Serine-protein kinase ATM

Overview
NameSerine-protein kinase ATM
Smed IDSMED30019647
Length (bp)8400
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine-protein kinase ATM (SMED30019647) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine-protein kinase ATM (SMED30019647) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine-protein kinase ATM (SMED30019647) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine-protein kinase ATM (SMED30019647) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019647

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30019647SMESG000023629.1 SmedASXL_051364SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30019647SMESG000023630.1 SmedASXL_000051SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30019647SMESG000023628.1 SMESG000023629.1 SmedASXL_017933SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30019647SMESG000023630.1 SMESG000023629.1 SmedASXL_010595SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30019647SMESG000023630.1 SmedASXL_000790SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30019647SMESG000023629.1 SMESG000023628.1 dd_Smed_v4_14586_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019647SMESG000023629.1 SMED_14513_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30019647SMESG000023629.1 SMED_14513_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine-protein kinase ATM vs. Ensembl Human
Match: ATM (ATM serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:795])

HSP 1 Score: 483.026 bits (1242), Expect = 2.411e-136
Identity = 323/954 (33.86%), Postives = 523/954 (54.82%), Query Frame = 3
Query: 5613 AMYDFLYS-RSEHVSEFYRNHVVDSCKISWDQEACFRPLIERATLFGNETSLPTI--LESLIRIANKSNIDQLDSS--IVWA----LIRSNRFARNLEIVNQQLLGISDLAKRCKRHEYIDFIRDMLNLHEVDNSILKCSGESSLFRTIDIFSQKT-ETEETKKSFLQLE--QFIYDSQKHILTC----QQIKR------NHDLFFKLYFKAVSKICA-WNQEYPVHSVSHIRTKILEPAMGVFGKSLKQESDMLS--------TMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWDEL--NNLSQDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSE--NNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXAND--KMNSRI----SVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            ++Y+ L S R    S FY +  +   ++   +E C R L    +L+   + L  I  LES+  + ++S   +  S   I W     L++ + F+    I+  + + +  L ++   +   + I+D+L  H V+ SIL  + +++      IF  K   +     S  QLE  Q  +  ++  L      Q IK+       ++   KL +    ++C  W  E  + + + I    LE A+ V G    + SD L         +++ FS  QY  I  YM+SSE+EN+  +L  +K +V  L + + +   R  ++ Q E++ DEL    L +DR+RFL  A  +   CL + + +D  +F L S+WL N    ++N ++     KI T+KFL LM QL AR+ ++      F   L  LI RI +DHP H+++ +LA+ NANRD  L K +  +  +   +  K +S++    + A   +   ++  +  ++R  + L  AYI  AN+D + +K    K +  P +  + ++     + VPT+ I +D + +Y    L  I  F   + L GG+NLPKI+ C  SDG +RRQLVK  DDLRQD+VMQQVF + N+LL  + + T K               R ++I TYKV+P++Q SG++EWC  TVP+G++L N++ GAH+RYRP D +  QC+K++    +++ +++ E F D+    QPV  YF  EKF +   WF+ R +Y  S+A +SIVG+ILGLGDRHVQNIL++  +AEL+HID G+AF+ GK++PT E VPFRLTRD+V G+G  GVEG F+  C   + ++R+ ++ +LT++EVLL+DPL  W +NP  A  L+ ++  +++       ++   E   N S    S N++AERV++ +  K  G  + + L+  G VN LIQ A + +NL+R+F GW+A++
Sbjct: 2127 SLYNALQSLRDREFSTFYES--LKYARVKEVEEMCKRSLESVYSLYPTLSRLQAIGELESIGELFSRSVTHRQLSEVYIKWQKHSQLLKDSDFSFQEPIMALRTVILEILMEKEMDNSQRECIKDILTKHLVELSILARTFKNTQLPERAIFQIKQYNSVSCGVSEWQLEEAQVFWAKKEQSLALSILKQMIKKLDASCAANNPSLKLTYTECLRVCGNWLAETCLENPAVIMQTYLEKAVEVAGNYDGESSDELRNGKMKAFLSLARFSDTQYQRIENYMKSSEFENKQALLKRAKEEVGLLREHKIQTN-RYTVKVQRELELDELALRALKEDRKRFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENSGVSEVNGMMKRDGMKIPTYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANRDEFLTKPEVARRSRITKNVPKQSSQLDEDRTEAANRIICTIRSRRPQMVRSVEALCDAYIILANLDATQWKTQ-RKGINIPADQPITKLKNLEDVVVPTMEIKVDHTGEYG--NLVTIQSFKAEFRLAGGVNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLL-QRNTETRK---------------RKLTICTYKVVPLSQRSGVLEWCTGTVPIGEFLVNNEDGAHKRYRPNDFSAFQCQKKMMEVQKKSFEEKYEVFMDVCQNFQPVFRYFCMEKFLDPAIWFEKRLAYTRSVATSSIVGYILGLGDRHVQNILINEQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMRNSQETLLTIVEVLLYDPLFDWTMNPLKA--LYLQQRPEDETELHPTLNADDQECKRNLSDIDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAIDPKNLSRLFPGWKAWV 3056          
BLAST of Serine-protein kinase ATM vs. Ensembl Human
Match: ATM (ATM serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:795])

HSP 1 Score: 483.026 bits (1242), Expect = 2.411e-136
Identity = 323/954 (33.86%), Postives = 523/954 (54.82%), Query Frame = 3
Query: 5613 AMYDFLYS-RSEHVSEFYRNHVVDSCKISWDQEACFRPLIERATLFGNETSLPTI--LESLIRIANKSNIDQLDSS--IVWA----LIRSNRFARNLEIVNQQLLGISDLAKRCKRHEYIDFIRDMLNLHEVDNSILKCSGESSLFRTIDIFSQKT-ETEETKKSFLQLE--QFIYDSQKHILTC----QQIKR------NHDLFFKLYFKAVSKICA-WNQEYPVHSVSHIRTKILEPAMGVFGKSLKQESDMLS--------TMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWDEL--NNLSQDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSE--NNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXAND--KMNSRI----SVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            ++Y+ L S R    S FY +  +   ++   +E C R L    +L+   + L  I  LES+  + ++S   +  S   I W     L++ + F+    I+  + + +  L ++   +   + I+D+L  H V+ SIL  + +++      IF  K   +     S  QLE  Q  +  ++  L      Q IK+       ++   KL +    ++C  W  E  + + + I    LE A+ V G    + SD L         +++ FS  QY  I  YM+SSE+EN+  +L  +K +V  L + + +   R  ++ Q E++ DEL    L +DR+RFL  A  +   CL + + +D  +F L S+WL N    ++N ++     KI T+KFL LM QL AR+ ++      F   L  LI RI +DHP H+++ +LA+ NANRD  L K +  +  +   +  K +S++    + A   +   ++  +  ++R  + L  AYI  AN+D + +K    K +  P +  + ++     + VPT+ I +D + +Y    L  I  F   + L GG+NLPKI+ C  SDG +RRQLVK  DDLRQD+VMQQVF + N+LL  + + T K               R ++I TYKV+P++Q SG++EWC  TVP+G++L N++ GAH+RYRP D +  QC+K++    +++ +++ E F D+    QPV  YF  EKF +   WF+ R +Y  S+A +SIVG+ILGLGDRHVQNIL++  +AEL+HID G+AF+ GK++PT E VPFRLTRD+V G+G  GVEG F+  C   + ++R+ ++ +LT++EVLL+DPL  W +NP  A  L+ ++  +++       ++   E   N S    S N++AERV++ +  K  G  + + L+  G VN LIQ A + +NL+R+F GW+A++
Sbjct: 2127 SLYNALQSLRDREFSTFYES--LKYARVKEVEEMCKRSLESVYSLYPTLSRLQAIGELESIGELFSRSVTHRQLSEVYIKWQKHSQLLKDSDFSFQEPIMALRTVILEILMEKEMDNSQRECIKDILTKHLVELSILARTFKNTQLPERAIFQIKQYNSVSCGVSEWQLEEAQVFWAKKEQSLALSILKQMIKKLDASCAANNPSLKLTYTECLRVCGNWLAETCLENPAVIMQTYLEKAVEVAGNYDGESSDELRNGKMKAFLSLARFSDTQYQRIENYMKSSEFENKQALLKRAKEEVGLLREHKIQTN-RYTVKVQRELELDELALRALKEDRKRFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENSGVSEVNGMMKRDGMKIPTYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANRDEFLTKPEVARRSRITKNVPKQSSQLDEDRTEAANRIICTIRSRRPQMVRSVEALCDAYIILANLDATQWKTQ-RKGINIPADQPITKLKNLEDVVVPTMEIKVDHTGEYG--NLVTIQSFKAEFRLAGGVNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLL-QRNTETRK---------------RKLTICTYKVVPLSQRSGVLEWCTGTVPIGEFLVNNEDGAHKRYRPNDFSAFQCQKKMMEVQKKSFEEKYEVFMDVCQNFQPVFRYFCMEKFLDPAIWFEKRLAYTRSVATSSIVGYILGLGDRHVQNILINEQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMRNSQETLLTIVEVLLYDPLFDWTMNPLKA--LYLQQRPEDETELHPTLNADDQECKRNLSDIDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAIDPKNLSRLFPGWKAWV 3056          
BLAST of Serine-protein kinase ATM vs. Ensembl Human
Match: ATR (ATR serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:882])

