229 (22.71%), Postives = 105/229 (45.85%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVTTSGSHNLSLELESWNADVQ-AFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYWSDFIRDIPASGRKQW 1297
            ++V L P   +   T +H ++ NP + +Q  F     E   + LV+ +Y+ +RFS+   +      + +V  S       +L+S   + Q   G+I  +  Y   + ++   ILE+++L    +   ++ + KI  ++  K +K KK++  K   +     NE+   +VP   +  + + I++ D   I  + ++  +  G +S    TE  +WSD + + P     QW
Sbjct:  175 VKVYLLPDKKKKFETKVHRKTLNPTFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYAKIHLMQNGKRLKKKKTTIKKNTLNPYY--NESFSFEVPFEQIQKVQIVITVLDYDKIGKNDAIGKVFVGLNSSG--TELRHWSDMLAN-PRRPIAQW 398          
BLAST of SMED30019652 vs. Ensembl Cavefish
Match: syt2a (synaptotagmin-2-like [Source:NCBI gene;Acc:103042251])

HSP 1 Score: 49.2914 bits (116), Expect = 6.240e-6
Identity = 51/236 (21.61%), Postives = 105/236 (44.49%), Query Frame = 2
Query:  656 TSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVTTS-GSHNLSLELESW-------NADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYWSDFIRDIPASGRKQWFPFHQK**TDFEIV 1339
            T +H ++ NP++ +   F     E   + LV+ +Y+ +RFS+       H  + EV     + +L+  +E W         + +  G+I ++  Y   + ++   ILE+++L    +   ++ ++KI  L+  K +K KK++  K   +     NE+   ++P   +  +   I++ D   I  + ++  +  G  S    T   +WSD + + P     QW P   +   D E+ 
Sbjct:  202 TKVHKKTLNPVFNETFCFKIPFQEMGGKTLVMSVYDFDRFSK-------HDVIGEVKIPMNTLDLAQPIEQWRDLDSAEKEEPERLGDICVSLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKIHLLQNGKRLKKKKTTVKKNTLNPYY--NESFSFEIPQDQMQKIQAVITVLDYDKIGKNDAIGKIWVGNKSQG--TALRHWSDMVSN-PRRPIAQWHPLRPEEEVDAELA 425          
BLAST of SMED30019652 vs. Ensembl Nematostella
Match: EDO33088 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST77])

HSP 1 Score: 60.4622 bits (145), Expect = 2.906e-10
Identity = 49/226 (21.68%), Postives = 105/226 (46.46%), Query Frame = 2
Query:  620 VSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVTTSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYWSDFIRDIPASGRKQW 1297
            V L P    +  + +   + +P + +  +F  N NE +E+ L   +Y+  R  +  P+     SLK     G+  +   ++     V   GEI L+ +YN  +SR+   + ++R++L F  +   EYF+KI  +   + +K K++ +   + S + + + +    +P   L+   + +S+ +  ++ G +++  +  G        E ++W   IR  P +  +QW
Sbjct:   53 VCLLPDEKPVLESYVKQSTWDPNFDETFVFKLNTNEVKEKTLRFSVYDCTRLHKLCPIGHTLFSLKGQDLDGTMAVERAIKP-QCQVNR-GEISLSLTYNPGTSRLVVGVRQARNILQFEGHAHKEYFVKISRIHLNRKVKTKRTPSTDGDASPIFKHDMSF--NIPTEQLSDSCLVLSLMNHGVVRGSTTIGRVVLGPYVFGSGNERSHWGRMIRS-PLNTIEQW 273          
BLAST of SMED30019652 vs. Ensembl Medaka
Match: syt2a (synaptotagmin-2 [Source:NCBI gene;Acc:101161806])

HSP 1 Score: 51.6026 bits (122), Expect = 1.124e-6
Identity = 52/227 (22.91%), Postives = 105/227 (46.26%), Query Frame = 2
Query:  656 TSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVTTS-GSHNLSLELESW----NADV---QAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDS-GTGPTESTYWSDFIRDIPASGRKQWFPFH 1309
            T +H ++ NP++ +   F     E   + LV+ +Y+ +RFS+       H  + E+     + +L+  +E W    +AD    +  G+I ++  Y   + ++   ILE+++L    +   ++ ++KI  L+  K +K KK++  K   +     NE+   ++PL  +  +   I++ D   I  + ++  +  G  S G G     +WSD + + P     QW P  
Sbjct:  203 TKVHKKTLNPVFNETFTFKIPFQEMGGKTLVMSVYDFDRFSK-------HDVIGEIKIPMNTLDLAKPIEEWRDLDSADQEEPEKLGDICISLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKINLLQNGKRLKKKKTTVKKNTLNPYY--NESFSFEIPLEQMQKIQAVITVLDYDKIGKNDAIGKIWVGSKSTGAG---LKHWSDMLAN-PRRPIAQWHPLQ 416          
BLAST of SMED30019652 vs. Ensembl Medaka
Match: syt2a (synaptotagmin-2 [Source:NCBI gene;Acc:101161806])