HSP 1 Score: 209.92 bits (533), Expect = 3.884e-53
Identity = 154/597 (25.80%), Postives = 271/597 (45.39%), Query Frame = 3
Query: 6639 KLNNIISDVIGKIETHKFLVLMPQLCARLNSENNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMNSRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIA--KQVKLPVPTLSIPIDRSL------KYSLDRLP----LIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTV---PLGDWLANDK----TGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKD-ILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSY------LNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            K+N +I++    +  ++FL    QL +R+   +++ F + +E +I ++ L +P  +++ + A+  ++             +    + +N  I +         K+S    + DA  LT   +   N  +      +     F +   L+  A   ++ +P+ ++ IP   S+        S +  P     I GFDD+  +   +  PK +  + SDG     + K  DDLR+D  + +  S++N  L                   A    R + IRTY VIP+    GIIEW  +T    P+   L  +K    TG   R         QC     +     + ++++ F++ +L +  P+   +    FP+   W+ +R +Y  S A+ S+VG+ILGLGDRH +NIL D  T E +H+DF   F+ G+     E VPFRLT ++V+G+GP G EG F+  C   + L+R Q++ ++++++  LHDPL  W   P      H+K   +                       G   N+ A+  +L++ ++  G + +        L+ EGHV+YLIQ A++   L +M+ GW  Y+
Sbjct: 2057 KINKVITEHTNYLAPYQFLTAFSQLISRICHSHDEVFVVLME-IIAKVFLAYPQQAMWMMTAVSKSS---------YPMRVNRCKEILNKAIHM---------KKSLEKFVGDATRLTDKLLELCNKPVDGSSSTLSMSTHFKMLKKLVEEATFSEILIPLQSVMIPTLPSILGTHANHASHEPFPGHWAYIAGFDDMVEILASLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLMEFNSLINKCLRK----------------DAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKLYKEKGVYMTGKELR---------QC----MLPKSAALSEKLKVFREFLLPRHPPIFHEWFLRTFPDPTSWYSSRSAYCRSTAVMSMVGYILGLGDRHGENILFDSLTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMVNGMGPMGTEGLFRRACEVTMRLMRDQREPLMSVLKTFLHDPLVEWS-KPVKG---HSKAPLNET---------------------GEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM 2580          
BLAST of Serine-protein kinase ATM vs. Ensembl Human
Match: ATR (ATR serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:882])

HSP 1 Score: 209.534 bits (532), Expect = 4.216e-53
Identity = 154/597 (25.80%), Postives = 272/597 (45.56%), Query Frame = 3
Query: 6639 KLNNIISDVIGKIETHKFLVLMPQLCARLNSENNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMNSRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIA--KQVKLPVPTLSIPIDRSL------KYSLDRLP----LIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTV---PLGDWLANDK----TGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKD-ILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSY------LNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            K+N +I++    +  ++FL    QL +R+   +++ F + +E +I ++ L +P  +++ + A+  ++    + +           + +N  I +         K+S    + DA  LT   +   N  +      +     F +   L+  A   ++ +P+ ++ IP   S+        S +  P     I GFDD+  +   +  PK +  + SDG     + K  DDLR+D  + +  S++N  L                   A    R + IRTY VIP+    GIIEW  +T    P+   L  +K    TG   R         QC     +     + ++++ F++ +L +  P+   +    FP+   W+ +R +Y  S A+ S+VG+ILGLGDRH +NIL D  T E +H+DF   F+ G+     E VPFRLT ++V+G+GP G EG F+  C   + L+R Q++ ++++++  LHDPL  W   P      H+K   +                       G   N+ A+  +L++ ++  G + +        L+ EGHV+YLIQ A++   L +M+ GW  Y+
Sbjct: 2121 KINKVITEHTNYLAPYQFLTAFSQLISRICHSHDEVFVVLME-IIAKVFLAYPQQAMWMMTAVSKSSYPMRVNR---------CKEILNKAIHM---------KKSLEKFVGDATRLTDKLLELCNKPVDGSSSTLSMSTHFKMLKKLVEEATFSEILIPLQSVMIPTLPSILGTHANHASHEPFPGHWAYIAGFDDMVEILASLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLMEFNSLINKCLRK----------------DAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKLYKEKGVYMTGKELR---------QC----MLPKSAALSEKLKVFREFLLPRHPPIFHEWFLRTFPDPTSWYSSRSAYCRSTAVMSMVGYILGLGDRHGENILFDSLTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMVNGMGPMGTEGLFRRACEVTMRLMRDQREPLMSVLKTFLHDPLVEWS-KPVKG---HSKAPLNET---------------------GEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM 2644          
BLAST of Serine-protein kinase ATM vs. Ensembl Human
Match: ATR (ATR serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:882])

HSP 1 Score: 190.274 bits (482), Expect = 3.150e-47
Identity = 131/493 (26.57%), Postives = 230/493 (46.65%), Query Frame = 3
Query: 6639 KLNNIISDVIGKIETHKFLVLMPQLCARLNSENNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMNSRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIA--KQVKLPVPTLSIPIDRSL------KYSLDRLP----LIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTV---PLGDWLANDK----TGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKD-ILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSW 8057
            K+N +I++    +  ++FL    QL +R+   +++ F + +E +I ++ L +P  +++ + A+  ++             +    + +N  I +         K+S    + DA  LT   +   N  +      +     F +   L+  A   ++ +P+ ++ IP   S+        S +  P     I GFDD+  +   +  PK +  + SDG     + K  DDLR+D  + +  S++N  L                   A    R + IRTY VIP+    GIIEW  +T    P+   L  +K    TG   R         QC     +     + ++++ F++ +L +  P+   +    FP+   W+ +R +Y  S A+ S+VG+ILGLGDRH +NIL D  T E +H+DF   F+ G+     E VPFRLT ++V+G+GP G EG F+  C   + L+R Q++ ++++++  LHDPL  W
Sbjct: 1718 KINKVITEHTNYLAPYQFLTAFSQLISRICHSHDEVFVVLME-IIAKVFLAYPQQAMWMMTAVSKSS---------YPMRVNRCKEILNKAIHM---------KKSLEKFVGDATRLTDKLLELCNKPVDGSSSTLSMSTHFKMLKKLVEEATFSEILIPLQSVMIPTLPSILGTHANHASHEPFPGHWAYIAGFDDMVEILASLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLMEFNSLINKCLRK----------------DAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKLYKEKGVYMTGKELR---------QC----MLPKSAALSEKLKVFREFLLPRHPPIFHEWFLRTFPDPTSWYSSRSAYCRSTAVMSMVGYILGLGDRHGENILFDSLTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMVNGMGPMGTEGLFRRACEVTMRLMRDQREPLMSVLKTFLHDPLVEW 2162          
BLAST of Serine-protein kinase ATM vs. Ensembl Celegans
Match: atm-1 (Serine/threonine-protein kinase ATM [Source:UniProtKB/Swiss-Prot;Acc:Q9N3Q4])

HSP 1 Score: 169.474 bits (428), Expect = 2.091e-41
Identity = 129/537 (24.02%), Postives = 239/537 (44.51%), Query Frame = 3
Query: 6756 NLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMNSRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLAN--DKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGK-LMPTQERVPFRLTRDLVHGLGPFGVE-GRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEG-HVNYLIQTASNVENLARMFHGWQAYL 8351
            +L +++  +I D+P+H ++ +L   +    S+++          A+ + +S++      + +  +  +   + D            NV +   + +     ++P +  + +  K  +LP+PT+S  I     YS   L     + DV+++  GI+ PKI   + SDG K  + V   DD+RQD +++Q+F V N++L                            +RTY V+P+    G+IE+C  TV L + +     + G H+ +  ++ +  +    ++    E+ + R + F +I  +  PV  +F +  F  +Q W +   +Y  SLA  SIV +I+GLGDRH  NIL D      +HID G+  +  K  +P  E+VPFR+TRD++  +   G+E G+    C  ++  L+    +IL +   LL + + +++   Q A                               RP    + ++E  I  +  K  G  D          +  L++ A++ +NL+RMF GW  +L
Sbjct: 1234 HLSQILCHLIYDYPYHVLHTILMYDDEKNASKVKGFLKTIFDARADQRDSSKLKEIVITIREAHQAYREIAMLDVR---------GNVRIQRVEINGKTMYRWPHDLKIFK-CKLRQLPIPTISQKIGCPGDYSTTDLITWKRWKDVFTIADGISTPKIWEIEGSDG-KWYKTVWKKDDVRQDVLVEQMFDVTNNMLEKA------------------------MLRTYNVVPLDTECGVIEFCGGTVSLKEVMCGVTREGGLHREFNSEEVSASKVSSMMRQVQTESTETRRQVFVEICQQYSPVFRHFFYTNFSTAQIWRQKIINYRQSLATWSIVCYIVGLGDRHASNILFDQKLCTFVHIDLGMILEYSKRTLPVPEQVPFRITRDVLDPILIEGIENGQLAEECTQIMEKLKENGKVILGVASALLRETMTNFREAEQAA------------------------------GRP----SYISEMAIGRLREKLRGTDDGVTAQSSNLQIRRLLREATSADNLSRMFCGWMPFL 1701          
BLAST of Serine-protein kinase ATM vs. Ensembl Celegans
Match: atm-1 (Serine/threonine-protein kinase ATM [Source:UniProtKB/Swiss-Prot;Acc:Q9N3Q4])

HSP 1 Score: 169.474 bits (428), Expect = 2.464e-41
Identity = 129/537 (24.02%), Postives = 239/537 (44.51%), Query Frame = 3
Query: 6756 NLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMNSRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLAN--DKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGK-LMPTQERVPFRLTRDLVHGLGPFGVE-GRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEG-HVNYLIQTASNVENLARMFHGWQAYL 8351
            +L +++  +I D+P+H ++ +L   +    S+++          A+ + +S++      + +  +  +   + D            NV +   + +     ++P +  + +  K  +LP+PT+S  I     YS   L     + DV+++  GI+ PKI   + SDG K  + V   DD+RQD +++Q+F V N++L                            +RTY V+P+    G+IE+C  TV L + +     + G H+ +  ++ +  +    ++    E+ + R + F +I  +  PV  +F +  F  +Q W +   +Y  SLA  SIV +I+GLGDRH  NIL D      +HID G+  +  K  +P  E+VPFR+TRD++  +   G+E G+    C  ++  L+    +IL +   LL + + +++   Q A                               RP    + ++E  I  +  K  G  D          +  L++ A++ +NL+RMF GW  +L
Sbjct: 1911 HLSQILCHLIYDYPYHVLHTILMYDDEKNASKVKGFLKTIFDARADQRDSSKLKEIVITIREAHQAYREIAMLDVR---------GNVRIQRVEINGKTMYRWPHDLKIFK-CKLRQLPIPTISQKIGCPGDYSTTDLITWKRWKDVFTIADGISTPKIWEIEGSDG-KWYKTVWKKDDVRQDVLVEQMFDVTNNMLEKA------------------------MLRTYNVVPLDTECGVIEFCGGTVSLKEVMCGVTREGGLHREFNSEEVSASKVSSMMRQVQTESTETRRQVFVEICQQYSPVFRHFFYTNFSTAQIWRQKIINYRQSLATWSIVCYIVGLGDRHASNILFDQKLCTFVHIDLGMILEYSKRTLPVPEQVPFRITRDVLDPILIEGIENGQLAEECTQIMEKLKENGKVILGVASALLRETMTNFREAEQAA------------------------------GRP----SYISEMAIGRLREKLRGTDDGVTAQSSNLQIRRLLREATSADNLSRMFCGWMPFL 2378          
BLAST of Serine-protein kinase ATM vs. Ensembl Celegans
Match: let-363 (Target of rapamycin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q95Q95])

HSP 1 Score: 146.362 bits (368), Expect = 2.427e-34
Identity = 91/287 (31.71%), Postives = 156/287 (54.36%), Query Frame = 3
Query: 7224 PKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCR----KRLQISAEE-NIKKRIETFKDILTKIQPV-LGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPT-QERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKL 8063
            P+ +  + S+GL  + L+K ++D RQD  + Q+F +VN+LL N                      R ++I+ Y ++ +++ SG+I W    VP  D L    T   +    +   PL       ++L +  E   + ++++ F+  L+  Q   L +  + K P S+ WF  R +Y  S+A  S+VG+ILGLGDRH  N++LD  T +++HIDFG  F++  L     ERVPFRLTR L++ +   G++G +  T   VL +LR+ ++ +L ++E  ++DP+ +W+L
Sbjct: 2340 PRKMVIRGSNGLDYQFLLKGHEDPRQDERVMQLFGLVNTLLANNSETC----------------RRNLTIQRYSIVALSKDSGLIGW----VPNCDTL---HTLVKEYREKKAKIPLSIEHKTLQKLSLETEHLTLMQKLQLFESALSVTQGEDLRHVLWLKSPSSEVWFDRRTNYTRSVACMSMVGYILGLGDRHPSNLMLDRLTGKVVHIDFGDCFEVAMLREKFPERVPFRLTRMLINAMEVTGLDGVYNYTAERVLKMLRTNQESLLAVLEAFVYDPVINWRL 2603          
BLAST of Serine-protein kinase ATM vs. Ensembl Celegans
Match: let-363 (Target of rapamycin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q95Q95])

HSP 1 Score: 146.362 bits (368), Expect = 2.428e-34
Identity = 91/287 (31.71%), Postives = 156/287 (54.36%), Query Frame = 3
Query: 7224 PKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCR----KRLQISAEE-NIKKRIETFKDILTKIQPV-LGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPT-QERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKL 8063
            P+ +  + S+GL  + L+K ++D RQD  + Q+F +VN+LL N                      R ++I+ Y ++ +++ SG+I W    VP  D L    T   +    +   PL       ++L +  E   + ++++ F+  L+  Q   L +  + K P S+ WF  R +Y  S+A  S+VG+ILGLGDRH  N++LD  T +++HIDFG  F++  L     ERVPFRLTR L++ +   G++G +  T   VL +LR+ ++ +L ++E  ++DP+ +W+L
Sbjct: 2343 PRKMVIRGSNGLDYQFLLKGHEDPRQDERVMQLFGLVNTLLANNSETC----------------RRNLTIQRYSIVALSKDSGLIGW----VPNCDTL---HTLVKEYREKKAKIPLSIEHKTLQKLSLETEHLTLMQKLQLFESALSVTQGEDLRHVLWLKSPSSEVWFDRRTNYTRSVACMSMVGYILGLGDRHPSNLMLDRLTGKVVHIDFGDCFEVAMLREKFPERVPFRLTRMLINAMEVTGLDGVYNYTAERVLKMLRTNQESLLAVLEAFVYDPVINWRL 2606          
BLAST of Serine-protein kinase ATM vs. Ensembl Celegans
Match: smg-1 (Serine/threonine-protein kinase smg-1 [Source:UniProtKB/Swiss-Prot;Acc:O01510])

HSP 1 Score: 125.946 bits (315), Expect = 3.512e-28
Identity = 89/305 (29.18%), Postives = 139/305 (45.57%), Query Frame = 3
Query: 7224 PKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLG-NKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPL----GDWLANDKTGAHQRYRPQDSTPLQCRK--------RLQISAEENIKKRI-------------ETFKDILTKI-QPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSW 8057
            PK +    SDG +   L K  +DL  D  + Q   + N +L   KG       + ++                Y VIP+   SG+I+W E   P+      W   +K       +  ++ P   R         RL   A+  I   I             E F+ +  K    ++    + +  ++  W+   K Y+ SLA+ S+VG +LGLGDRH+ N+L+D+    ++HID+ I FD GK +   E VPFRLTR++ H LGP  + G F+ +C  VL+ LRS   ++  L++  + DPL  W
Sbjct: 1767 PKKLGFVGSDGKQVAFLFKGREDLHLDERVMQFLRLCNVMLQPGKGKHRQSVAAYQAHH--------------YAVIPLGPRSGLIKWVEGATPMFHIYRKWQMKEKALKQATKKNGETVPEIERPSNMYHNMIRLAF-ADHKIDSSITSDRSKWPAEILEEVFESLTAKTPTDLISRELWMRANDATTWWSVTKRYSRSLAVMSMVGSVLGLGDRHLDNLLVDLKWGHVVHIDYNICFDKGKNLRIPETVPFRLTRNMRHALGPSEMYGTFRESCVHVLSTLRSGHQVLTMLLDAFVFDPLVDW 2056          
BLAST of Serine-protein kinase ATM vs. Ensembl Fly
Match: tefu (gene:FBgn0045035 transcript:FBtr0110874)

HSP 1 Score: 337.421 bits (864), Expect = 3.242e-92
Identity = 226/699 (32.33%), Postives = 348/699 (49.79%), Query Frame = 3
Query: 6288 KQESDMLSTMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKI---LEKQSEVDWDELNNLSQDRERFL-LSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSENNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMNSRISVAYTMVEQLVKE--SQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLA-NDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKF----AGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            KQ +   +T++ ++ ++Y  ++ Y  S EY+  +K + E  R  +  V  R     R I   +++ + +D  +LN + +    +L L+     + C  +   +   I+ ++S+W +N ++++    I D I  + ++KF+    QL ARLNS+N  S    L  L+ +   DHP+H+ Y L  +  A+ D                +    R  +A  ++  + ++  +  +  +  + L  A I +AN   +   + +   ++      + R      +  PTL +P+  S +YS+     +V + +  +  GG+N P  + C  SDG  R QLVK  DDLRQD+VMQQVF +VN LL                  S FI  R + +RTYKV P++  SGI+EWC ++VP+G +L    K GAH RYRP D    +CRK      +   + R   +K I   I+PV  YF  EKFP    WF+ R +Y NS+A  S+VG++LGLGDRH QNIL+D  TAE+IHIDFGIAF+ GK+  T E VPFRLTRD V  +G  G +G F  +C   +++LR  K +  T++EVLL+DPL  W        VL  K+                      +     S N +A+R +L +  K     AG +  S  N E  V  LI  A+   NL  +F GW  +L
Sbjct: 2133 KQRTAAYATIAKYADREYQQLHDYRHSQEYQT-LKDIIEQNRQTAEKVTQRENQDRRVISVQMKRYASLDEQQLNQIEEKLTEYLRLALTNYMAYCRLDSGFSSAAIYRIISLWFTNATSKQCQECIKDEILTVPSYKFICAANQLTARLNSKNT-SLLKGLTDLLVQCGKDHPYHTFYQLYPLVFAHLD--------------GENSNTERSGIARKIIAMICEKNGTAGECSKQLESLLPALITFANEGKTNDNRPVSDSVRNKQFDKVRRWRNLNAVHCPTLELPVMPSKEYSIIS---VVKWTNETTQCGGLNAPVKIMCVCSDGKIRAQLVKGKDDLRQDAVMQQVFGIVNELLNQD---------------SEFI-ERKLKLRTYKVTPLSMRSGILEWCTNSVPVGHYLVVEGKGGAHARYRPNDWNNNKCRKLSSDHLKSPKETRYAIYKKICENIKPVFHYFLLEKFPIPGVWFERRLAYTNSVATTSMVGYVLGLGDRHTQNILVDQQTAEVIHIDFGIAFEQGKIQTTPETVPFRLTRDFVAPMGICGTKGVFAKSCEATMHILRRYKSVFTTILEVLLYDPLFIWG-------VLKKKQSP--------------------QQSGEESVNLVAQRALLLVQNKLDGREAGTMGDS--NVEAQVERLINEATLPSNLCMLFPGWDPHL 2767          
BLAST of Serine-protein kinase ATM vs. Ensembl Fly
Match: mei-41 (gene:FBgn0004367 transcript:FBtr0074271)