HSP 1 Score: 51.6026 bits (122), Expect = 1.124e-6
Identity = 52/227 (22.91%), Postives = 105/227 (46.26%), Query Frame = 2
Query:  656 TSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVTTS-GSHNLSLELESW----NADV---QAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDS-GTGPTESTYWSDFIRDIPASGRKQWFPFH 1309
            T +H ++ NP++ +   F     E   + LV+ +Y+ +RFS+       H  + E+     + +L+  +E W    +AD    +  G+I ++  Y   + ++   ILE+++L    +   ++ ++KI  L+  K +K KK++  K   +     NE+   ++PL  +  +   I++ D   I  + ++  +  G  S G G     +WSD + + P     QW P  
Sbjct:  203 TKVHKKTLNPVFNETFTFKIPFQEMGGKTLVMSVYDFDRFSK-------HDVIGEIKIPMNTLDLAKPIEEWRDLDSADQEEPEKLGDICISLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKINLLQNGKRLKKKKTTVKKNTLNPYY--NESFSFEIPLEQMQKIQAVITVLDYDKIGKNDAIGKIWVGSKSTGAG---LKHWSDMLAN-PRRPIAQWHPLQ 416          
BLAST of SMED30019652 vs. Ensembl Medaka
Match: syt7a (synaptotagmin-7-like [Source:NCBI gene;Acc:101169108])

HSP 1 Score: 51.2174 bits (121), Expect = 1.360e-6
Identity = 51/230 (22.17%), Postives = 101/230 (43.91%), Query Frame = 2
Query:  611 MMRVSLDPASDQINFTSIHSRSKNPIWKDQLMF-NFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVTTSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYWSDFIRDIPASGRKQW 1297
             +++ L P       T +  ++ NP W +  +F  F   + RE+ L L + + +RFSR  P+      L +V          EL+  +      GE+ ++  YN  ++ +  +I+++R+L    +   ++ ++K+  + K K ++ KK+   K   + V   NE+    VP   L    + I++ D   +  +  +  +     S  GP E  +W D +   P +   QW
Sbjct:  163 FVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVRERTLYLQVLDYDRFSRNDPIGEVSIPLNKVELGQMKTFWKELKPCSDGSGRRGELLVSLCYNPTANTITVNIIKARNLKAMDIGGTSDPYVKVWLMHKDKRVEKKKTVVIKCCLNPVF--NESFPFDVPAHVLRETTIVITVMDKDRLSRNDVIGKIYLSWKS--GPAEVKHWKDMLAR-PRTNVAQW 387          
BLAST of SMED30019652 vs. Ensembl Medaka
Match: ENSORLT00000008980.2 (synaptotagmin-2-like [Source:NCBI gene;Acc:101157206])

HSP 1 Score: 50.447 bits (119), Expect = 2.316e-6
Identity = 56/237 (23.63%), Postives = 112/237 (47.26%), Query Frame = 2
Query:  614 MRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVTTS-GSHNLSLELESW----NADV---QAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFG-QDSGTGPTESTYWSDFIRDIPASGRKQW 1297
            +RV L P   +   T +H ++ NP++ +  +F     E   + L L +Y+ +RFS+       H  + EV  +  + +L   +E W    +AD    +  G+I ++  Y   + ++   ILE+++L        ++ ++KIQ L+  K +K KK++  K   +     NE+   ++PL  +  + V +++ D   I  + ++  +  G + +G G     +WSD + + P     QW
Sbjct:  163 VRVLLLPDKKKKFDTKVHKKTLNPVFNETFVFKVPYEELGGKTLCLSVYDYDRFSK-------HDVIGEVKLAMNTIDLGRPIEEWRDLESADQEEPEKLGDICISLRYVPTAGKLTVCILEAKNLKKMDACGLSDPYVKIQLLQGGKRLKKKKTTVKKNTLNPYY--NESFSFEIPLEQMQKILVAVTVFDYDKIGKNDAIGKIFVGSKATGLG---LKHWSDMLAN-PRRPIAQW 386          
BLAST of SMED30019652 vs. Ensembl Medaka
Match: syt1b (synaptotagmin-1-like [Source:NCBI gene;Acc:101162836])