HSP 1 Score: 171.014 bits (432), Expect = 1.122e-41
Identity = 150/606 (24.75%), Postives = 271/606 (44.72%), Query Frame = 3
Query: 6603 LMSMWL-------SNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSENNKSFEINLEKLIKRIILDHPFHSIYNLLA-IRNANRDXXXXXXXXXXXXXXANDKMNSRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFP-LNCSLLRIAKQVKLPVPTLS---------IPIDRSLKYSLDRLPL----IVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETF-KDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            L+S+WL       + E  +K+N+++++    + T  F  +  Q+ +RL    N  F + L  +I +++  +P  S++ LL   ++A           L   +  N      +    ++ E+L+  +  ++  D               +S     + K  K P  +  LL   K ++  +P  S         +P ++S   +++  P     I GF +   +      PK +  + SDG     LVK  DDLR+D+ + +   +V   L                   A    R + IRTY V+P  +  G++EW  +   L  + +       QR     +  LQ    L +   E+I+++ E F K ++    PV   +  ++F     W++AR +Y  ++A+ S+VG+ILGLGDRH +NIL      + +H+DF   F+ G+L+P  E VPFRLT +++  +GP GVEG F+  C   L LL+ +   +++++   ++D      +  Q      T++ A                     ++      ++A+R+   + R+ A ++    L+ EG VN+LI  A+ V+NLA M+ GW A+L
Sbjct: 1983 LISLWLDTTESSTNTEQVKKMNDLLTNCCTALPTAVFYTVYSQMLSRLCHPVNDVFTV-LRNVIIKLVEAYPQQSLWMLLPHFKSAKAHRIKRCKLVLTDSRLQNSTFQKLLQDFNSLTERLMDLTNKEVTLDR-----------TYKLSDLDTRLSKLCKQPEFSQILLPFEKYMQPTLPLNSDSNSSEGSHLPANQS---TVNWFPYQQIYISGFQESVLILRSAAKPKKLTIRCSDGKDYDVLVKPKDDLRRDARLMEFNGLVKRYLHQ----------------DAPARQRRLHIRTYAVLPFNEECGLVEWLPN---LASYRSICMNLYAQRRLVMSTRQLQ---SLAVPLHESIERKREVFTKQLVPAHPPVFQEWLRQRFATPHSWYEARNTYIRTVAVMSMVGYILGLGDRHGENILFAEGNGDAVHVDFNCLFNQGELLPYPEVVPFRLTHNMIVAMGPLGVEGSFRKCCEITLRLLKQESKTLMSILRPFVYD------VGAQ------TRKGAAT-------------------AKITKDVQRIADRLQGHVKRQQANSIP---LSTEGQVNFLINEATKVDNLASMYIGWGAFL 2517          
BLAST of Serine-protein kinase ATM vs. Ensembl Fly
Match: Tor (gene:FBgn0021796 transcript:FBtr0080422)

HSP 1 Score: 162.54 bits (410), Expect = 3.837e-39
Identity = 131/464 (28.23%), Postives = 215/464 (46.34%), Query Frame = 3
Query: 7056 LKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEEN-----IKKRIETFKDILTKIQPV-LGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPT-QERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDN-------------KSRP--------------GSSQNQMAERVILEMSRKFAGA--VDSSYLNCEGHVNYLIQTASNVENLARMFHGW 8339
            L+ P     L   K ++L VP    P    ++ S+ +  L V    + S Q     P+ +  + S+G     L+K ++DLRQD  + Q+FS+VN+LL +                    + R ++I+ Y VIP++  SG+I W    VP  D L        + YR +   PL    R  ++   +     + +++E F+  L + Q   L    + K P S+ WF+ R +Y  SLA+ S+VG+ILGLGDRH  N++LD  + +++HIDFG  F++        E++PFRLTR L+  +   G+EG ++ TC  V+ +LR  KD ++ ++E  ++DPL +W       R+L   ++ ++          +   G  +             KS+P                  N  A +VI  +  K  G        +N +  V  LIQ A+N ENL + + GW
Sbjct: 2042 LELPYVSPKLMTCKDLELAVPGSYNPGQELIRISIIKTNLQV----ITSKQR----PRKLCIRGSNGKDYMYLLKGHEDLRQDERVMQLFSLVNTLLLDDPDT----------------FRRNLAIQRYAVIPLSTNSGLIGW----VPHCDTLHT----LIRDYRDKKKVPLNQEHRTMLNFAPDYDHLTLMQKVEVFEHALGQTQGDDLAKLLWLKSPSSELWFERRNNYTRSLAVMSMVGYILGLGDRHPSNLMLDRMSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLIKAMEVTGIEGTYRRTCESVMLVLRRNKDSLMAVLEAFVYDPLLNW-------RLLDVDKKGNDAVAGAGAPGGRGGSGMQDSLSNSVEDSLPMAKSKPYDPTLQQGGLHNNVADETNSKASQVIKRVKCKLTGTDFQTEKSVNEQSQVELLIQQATNNENLCQCYIGW 2466          
BLAST of Serine-protein kinase ATM vs. Ensembl Fly
Match: Tor (gene:FBgn0021796 transcript:FBtr0336615)

HSP 1 Score: 162.54 bits (410), Expect = 3.870e-39
Identity = 131/464 (28.23%), Postives = 215/464 (46.34%), Query Frame = 3
Query: 7056 LKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEEN-----IKKRIETFKDILTKIQPV-LGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPT-QERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDN-------------KSRP--------------GSSQNQMAERVILEMSRKFAGA--VDSSYLNCEGHVNYLIQTASNVENLARMFHGW 8339
            L+ P     L   K ++L VP    P    ++ S+ +  L V    + S Q     P+ +  + S+G     L+K ++DLRQD  + Q+FS+VN+LL +                    + R ++I+ Y VIP++  SG+I W    VP  D L        + YR +   PL    R  ++   +     + +++E F+  L + Q   L    + K P S+ WF+ R +Y  SLA+ S+VG+ILGLGDRH  N++LD  + +++HIDFG  F++        E++PFRLTR L+  +   G+EG ++ TC  V+ +LR  KD ++ ++E  ++DPL +W       R+L   ++ ++          +   G  +             KS+P                  N  A +VI  +  K  G        +N +  V  LIQ A+N ENL + + GW
Sbjct: 2043 LELPYVSPKLMTCKDLELAVPGSYNPGQELIRISIIKTNLQV----ITSKQR----PRKLCIRGSNGKDYMYLLKGHEDLRQDERVMQLFSLVNTLLLDDPDT----------------FRRNLAIQRYAVIPLSTNSGLIGW----VPHCDTLHT----LIRDYRDKKKVPLNQEHRTMLNFAPDYDHLTLMQKVEVFEHALGQTQGDDLAKLLWLKSPSSELWFERRNNYTRSLAVMSMVGYILGLGDRHPSNLMLDRMSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLIKAMEVTGIEGTYRRTCESVMLVLRRNKDSLMAVLEAFVYDPLLNW-------RLLDVDKKGNDAVAGAGAPGGRGGSGMQDSLSNSVEDSLPMAKSKPYDPTLQQGGLHNNVADETNSKASQVIKRVKCKLTGTDFQTEKSVNEQSQVELLIQQATNNENLCQCYIGW 2467          
BLAST of Serine-protein kinase ATM vs. Ensembl Fly
Match: nonC (gene:FBgn0263968 transcript:FBtr0070972)

HSP 1 Score: 125.561 bits (314), Expect = 6.910e-28
Identity = 82/311 (26.37%), Postives = 153/311 (49.20%), Query Frame = 3
Query: 7224 PKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNK----GSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYR-------------PQDST--------PLQCRKRLQISAEEN---IKKRIETFKDILTKIQP--VLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLN 8066
            PK V    S+G +   L K  +DL  D  + Q  S+ N+++  +    G+  Y+A+                    Y VIP+   SG+I W +   P+    A  K    +R +             P+  T        PL  +  +Q+S       I   ++   D L++  P  +L    + +   +  W ++ + +   +++ S++G+++GLGDRH+ N+L+++ + +++HID+ + F+ G+ +   E+VPFRLT++LV  +G  G+EG F+  C  VL ++R +++ +LTL+E  ++DPL  W  N
Sbjct: 1910 PKKVAFYGSNGQRYTFLFKGMEDLHLDERIMQFLSISNAIMACRSDAPGNGCYRAHH-------------------YSVIPLGPQSGLISWVDGVTPV---FALYKKWQQRRSQVAGNAGAGAVANVPRRFTDLFYNKLSPLLAKHNMQVSDPRRQWPISVLLQVL-DELSQETPNDLLARELWCQAGNAAEWRQSVRRFVRCMSVMSMIGYVIGLGDRHLDNVLINLGSGDIVHIDYNVCFEKGRTLRIPEKVPFRLTQNLVQAMGITGIEGPFRLGCEYVLKVMRKERETLLTLLEAFVYDPLVDWTTN 2197          
BLAST of Serine-protein kinase ATM vs. Ensembl Zebrafish
Match: atm (ATM serine/threonine kinase [Source:ZFIN;Acc:ZDB-GENE-040809-1])

HSP 1 Score: 470.315 bits (1209), Expect = 3.262e-133
Identity = 272/747 (36.41%), Postives = 433/747 (57.97%), Query Frame = 3
Query: 6189 KIC-AWNQEYPVHSVSHIRTKILEPAM--------GVFGKSLKQESDMLSTMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKI--------LEKQSEVDWDELNNLSQDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSENNKS-------FEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMN-SRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKRE-ADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            ++C +W  E  + S + I    LE A+        G+  K   Q++    +++ FS  QY  I  YM+SSE+EN+  +L ++K +V  + +       RK+        ++++ E+D   L NL  DR RFLL A  +  ECL+  + +D  +F L S+WL N   + +N+ +   + KI ++KFL LM QL AR+ ++ + S       F   L +LI +  +DHP H+++ +LA+ NAN+D    +S+S KS       ++  R  VA  +++ +V++ ++ +++D ++L  AYI  A +D S  K +  K +  P    L++I     + +PT+ I +D S +Y  + +  +  F   + L GG+NLPKI+ C+ SDG+ RRQLVK  DDLRQD+VMQQVF + ++LL                  +A    R ++IR YKV+P +Q SG++EWC  TVP+G++L + + GAH+R+RPQD   + CRK++  +       +++ F ++    +PV  YF  E+F +   W + R +Y  S+A +SIVG+I+GLGDRH+QNIL+D  T+EL+HID G+AF+ GK++PT E VPFRL+RD+V G+G  GVEG F+  C   + ++RS ++ +LT++EVLL+DPL  W +NP  A  L    E A+ +           IE    K+    S N++AERV+L +  K  G  D + L+  G VN LIQ A + +NL+R+F GWQA++
Sbjct: 1612 RLCGSWLAESCLESPAVILENYLERAVEVIEEHCGGLKSKLQSQKTQAYFSLARFSDAQYQGIENYMKSSEFENKHALLEKAKEEVDLMRE-------RKVNNNRYTVKVQRELELDVKALANLQADRNRFLLKAVENYIECLELGEEHDTWVFRLASLWLENADVKAVNDKMKSGVKKIPSYKFLPLMYQLAARMGTKVSSSMASQDVGFHHVLNELICQSSVDHPHHTLFIILALVNANKDDSFSRSRSSKSSARQPSPLDLERAEVARKIID-VVRKKRAKMVKDIEMLCNAYITLAYMDASRHKTE-KKAIPIPAEQPLMQIKDLEDVIIPTMDIKVDPSGRY--EDVVTVRSFKRHFHLAGGVNLPKIIDCEGSDGISRRQLVKGQDDLRQDAVMQQVFHMCSTLLQR----------------NAETRKRKLNIRRYKVVPFSQRSGVLEWCSGTVPIGEFLVDPQKGAHKRFRPQDWANMLCRKKMMEAQRMEFNDKLQAFTEVCQNFRPVFRYFCMERFLDPAIWLERRLAYTRSVATSSIVGYIVGLGDRHIQNILIDEQTSELVHIDLGVAFEQGKILPTPETVPFRLSRDIVDGMGITGVEGVFRRCCEKTMEVMRSSQEALLTIVEVLLYDPLFDWTMNPLKAFYLQQHDEQAELNATLNPTPGGDEIETH-RKASDSQSFNKVAERVLLRLQEKLKGVEDGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWQAWV 2330          
BLAST of Serine-protein kinase ATM vs. Ensembl Zebrafish
Match: atm (ATM serine/threonine kinase [Source:ZFIN;Acc:ZDB-GENE-040809-1])