HSP 1 Score: 50.447 bits (119), Expect = 2.404e-6
Identity = 47/215 (21.86%), Postives = 100/215 (46.51%), Query Frame = 2
Query:  656 TSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVTTSGSHNLSLELE-SWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYWSDFIRDIPASGRKQW 1297
            T +H ++  P + +   F     E   + LV+ +Y+ +RFS+   +      ++ V  S S     +L+ +   + +  G+I L+  Y   + ++   ILE+++L    +   ++ ++KI  ++  K +K KK++  K   +     NE+   +VP   +  + V +++ D   I  + ++  +  G +S    TE  +WSD + + P     QW
Sbjct:  181 TKVHRKTLEPTFNETFTFKVPYTEMGGRTLVMTVYDFDRFSKHDAIGAVKIPMRGVDFSQSMQEWRDLQKAEKEESERLGDICLSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYY--NESFSFEVPCEQIEKVQVAVTVLDYDKIGKNDAIGKVLLGGNSSG--TEQRHWSDMLAN-PRRPIAQW 390          
BLAST of SMED30019652 vs. Planmine SMEST
Match: SMESG000043998.1 (SMESG000043998.1)

HSP 1 Score: 737.258 bits (1902), Expect = 0.000e+0
Identity = 399/400 (99.75%), Postives = 400/400 (100.00%), Query Frame = 2
Query:  116 MITXXXXXXXXXXECNWPWVKDKEIPDSTVEIDYHFRGRINSTNSIGQCDLPLPVQIVTEQPQPEPVEIEKPKKHKKXXXXXXXXXXXXXXGILNQVLLERRGTKRNNDGPQAMINLICDEILQKLSVSLISIKNYNSVFLLKPSASFSRNNSENSPLLSTAPSLMMRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVTTSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEXXXXXXXXXXXXXXPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTESTYWSDFIRDIPASGRKQWFPFHQK 1315
            MITLKKCCCSCLSECNWPWVKDKEIPDSTVEIDYHFRGRINSTNSIGQCDLPLPVQIVTEQPQPEPVEIEKPKKHKKSVSSLDSAIFSSASGILNQVLLERRGTKRNNDGPQAMINLICDEILQKLSVSLISIKNYNSVFLLKPSASFSRNNSENSPLLSTAPSLMMRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVTTSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEKKKLIKVKKSSAGKPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTE+TYWSDFIRDIPASGRKQWFPFHQK
Sbjct:    1 MITLKKCCCSCLSECNWPWVKDKEIPDSTVEIDYHFRGRINSTNSIGQCDLPLPVQIVTEQPQPEPVEIEKPKKHKKSVSSLDSAIFSSASGILNQVLLERRGTKRNNDGPQAMINLICDEILQKLSVSLISIKNYNSVFLLKPSASFSRNNSENSPLLSTAPSLMMRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNFNRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVTTSGSHNLSLELESWNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQFLEKKKLIKVKKSSAGKPEPSSVLQINETVRAKVPLASLNYLNVRISICDAKMIIGDSSLYYLNFGQDSGTGPTETTYWSDFIRDIPASGRKQWFPFHQK 400          
The following BLAST results are available for this feature:
BLAST of SMED30019652 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SYT176.545e-722.27synaptotagmin 17 [Source:HGNC Symbol;Acc:HGNC:2411... [more]
SYT176.642e-722.27synaptotagmin 17 [Source:HGNC Symbol;Acc:HGNC:2411... [more]
SYT171.500e-622.27synaptotagmin 17 [Source:HGNC Symbol;Acc:HGNC:2411... [more]
back to top
BLAST of SMED30019652 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019652 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Syt77.525e-622.18gene:FBgn0039900 transcript:FBtr0089139[more]
back to top
BLAST of SMED30019652 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt172.383e-823.83synaptotagmin XVII [Source:ZFIN;Acc:ZDB-GENE-09052... [more]
syt171.541e-723.36synaptotagmin XVII [Source:ZFIN;Acc:ZDB-GENE-09052... [more]
syt171.600e-723.36synaptotagmin XVII [Source:ZFIN;Acc:ZDB-GENE-09052... [more]
syt1a1.692e-723.58synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-... [more]
syt1a1.692e-723.58synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-... [more]
back to top
BLAST of SMED30019652 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc35e13.432e-823.83solute carrier family 35 member E1 [Source:Xenbase... [more]
slc35e13.517e-823.83solute carrier family 35 member E1 [Source:Xenbase... [more]
luzp21.033e-621.67leucine zipper protein 2 [Source:Xenbase;Acc:XB-GE... [more]
e2f44.246e-624.20E2F transcription factor 4 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of SMED30019652 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syt171.462e-723.18synaptotagmin XVII [Source:MGI Symbol;Acc:MGI:1049... [more]
Syt171.626e-723.18synaptotagmin XVII [Source:MGI Symbol;Acc:MGI:1049... [more]
Syt173.488e-723.18synaptotagmin XVII [Source:MGI Symbol;Acc:MGI:1049... [more]