HSP 1 Score: 471.085 bits (1211), Expect = 7.599e-133
Identity = 272/747 (36.41%), Postives = 433/747 (57.97%), Query Frame = 3
Query: 6189 KIC-AWNQEYPVHSVSHIRTKILEPAM--------GVFGKSLKQESDMLSTMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKI--------LEKQSEVDWDELNNLSQDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSENNKS-------FEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMN-SRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKRE-ADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            ++C +W  E  + S + I    LE A+        G+  K   Q++    +++ FS  QY  I  YM+SSE+EN+  +L ++K +V  + +       RK+        ++++ E+D   L NL  DR RFLL A  +  ECL+  + +D  +F L S+WL N   + +N+ +   + KI ++KFL LM QL AR+ ++ + S       F   L +LI +  +DHP H+++ +LA+ NAN+D    +S+S KS       ++  R  VA  +++ +V++ ++ +++D ++L  AYI  A +D S  K +  K +  P    L++I     + +PT+ I +D S +Y  + +  +  F   + L GG+NLPKI+ C+ SDG+ RRQLVK  DDLRQD+VMQQVF + ++LL                  +A    R ++IR YKV+P +Q SG++EWC  TVP+G++L + + GAH+R+RPQD   + CRK++  +       +++ F ++    +PV  YF  E+F +   W + R +Y  S+A +SIVG+I+GLGDRH+QNIL+D  T+EL+HID G+AF+ GK++PT E VPFRL+RD+V G+G  GVEG F+  C   + ++RS ++ +LT++EVLL+DPL  W +NP  A  L    E A+ +           IE    K+    S N++AERV+L +  K  G  D + L+  G VN LIQ A + +NL+R+F GWQA++
Sbjct: 2373 RLCGSWLAESCLESPAVILENYLERAVEVIEEHCGGLKSKLQSQKTQAYFSLARFSDAQYQGIENYMKSSEFENKHALLEKAKEEVDLMRE-------RKVNNNRYTVKVQRELELDVKALANLQADRNRFLLKAVENYIECLELGEEHDTWVFRLASLWLENADVKAVNDKMKSGVKKIPSYKFLPLMYQLAARMGTKVSSSMASQDVGFHHVLNELICQSSVDHPHHTLFIILALVNANKDDSFSRSRSSKSSARQPSPLDLERAEVARKIID-VVRKKRAKMVKDIEMLCNAYITLAYMDASRHKTE-KKAIPIPAEQPLMQIKDLEDVIIPTMDIKVDPSGRY--EDVVTVRSFKRHFHLAGGVNLPKIIDCEGSDGISRRQLVKGQDDLRQDAVMQQVFHMCSTLLQR----------------NAETRKRKLNIRRYKVVPFSQRSGVLEWCSGTVPIGEFLVDPQKGAHKRFRPQDWANMLCRKKMMEAQRMEFNDKLQAFTEVCQNFRPVFRYFCMERFLDPAIWLERRLAYTRSVATSSIVGYIVGLGDRHIQNILIDEQTSELVHIDLGVAFEQGKILPTPETVPFRLSRDIVDGMGITGVEGVFRRCCEKTMEVMRSSQEALLTIVEVLLYDPLFDWTMNPLKAFYLQQHDEQAELNATLNPTPGGDEIETH-RKASDSQSFNKVAERVLLRLQEKLKGVEDGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWQAWV 3091          
BLAST of Serine-protein kinase ATM vs. Ensembl Zebrafish
Match: atr (ATR serine/threonine kinase [Source:ZFIN;Acc:ZDB-GENE-070912-458])

HSP 1 Score: 216.468 bits (550), Expect = 2.052e-55
Identity = 158/591 (26.73%), Postives = 273/591 (46.19%), Query Frame = 3
Query: 6639 KLNNIISDVIGKIETHKFLVLMPQLCARLNSENNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMNSRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLR--IAKQVKLPVPTLSIPIDRSLKYS---LDRLP----LIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLAN--DKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDIL-TKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNK--SRPGSSQNQMAERVILEMSRKFAGAVDSSY------LNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            K+N++ISD    +  ++FL    QL +R+   +N+ F + +E ++ ++ L +P  +++ + A+  ++  +                +MN    +    +   + +S    I DA+ LT   +   N  +      +   + F +   L+      Q+ +P+ ++ IP   S   +    D  P     + GFDD   +   +  PK +  + SDG     + K  DDLR+D  + +   ++N       S+   A S +          R + IRTY VIP+ +  GIIEW   T  L   L     + G +        T L   K+L +      +++++  KD+L  +  PV   +    FP+   W+ +R +Y  S A+ S+VG+ILGLGDRH +NIL D  T E +H+DF   F+ G+     E VPFRLT+++VH +GP G EG F+  C  +L L+R Q++ ++++++  LHDPL  W                            K ++GF     +  G   N+ A+  +L++ ++  G + +        L+ EGHV+YLIQ A++   L  M+ GW  YL
Sbjct: 2115 KINSVISDHTSNLSPYQFLTAFSQLISRICHSSNEVFAVLME-IVAKVFLAYPQQAMWMMTAVSKSSYPT----------------RMNRCKEILKKAIS--LNDSFMKFIGDANRLTDKLLELGNKPVDGNSSTLSMSVHFKMLKKLVEEPTFSQILIPLQSVLIPTLPSTGGANPKHDAFPGHWVYLSGFDDTVEILASLQKPKKISLKGSDGKFYTMMCKPKDDLRKDCRLMEFNCLINK------SLRKDAESRR----------RDLRIRTYAVIPLNEECGIIEWVNKTAGLRHILTKLYKEKGIYV-----SGTEL---KKLILPKTAPFQEKLKLHKDVLCARHPPVFHEWFLRTFPDPTSWYNSRSAYCRSTAVMSMVGYILGLGDRHGENILFDSFTGECVHVDFNCLFNKGETFDVPEVVPFRLTQNMVHAMGPMGTEGLFRQACEVILRLMRDQREPLMSVLKTFLHDPLVEWS---------------------------KPVKGFSKTQVNESGEILNEKAKTHVLDIEQRLQGVIKNRNKVMGLPLSIEGHVHYLIQEATDDNLLCMMYLGWGPYL 2635          
BLAST of Serine-protein kinase ATM vs. Ensembl Zebrafish
Match: AL844179.1 (pep chromosome:GRCz11:CHR_ALT_CTG8_1_27:46082265:46126761:-1 gene:ENSDARG00000112020.1 transcript:ENSDART00000184694.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL844179.1)

HSP 1 Score: 154.066 bits (388), Expect = 2.328e-37
Identity = 122/414 (29.47%), Postives = 202/414 (48.79%), Query Frame = 3
Query: 7224 PKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFH--------------FEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPT-QERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFD----NKSRPGSSQ------------------NQMAERVILEMSRKFAGAVDSSY---LNCEGHVNYLIQTASNVENLARMFHGWQA 8345
            P+ +    S+G +   L+K ++DLRQD  + Q+F +VN+LL N  +   K                 +SI+ Y VIP++  SG+I W    VP  D L        + YR         +K++ ++ E  I  R+    D LT ++ V  + H              + K P S+ WF  R +Y  SLA+ S+VG+ILGLGDRH  N++LD  + +++HIDFG  F++        E++PFRLTR L + +   G++G ++ TC  V+ +LR  +D ++ ++E  ++DPL +W+L   + +    KR      + T+  S + +EG D       +PG++                   N+ A ++I  +  K  G  D S+   L+    V  LI+ A++ ENL ++F  W A
Sbjct:  357 PRKLTIMGSNGHEFMFLLKGHEDLRQDERVMQLFGLVNTLLANDPASLRKN----------------LSIQRYAVIPLSTNSGLIGW----VPHCDTLH----ALIRDYRE--------KKKILLNIEHRIMLRMAPDYDHLTLMEKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHRDSVMAVLEAFVYDPLLNWRLMDTNTK--GNKRSRTRTDSYTAGQSVEAMEGIDLGETTHKKPGTTVPESIHSFIGDGLVQPEALNKKAIQIINRVRDKLTGR-DFSHDETLDVPTQVELLIKQATSHENLCQLF-CWSA 734          
BLAST of Serine-protein kinase ATM vs. Ensembl Zebrafish
Match: mtor (mechanistic target of rapamycin kinase [Source:ZFIN;Acc:ZDB-GENE-030131-2974])