Syt174.805e-622.63synaptotagmin XVII [Source:MGI Symbol;Acc:MGI:1049... [more]
Syt25.707e-622.36synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666][more]
back to top
BLAST of SMED30019652 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A4IJ05|SYT17_XENTR1.863e-723.83Synaptotagmin-17 OS=Xenopus tropicalis OX=8364 GN=... [more]
sp|Q920M7|SYT17_MOUSE1.138e-623.18Synaptotagmin-17 OS=Mus musculus OX=10090 GN=Syt17... [more]
sp|Q62807|SYT17_RAT1.165e-623.18Synaptotagmin-17 OS=Rattus norvegicus OX=10116 GN=... [more]
sp|Q5R8Q5|SYT17_PONAB1.698e-622.73Synaptotagmin-17 OS=Pongo abelii OX=9601 GN=SYT17 ... [more]
sp|Q9BSW7|SYT17_HUMAN3.190e-622.27Synaptotagmin-17 OS=Homo sapiens OX=9606 GN=SYT17 ... [more]
back to top
BLAST of SMED30019652 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A556UZP99.009e-724.20Synaptotagmin-17 OS=Bagarius yarrelli OX=175774 GN... [more]
A0A210Q1H43.958e-624.54Synaptotagmin-17 OS=Mizuhopecten yessoensis OX=657... [more]
A0A5N5MH894.047e-624.20Uncharacterized protein OS=Pangasianodon hypophtha... [more]
E4X9B75.298e-624.12Uncharacterized protein OS=Oikopleura dioica OX=34... [more]
A0A2B4RXD26.010e-621.89Synaptotagmin-7 OS=Stylophora pistillata OX=50429 ... [more]
back to top
BLAST of SMED30019652 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
syt171.893e-722.83synaptotagmin 17 [Source:NCBI gene;Acc:103039203][more]
syt1a2.110e-622.71synaptotagmin 1 [Source:NCBI gene;Acc:103044539][more]
syt1a2.331e-622.71synaptotagmin 1 [Source:NCBI gene;Acc:103044539][more]
syt2a6.240e-621.61synaptotagmin-2-like [Source:NCBI gene;Acc:1030422... [more]
back to top
BLAST of SMED30019652 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019652 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019652 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO330882.906e-1021.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30019652 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt2a1.124e-622.91synaptotagmin-2 [Source:NCBI gene;Acc:101161806][more]
syt2a1.124e-622.91synaptotagmin-2 [Source:NCBI gene;Acc:101161806][more]
syt7a1.360e-622.17synaptotagmin-7-like [Source:NCBI gene;Acc:1011691... [more]
ENSORLT00000008980.22.316e-623.63synaptotagmin-2-like [Source:NCBI gene;Acc:1011572... [more]
syt1b2.404e-621.86synaptotagmin-1-like [Source:NCBI gene;Acc:1011628... [more]
back to top
BLAST of SMED30019652 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000043998.10.000e+099.75SMESG000043998.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019652 ID=SMED30019652|Name=SMED30019652|organism=Schmidtea mediterranea sexual|type=transcript|length=1411bp
TTTTAATTCATTGTTTTAATGGGATAATCACTCTAGCCAATCAGCTCGCT
TTCCTAGAAATCAGTTTTGTCAAGCTCACTCCTCTTGTTTTCTCCCGACT
TCAACCACCAAGCAAATGATAACATTGAAGAAATGTTGCTGCTCATGCTT
ATCAGAGTGTAACTGGCCATGGGTAAAGGATAAAGAAATTCCGGATTCGA
CAGTTGAGATTGACTACCACTTCCGAGGAAGAATTAATTCAACGAATTCA
ATTGGTCAGTGCGATCTTCCTTTACCTGTCCAGATTGTCACTGAGCAGCC
ACAACCGGAACCGGTTGAAATTGAAAAACCAAAGAAACATAAGAAATCCG
TGTCATCATTAGATTCAGCAATTTTCTCATCGGCTTCGGGAATATTGAAT
CAAGTTCTCCTAGAAAGACGAGGAACAAAACGCAACAACGATGGACCTCA
AGCTATGATTAATTTGATCTGTGACGAAATACTACAGAAATTATCAGTCA
GTCTAATATCAATCAAAAACTATAATTCGGTGTTTCTCTTGAAACCTTCA
GCCAGTTTTTCCAGAAACAATTCAGAAAATTCTCCTTTGCTAAGTACTGC
TCCATCACTAATGATGAGAGTGTCTCTAGATCCAGCCTCAGATCAAATAA
ACTTCACTTCAATACATTCTCGCAGCAAGAATCCAATTTGGAAAGACCAG
TTGATGTTCAACTTCAACCGAAATGAAAAACGTGAACAGAACTTGGTTTT
GATTCTTTATGAAAGCAACAGATTCTCCCGTTGGACCCCTGTCAAAATGG
CTCATCACTCATTAAAGGAAGTGACAACGAGTGGCAGTCATAATCTTTCT
TTAGAGCTCGAATCGTGGAATGCGGATGTTCAAGCTTTCGGTGAAATCAA
GCTTGCATTTTCCTATAACAAAGCTTCCAGTCGGGTTTACTGTGACATAC
TAGAGTCAAGGTCCCTTCTCCATTTCGGTCTCAACAGAAAGGCAGAATAT
TTTATAAAAATCCAATTTCTCGAAAAGAAAAAGTTAATAAAGGTGAAAAA
GTCCTCGGCCGGCAAGCCGGAGCCCTCCTCAGTGCTGCAGATCAACGAAA
CGGTTCGGGCAAAAGTTCCATTGGCAAGCTTGAACTATTTGAATGTCCGA
ATCTCAATTTGCGATGCTAAAATGATCATTGGGGATTCGTCGCTCTATTA
TCTGAATTTCGGGCAGGACTCGGGAACCGGGCCCACCGAATCCACTTACT
GGTCAGACTTCATCAGAGACATTCCGGCCTCGGGCAGGAAGCAATGGTTC
CCATTTCATCAGAAGTAGTGAACGGACTTTGAGATTGTAGATGACTGCAA
ATCAGCATTTGAATGTAATCATCATTTGTGGTTATTTTGTGATAAATAGA
TTCCATGGCGC
back to top

protein sequence of SMED30019652-orf-1

>SMED30019652-orf-1 ID=SMED30019652-orf-1|Name=SMED30019652-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=401bp
MITLKKCCCSCLSECNWPWVKDKEIPDSTVEIDYHFRGRINSTNSIGQCD
LPLPVQIVTEQPQPEPVEIEKPKKHKKSVSSLDSAIFSSASGILNQVLLE
RRGTKRNNDGPQAMINLICDEILQKLSVSLISIKNYNSVFLLKPSASFSR
NNSENSPLLSTAPSLMMRVSLDPASDQINFTSIHSRSKNPIWKDQLMFNF
NRNEKREQNLVLILYESNRFSRWTPVKMAHHSLKEVTTSGSHNLSLELES
WNADVQAFGEIKLAFSYNKASSRVYCDILESRSLLHFGLNRKAEYFIKIQ
FLEKKKLIKVKKSSAGKPEPSSVLQINETVRAKVPLASLNYLNVRISICD
AKMIIGDSSLYYLNFGQDSGTGPTESTYWSDFIRDIPASGRKQWFPFHQK
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR000008C2_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005544calcium-dependent phospholipid binding
Vocabulary: biological process
TermDefinition
GO:0007269neurotransmitter secretion
Vocabulary: cellular component
TermDefinition
GO:0008021synaptic vesicle
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 251..395
e-value: 1.5E-7
score: 33.1
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 100..250
e-value: 2.5E-6
score: 29.3
NoneNo IPR availablePANTHERPTHR10024:SF227SYNAPTOTAGMIN 1coord: 166..383
NoneNo IPR availablePANTHERPTHR10024SYNAPTOTAGMINcoord: 166..383
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 161..248
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 259..360