HSP 1 Score: 155.992 bits (393), Expect = 4.493e-37
Identity = 121/412 (29.37%), Postives = 201/412 (48.79%), Query Frame = 3
Query: 7224 PKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFH--------------FEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPT-QERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFD----NKSRPGSS------------------QNQMAERVILEMSRKFAGAVDSSY---LNCEGHVNYLIQTASNVENLARMFHGW 8339
            P+ +    S+G +   L+K ++DLRQD  + Q+F +VN+LL N  +   K                 +SI+ Y VIP++  SG+I W    VP  D L        + YR         +K++ ++ E  I  R+    D LT ++ V  + H              + K P S+ WF  R +Y  SLA+ S+VG+ILGLGDRH  N++LD  + +++HIDFG  F++        E++PFRLTR L + +   G++G ++ TC  V+ +LR  +D ++ ++E  ++DPL +W+L   + +    KR      + T+  S + +EG D       +PG++                   N+ A ++I  +  K  G  D S+   L+    V  LI+ A++ ENL + + GW
Sbjct: 2135 PRKLTIMGSNGHEFMFLLKGHEDLRQDERVMQLFGLVNTLLANDPASLRKN----------------LSIQRYAVIPLSTNSGLIGW----VPHCDTLH----ALIRDYRE--------KKKILLNIEHRIMLRMAPDYDHLTLMEKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHRDSVMAVLEAFVYDPLLNWRLMDTNTK--GNKRSRTRTDSYTAGQSVEAMEGIDLGETTHKKPGTTVPESIHSFIGDGLVQPEALNKKAIQIINRVRDKLTGR-DFSHDETLDVPTQVELLIKQATSHENLCQCYIGW 2511          
BLAST of Serine-protein kinase ATM vs. Ensembl Xenopus
Match: ATM (ATM serine/threonine kinase [Source:NCBI gene;Acc:100490767])

HSP 1 Score: 488.034 bits (1255), Expect = 5.704e-138
Identity = 286/754 (37.93%), Postives = 447/754 (59.28%), Query Frame = 3
Query: 6150 HDLFFKLYFKAVSKICA-WNQEYPVHSVSHIRTKILEPAMGVF------GKSLKQESDMLS--TMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWDELNNLS--QDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSE--NNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMNS-------RISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            +D   +L +    ++C  W  E  + S + I    LE A+ V       G+ L QE  M +  +++ FS  QY  I+ YM+SSE+EN+  +L ++K +V  +   + +   R  ++ Q E++ DE   L+  +DR+RFL  A  +   CL + + +D  IF L S+WL N +  ++N+++     +I +HKFL LM QL AR+ ++   N  F   L  LI RI +DHP H+++ +LA+ NAN+D +L K +++K  +   +           R+  A  +V+  +K+ +++++RD + L  AYI  AN+D + +K      +  P +  + ++ K   + +PT+ I +D S KY  + L  IV F   + L GG+NLPKI+ C  SDG +RRQLVK  DDLRQD+VMQQVF + N+LL  + S T K               R ++IR YKV+P++Q SG++EWC  TVP+G++L N+K GAH+RYRP+D   LQC++++        +++ +TF DI    +PV  YF  EKF +   WF+ R +Y  S+A +SIVG+I+GLGDRHVQNIL+D  +AEL+HID G+AF+ GK++PT E VPFRLTRD+V G+G  GVEG F+  C   + ++R+ ++ +LT++EVLL+DPL  W +NP  A  L  + E D +     +         D++     S N++AERV+L +  K  G  +   L+  G VN+LIQ A + +NL+R+F GW+A++
Sbjct: 2161 NDSTLRLLYAECLRLCGNWLAETCLESPTVIMQNYLEKAVEVAEYPDGAGEKL-QEGRMKAFLSLARFSDAQYQRIDNYMKSSEFENKQALLRKAKEEVGLMKQHKVQTN-RYTVKVQRELELDECAILALREDRKRFLCKAVENYISCLVSGEEHDMWIFRLCSLWLENSAVSEVNSMMRQDAQRIPSHKFLPLMYQLAARMGTKKMGNLGFHDVLNNLIGRISMDHPHHTLFIILALANANKDDQLMKPEAVKRGRLTKNAPKQISQLDEDRMEAARHIVDT-IKKQRTNMVRDVERLCDAYITLANMDANQWKSQ-RNAIPIPSDQPITKLNKLHDVVIPTMEIKVDPSGKY--ENLVTIVSFKPEFRLAGGLNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLL-QRNSETRK---------------RKLTIRRYKVVPLSQRSGVLEWCTGTVPIGEYLVNEKEGAHKRYRPRDYGSLQCQRKMMEVQRGRFEEKYQTFLDISENFRPVFRYFCMEKFLDPAMWFEKRLAYTRSVATSSIVGYIVGLGDRHVQNILIDEESAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMRNNQEALLTIVEVLLYDPLFDWTMNPLKALYLQ-QDEVDFNATLGGDDPECNRNSCDSQ-----SVNKVAERVLLRLQEKLKGVEEGMVLSVGGQVNHLIQQAMDPKNLSRLFPGWKAWV 2886          
BLAST of Serine-protein kinase ATM vs. Ensembl Xenopus
Match: ATM (ATM serine/threonine kinase [Source:NCBI gene;Acc:100490767])

HSP 1 Score: 488.034 bits (1255), Expect = 6.327e-138
Identity = 286/754 (37.93%), Postives = 447/754 (59.28%), Query Frame = 3
Query: 6150 HDLFFKLYFKAVSKICA-WNQEYPVHSVSHIRTKILEPAMGVF------GKSLKQESDMLS--TMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWDELNNLS--QDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSE--NNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMNS-------RISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            +D   +L +    ++C  W  E  + S + I    LE A+ V       G+ L QE  M +  +++ FS  QY  I+ YM+SSE+EN+  +L ++K +V  +   + +   R  ++ Q E++ DE   L+  +DR+RFL  A  +   CL + + +D  IF L S+WL N +  ++N+++     +I +HKFL LM QL AR+ ++   N  F   L  LI RI +DHP H+++ +LA+ NAN+D +L K +++K  +   +           R+  A  +V+  +K+ +++++RD + L  AYI  AN+D + +K      +  P +  + ++ K   + +PT+ I +D S KY  + L  IV F   + L GG+NLPKI+ C  SDG +RRQLVK  DDLRQD+VMQQVF + N+LL  + S T K               R ++IR YKV+P++Q SG++EWC  TVP+G++L N+K GAH+RYRP+D   LQC++++        +++ +TF DI    +PV  YF  EKF +   WF+ R +Y  S+A +SIVG+I+GLGDRHVQNIL+D  +AEL+HID G+AF+ GK++PT E VPFRLTRD+V G+G  GVEG F+  C   + ++R+ ++ +LT++EVLL+DPL  W +NP  A  L  + E D +     +         D++     S N++AERV+L +  K  G  +   L+  G VN+LIQ A + +NL+R+F GW+A++
Sbjct: 2298 NDSTLRLLYAECLRLCGNWLAETCLESPTVIMQNYLEKAVEVAEYPDGAGEKL-QEGRMKAFLSLARFSDAQYQRIDNYMKSSEFENKQALLRKAKEEVGLMKQHKVQTN-RYTVKVQRELELDECAILALREDRKRFLCKAVENYISCLVSGEEHDMWIFRLCSLWLENSAVSEVNSMMRQDAQRIPSHKFLPLMYQLAARMGTKKMGNLGFHDVLNNLIGRISMDHPHHTLFIILALANANKDDQLMKPEAVKRGRLTKNAPKQISQLDEDRMEAARHIVDT-IKKQRTNMVRDVERLCDAYITLANMDANQWKSQ-RNAIPIPSDQPITKLNKLHDVVIPTMEIKVDPSGKY--ENLVTIVSFKPEFRLAGGLNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLL-QRNSETRK---------------RKLTIRRYKVVPLSQRSGVLEWCTGTVPIGEYLVNEKEGAHKRYRPRDYGSLQCQRKMMEVQRGRFEEKYQTFLDISENFRPVFRYFCMEKFLDPAMWFEKRLAYTRSVATSSIVGYIVGLGDRHVQNILIDEESAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMRNNQEALLTIVEVLLYDPLFDWTMNPLKALYLQ-QDEVDFNATLGGDDPECNRNSCDSQ-----SVNKVAERVLLRLQEKLKGVEEGMVLSVGGQVNHLIQQAMDPKNLSRLFPGWKAWV 3023          
BLAST of Serine-protein kinase ATM vs. Ensembl Xenopus
Match: ATM (ATM serine/threonine kinase [Source:NCBI gene;Acc:100490767])

HSP 1 Score: 487.649 bits (1254), Expect = 6.468e-138
Identity = 286/754 (37.93%), Postives = 447/754 (59.28%), Query Frame = 3
Query: 6150 HDLFFKLYFKAVSKICA-WNQEYPVHSVSHIRTKILEPAMGVF------GKSLKQESDMLS--TMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWDELNNLS--QDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSE--NNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMNS-------RISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            +D   +L +    ++C  W  E  + S + I    LE A+ V       G+ L QE  M +  +++ FS  QY  I+ YM+SSE+EN+  +L ++K +V  +   + +   R  ++ Q E++ DE   L+  +DR+RFL  A  +   CL + + +D  IF L S+WL N +  ++N+++     +I +HKFL LM QL AR+ ++   N  F   L  LI RI +DHP H+++ +LA+ NAN+D +L K +++K  +   +           R+  A  +V+  +K+ +++++RD + L  AYI  AN+D + +K      +  P +  + ++ K   + +PT+ I +D S KY  + L  IV F   + L GG+NLPKI+ C  SDG +RRQLVK  DDLRQD+VMQQVF + N+LL  + S T K               R ++IR YKV+P++Q SG++EWC  TVP+G++L N+K GAH+RYRP+D   LQC++++        +++ +TF DI    +PV  YF  EKF +   WF+ R +Y  S+A +SIVG+I+GLGDRHVQNIL+D  +AEL+HID G+AF+ GK++PT E VPFRLTRD+V G+G  GVEG F+  C   + ++R+ ++ +LT++EVLL+DPL  W +NP  A  L  + E D +     +         D++     S N++AERV+L +  K  G  +   L+  G VN+LIQ A + +NL+R+F GW+A++
Sbjct: 2159 NDSTLRLLYAECLRLCGNWLAETCLESPTVIMQNYLEKAVEVAEYPDGAGEKL-QEGRMKAFLSLARFSDAQYQRIDNYMKSSEFENKQALLRKAKEEVGLMKQHKVQTN-RYTVKVQRELELDECAILALREDRKRFLCKAVENYISCLVSGEEHDMWIFRLCSLWLENSAVSEVNSMMRQDAQRIPSHKFLPLMYQLAARMGTKKMGNLGFHDVLNNLIGRISMDHPHHTLFIILALANANKDDQLMKPEAVKRGRLTKNAPKQISQLDEDRMEAARHIVDT-IKKQRTNMVRDVERLCDAYITLANMDANQWKSQ-RNAIPIPSDQPITKLNKLHDVVIPTMEIKVDPSGKY--ENLVTIVSFKPEFRLAGGLNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLL-QRNSETRK---------------RKLTIRRYKVVPLSQRSGVLEWCTGTVPIGEYLVNEKEGAHKRYRPRDYGSLQCQRKMMEVQRGRFEEKYQTFLDISENFRPVFRYFCMEKFLDPAMWFEKRLAYTRSVATSSIVGYIVGLGDRHVQNILIDEESAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMRNNQEALLTIVEVLLYDPLFDWTMNPLKALYLQ-QDEVDFNATLGGDDPECNRNSCDSQ-----SVNKVAERVLLRLQEKLKGVEEGMVLSVGGQVNHLIQQAMDPKNLSRLFPGWKAWV 2884          
BLAST of Serine-protein kinase ATM vs. Ensembl Xenopus
Match: ATM (ATM serine/threonine kinase [Source:NCBI gene;Acc:100490767])

HSP 1 Score: 487.649 bits (1254), Expect = 7.328e-138
Identity = 286/754 (37.93%), Postives = 447/754 (59.28%), Query Frame = 3
Query: 6150 HDLFFKLYFKAVSKICA-WNQEYPVHSVSHIRTKILEPAMGVF------GKSLKQESDMLS--TMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWDELNNLS--QDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSE--NNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMNS-------RISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            +D   +L +    ++C  W  E  + S + I    LE A+ V       G+ L QE  M +  +++ FS  QY  I+ YM+SSE+EN+  +L ++K +V  +   + +   R  ++ Q E++ DE   L+  +DR+RFL  A  +   CL + + +D  IF L S+WL N +  ++N+++     +I +HKFL LM QL AR+ ++   N  F   L  LI RI +DHP H+++ +LA+ NAN+D +L K +++K  +   +           R+  A  +V+  +K+ +++++RD + L  AYI  AN+D + +K      +  P +  + ++ K   + +PT+ I +D S KY  + L  IV F   + L GG+NLPKI+ C  SDG +RRQLVK  DDLRQD+VMQQVF + N+LL  + S T K               R ++IR YKV+P++Q SG++EWC  TVP+G++L N+K GAH+RYRP+D   LQC++++        +++ +TF DI    +PV  YF  EKF +   WF+ R +Y  S+A +SIVG+I+GLGDRHVQNIL+D  +AEL+HID G+AF+ GK++PT E VPFRLTRD+V G+G  GVEG F+  C   + ++R+ ++ +LT++EVLL+DPL  W +NP  A  L  + E D +     +         D++     S N++AERV+L +  K  G  +   L+  G VN+LIQ A + +NL+R+F GW+A++
Sbjct: 2208 NDSTLRLLYAECLRLCGNWLAETCLESPTVIMQNYLEKAVEVAEYPDGAGEKL-QEGRMKAFLSLARFSDAQYQRIDNYMKSSEFENKQALLRKAKEEVGLMKQHKVQTN-RYTVKVQRELELDECAILALREDRKRFLCKAVENYISCLVSGEEHDMWIFRLCSLWLENSAVSEVNSMMRQDAQRIPSHKFLPLMYQLAARMGTKKMGNLGFHDVLNNLIGRISMDHPHHTLFIILALANANKDDQLMKPEAVKRGRLTKNAPKQISQLDEDRMEAARHIVDT-IKKQRTNMVRDVERLCDAYITLANMDANQWKSQ-RNAIPIPSDQPITKLNKLHDVVIPTMEIKVDPSGKY--ENLVTIVSFKPEFRLAGGLNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLL-QRNSETRK---------------RKLTIRRYKVVPLSQRSGVLEWCTGTVPIGEYLVNEKEGAHKRYRPRDYGSLQCQRKMMEVQRGRFEEKYQTFLDISENFRPVFRYFCMEKFLDPAMWFEKRLAYTRSVATSSIVGYIVGLGDRHVQNILIDEESAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMRNNQEALLTIVEVLLYDPLFDWTMNPLKALYLQ-QDEVDFNATLGGDDPECNRNSCDSQ-----SVNKVAERVLLRLQEKLKGVEEGMVLSVGGQVNHLIQQAMDPKNLSRLFPGWKAWV 2933          
BLAST of Serine-protein kinase ATM vs. Ensembl Xenopus
Match: ATM (ATM serine/threonine kinase [Source:NCBI gene;Acc:100490767])

HSP 1 Score: 487.649 bits (1254), Expect = 7.502e-138
Identity = 286/754 (37.93%), Postives = 447/754 (59.28%), Query Frame = 3
Query: 6150 HDLFFKLYFKAVSKICA-WNQEYPVHSVSHIRTKILEPAMGVF------GKSLKQESDMLS--TMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWDELNNLS--QDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSE--NNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMNS-------RISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            +D   +L +    ++C  W  E  + S + I    LE A+ V       G+ L QE  M +  +++ FS  QY  I+ YM+SSE+EN+  +L ++K +V  +   + +   R  ++ Q E++ DE   L+  +DR+RFL  A  +   CL + + +D  IF L S+WL N +  ++N+++     +I +HKFL LM QL AR+ ++   N  F   L  LI RI +DHP H+++ +LA+ NAN+D +L K +++K  +   +           R+  A  +V+  +K+ +++++RD + L  AYI  AN+D + +K      +  P +  + ++ K   + +PT+ I +D S KY  + L  IV F   + L GG+NLPKI+ C  SDG +RRQLVK  DDLRQD+VMQQVF + N+LL  + S T K               R ++IR YKV+P++Q SG++EWC  TVP+G++L N+K GAH+RYRP+D   LQC++++        +++ +TF DI    +PV  YF  EKF +   WF+ R +Y  S+A +SIVG+I+GLGDRHVQNIL+D  +AEL+HID G+AF+ GK++PT E VPFRLTRD+V G+G  GVEG F+  C   + ++R+ ++ +LT++EVLL+DPL  W +NP  A  L  + E D +     +         D++     S N++AERV+L +  K  G  +   L+  G VN+LIQ A + +NL+R+F GW+A++
Sbjct: 2335 NDSTLRLLYAECLRLCGNWLAETCLESPTVIMQNYLEKAVEVAEYPDGAGEKL-QEGRMKAFLSLARFSDAQYQRIDNYMKSSEFENKQALLRKAKEEVGLMKQHKVQTN-RYTVKVQRELELDECAILALREDRKRFLCKAVENYISCLVSGEEHDMWIFRLCSLWLENSAVSEVNSMMRQDAQRIPSHKFLPLMYQLAARMGTKKMGNLGFHDVLNNLIGRISMDHPHHTLFIILALANANKDDQLMKPEAVKRGRLTKNAPKQISQLDEDRMEAARHIVDT-IKKQRTNMVRDVERLCDAYITLANMDANQWKSQ-RNAIPIPSDQPITKLNKLHDVVIPTMEIKVDPSGKY--ENLVTIVSFKPEFRLAGGLNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLL-QRNSETRK---------------RKLTIRRYKVVPLSQRSGVLEWCTGTVPIGEYLVNEKEGAHKRYRPRDYGSLQCQRKMMEVQRGRFEEKYQTFLDISENFRPVFRYFCMEKFLDPAMWFEKRLAYTRSVATSSIVGYIVGLGDRHVQNILIDEESAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMRNNQEALLTIVEVLLYDPLFDWTMNPLKALYLQ-QDEVDFNATLGGDDPECNRNSCDSQ-----SVNKVAERVLLRLQEKLKGVEEGMVLSVGGQVNHLIQQAMDPKNLSRLFPGWKAWV 3060          
BLAST of Serine-protein kinase ATM vs. Ensembl Mouse
Match: Atm (ataxia telangiectasia mutated [Source:MGI Symbol;Acc:MGI:107202])

HSP 1 Score: 481.1 bits (1237), Expect = 6.564e-136
Identity = 279/754 (37.00%), Postives = 442/754 (58.62%), Query Frame = 3
Query: 6144 RNHDLFFKLYFKAVSKIC-AWNQEYPVHSVSHIRTKILEPAMGVFG------KSLKQ-ESDMLSTMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWDE--LNNLSQDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSE--NNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDX--XXXXXXXXXXXXXANDKMNSRI----SVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            + +D   K+ +    ++C +W  E  + + + I    LE A+ V G      + L+  +     +++ FS  QY  I  YM+SSE+EN+  +L  +K +V  L + + +   R  ++ Q E++ DE  L  L +DR+RFL  A  +   CL + + +D  +F L S+WL N    ++N ++     KI ++KFL LM QL AR+ ++      F   L  LI RI LDHP H+++ +LA+ NAN+D      ++     I ++  K NS +    + A T +   ++  +  +++D + L  AYI  AN+D S ++    K +  P N  + ++     + VPT+ I +D + +Y  + L  I  F   + L GG+NLPKI+ C  SDG +RRQLVK  DDLRQD+VMQQVF + N+LL  + + T K               R ++I TYKV+P++Q SG++EWC  TVP+G++L N + GAH+RYRP D +  QC+K++    +++ +++ +TF  I    +PV  YF  EKF +   WF+ R +Y  S+A +SIVG+ILGLGDRHVQNIL++  +AEL+HID G+AF+ GK++PT E VPFRL+RD+V G+G  GVEG F+  C   + ++RS ++ +LT++EVLL+DPL  W +NP  A  L  + E ++D ++T N   +  E   + S    S N++AERV++ +  K  G  + + L+  G VN LIQ A + +NL+R+F GW+A++
Sbjct: 2332 KENDAGLKVIYAECLRVCGSWLAETCLENPAVIMQTYLEKAVKVAGSYDGNSRELRNGQMKAFLSLARFSDTQYQRIENYMKSSEFENKQTLLKRAKEEVGLLREHKIQTN-RYTVKVQRELELDECALRALREDRKRFLCKAVENYINCLLSGEEHDLWVFRLCSLWLENSGVSEVNGMMKKDGMKISSYKFLPLMYQLAARMGTKMTGGLGFHEVLNNLISRISLDHPHHTLFIILALANANKDEFLSKPETTRRSRITKSTSKENSHLDEDRTEAATRIIHSIRSKRCKMVKDMEALCDAYIILANMDASQWRAQ-RKGINIPANQPITKLKNLEDVVVPTMEIKVDPTGEY--ENLVTIKSFKTEFRLAGGLNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLL-QRNTETRK---------------RKLTICTYKVVPLSQRSGVLEWCTGTVPIGEYLVNSEDGAHRRYRPNDFSANQCQKKMMEVQKKSFEEKYDTFMTICQNFEPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHVQNILINEQSAELVHIDLGVAFEQGKILPTPETVPFRLSRDIVDGMGITGVEGVFRRCCEKTMEVMRSSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDESDLHSTPNADDQ--ECKQSLSDTDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWKAWV 3063          
BLAST of Serine-protein kinase ATM vs. Ensembl Mouse
Match: Atm (ataxia telangiectasia mutated [Source:MGI Symbol;Acc:MGI:107202])

HSP 1 Score: 480.715 bits (1236), Expect = 7.414e-136
Identity = 279/754 (37.00%), Postives = 442/754 (58.62%), Query Frame = 3
Query: 6144 RNHDLFFKLYFKAVSKIC-AWNQEYPVHSVSHIRTKILEPAMGVFG------KSLKQ-ESDMLSTMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWDE--LNNLSQDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSE--NNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDX--XXXXXXXXXXXXXANDKMNSRI----SVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            + +D   K+ +    ++C +W  E  + + + I    LE A+ V G      + L+  +     +++ FS  QY  I  YM+SSE+EN+  +L  +K +V  L + + +   R  ++ Q E++ DE  L  L +DR+RFL  A  +   CL + + +D  +F L S+WL N    ++N ++     KI ++KFL LM QL AR+ ++      F   L  LI RI LDHP H+++ +LA+ NAN+D      ++     I ++  K NS +    + A T +   ++  +  +++D + L  AYI  AN+D S ++    K +  P N  + ++     + VPT+ I +D + +Y  + L  I  F   + L GG+NLPKI+ C  SDG +RRQLVK  DDLRQD+VMQQVF + N+LL  + + T K               R ++I TYKV+P++Q SG++EWC  TVP+G++L N + GAH+RYRP D +  QC+K++    +++ +++ +TF  I    +PV  YF  EKF +   WF+ R +Y  S+A +SIVG+ILGLGDRHVQNIL++  +AEL+HID G+AF+ GK++PT E VPFRL+RD+V G+G  GVEG F+  C   + ++RS ++ +LT++EVLL+DPL  W +NP  A  L  + E ++D ++T N   +  E   + S    S N++AERV++ +  K  G  + + L+  G VN LIQ A + +NL+R+F GW+A++
Sbjct: 2335 KENDAGLKVIYAECLRVCGSWLAETCLENPAVIMQTYLEKAVKVAGSYDGNSRELRNGQMKAFLSLARFSDTQYQRIENYMKSSEFENKQTLLKRAKEEVGLLREHKIQTN-RYTVKVQRELELDECALRALREDRKRFLCKAVENYINCLLSGEEHDLWVFRLCSLWLENSGVSEVNGMMKKDGMKISSYKFLPLMYQLAARMGTKMTGGLGFHEVLNNLISRISLDHPHHTLFIILALANANKDEFLSKPETTRRSRITKSTSKENSHLDEDRTEAATRIIHSIRSKRCKMVKDMEALCDAYIILANMDASQWRAQ-RKGINIPANQPITKLKNLEDVVVPTMEIKVDPTGEY--ENLVTIKSFKTEFRLAGGLNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLL-QRNTETRK---------------RKLTICTYKVVPLSQRSGVLEWCTGTVPIGEYLVNSEDGAHRRYRPNDFSANQCQKKMMEVQKKSFEEKYDTFMTICQNFEPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHVQNILINEQSAELVHIDLGVAFEQGKILPTPETVPFRLSRDIVDGMGITGVEGVFRRCCEKTMEVMRSSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDESDLHSTPNADDQ--ECKQSLSDTDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWKAWV 3066          
BLAST of Serine-protein kinase ATM vs. Ensembl Mouse
Match: Atr (ataxia telangiectasia and Rad3 related [Source:MGI Symbol;Acc:MGI:108028])

HSP 1 Score: 209.534 bits (532), Expect = 2.820e-53
Identity = 154/594 (25.93%), Postives = 276/594 (46.46%), Query Frame = 3
Query: 6639 KLNNIISDVIGKIETHKFLVLMPQLCARLNSENNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMNSRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLR--IAKQVKLPVPTLSIPIDRSL---KYSLDRLP----LIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTV---PLGDWLANDK----TGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDIL-TKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSY------LNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            K+N+++++   ++  ++FL    QL +R+   +++ F + +E +I ++ L +P  +++ + A+  ++    +             ++    ++ A  M     K+S    + DA  LT   +   N  +      +     F +   L+      ++ +P+ ++ IP   S+     + D  P     + GFDDV  +   +  PK +  + SDG     + K  DDLR+D  + +  S++N       S+   A S +          R + IRTY VIP+    GIIEW  +T    P+   +  +K    TG   R         QC     +     + ++++ F+++L  +  PV   +    FP+   W+ +R +Y  S A+ S+VG+ILGLGDRH +NIL D  T E +H+DF   F+ G+     E VPFRLT ++V+G+GP G EG F+  C   L L+R Q++ ++++++  LHDPL  W   P      H+K   +                       G   N+ A+  +L++ ++  G + +        L+ EGHV+YLIQ A++   L +M+ GW  Y+
Sbjct: 2121 KINSVLTEHTNRLAPYQFLTAFSQLISRICHSHDEVFVVLME-IIAKVFLAYPQQAMWMMTAVSKSSYPMRV-------------NRCKEILTKAIHM-----KKSLEKFVGDATRLTDKLLELCNKSVDGSNSTLSMSTHFKMLKRLVEDPTFSEILIPLQSVMIPTLPSVLGAHANHDPFPGHWAYLAGFDDVVEILSSLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLMEFNSLINK------SLRKDAESRR----------RELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKIYKEKGVYMTGKELR---------QC----MLPKSAALSEKLKVFQELLLPRHPPVFHEWFLRTFPDPTSWYSSRSAYCRSTAVMSMVGYILGLGDRHGENILFDSFTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMVNGMGPMGTEGLFRRACEVTLRLMRDQREPLMSVLKTFLHDPLVEWS-KPVKG---HSKAPLNET---------------------GEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM 2641          
BLAST of Serine-protein kinase ATM vs. Ensembl Mouse
Match: Atr (ataxia telangiectasia and Rad3 related [Source:MGI Symbol;Acc:MGI:108028])

HSP 1 Score: 209.534 bits (532), Expect = 2.864e-53
Identity = 154/594 (25.93%), Postives = 276/594 (46.46%), Query Frame = 3
Query: 6639 KLNNIISDVIGKIETHKFLVLMPQLCARLNSENNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMNSRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLR--IAKQVKLPVPTLSIPIDRSL---KYSLDRLP----LIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTV---PLGDWLANDK----TGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDIL-TKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSY------LNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            K+N+++++   ++  ++FL    QL +R+   +++ F + +E +I ++ L +P  +++ + A+  ++    +             ++    ++ A  M     K+S    + DA  LT   +   N  +      +     F +   L+      ++ +P+ ++ IP   S+     + D  P     + GFDDV  +   +  PK +  + SDG     + K  DDLR+D  + +  S++N       S+   A S +          R + IRTY VIP+    GIIEW  +T    P+   +  +K    TG   R         QC     +     + ++++ F+++L  +  PV   +    FP+   W+ +R +Y  S A+ S+VG+ILGLGDRH +NIL D  T E +H+DF   F+ G+     E VPFRLT ++V+G+GP G EG F+  C   L L+R Q++ ++++++  LHDPL  W   P      H+K   +                       G   N+ A+  +L++ ++  G + +        L+ EGHV+YLIQ A++   L +M+ GW  Y+
Sbjct: 2115 KINSVLTEHTNRLAPYQFLTAFSQLISRICHSHDEVFVVLME-IIAKVFLAYPQQAMWMMTAVSKSSYPMRV-------------NRCKEILTKAIHM-----KKSLEKFVGDATRLTDKLLELCNKSVDGSNSTLSMSTHFKMLKRLVEDPTFSEILIPLQSVMIPTLPSVLGAHANHDPFPGHWAYLAGFDDVVEILSSLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLMEFNSLINK------SLRKDAESRR----------RELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKIYKEKGVYMTGKELR---------QC----MLPKSAALSEKLKVFQELLLPRHPPVFHEWFLRTFPDPTSWYSSRSAYCRSTAVMSMVGYILGLGDRHGENILFDSFTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMVNGMGPMGTEGLFRRACEVTLRLMRDQREPLMSVLKTFLHDPLVEWS-KPVKG---HSKAPLNET---------------------GEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM 2635          
BLAST of Serine-protein kinase ATM vs. Ensembl Mouse
Match: Mtor (mechanistic target of rapamycin kinase [Source:MGI Symbol;Acc:MGI:1928394])

HSP 1 Score: 154.066 bits (388), Expect = 1.855e-36
Identity = 122/411 (29.68%), Postives = 197/411 (47.93%), Query Frame = 3
Query: 7224 PKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFH--------------FEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPT-QERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKL-------------------NPQHARVLHTKREADNDCXXXXXXXXXXIEGF--DNKSRPGSSQNQMAERVILEMSRKFAGAVDSSY---LNCEGHVNYLIQTASNVENLARMFHGW 8339
            P+ +    S+G +   L+K ++DLRQD  + Q+F +VN+LL N  +   K                 +SI+ Y VIP++  SG+I W    VP  D L        + YR         +K++ ++ E  I  R+    D LT +Q V  + H              + K P S+ WF  R +Y  SLA+ S+VG+ILGLGDRH  N++LD  + +++HIDFG  F++        E++PFRLTR L + +   G++G ++TTC  V+ +LR  KD ++ ++E  ++DPL +W+L                     Q   +L      +        T  ++I  F  D   +P  + N+ A ++I  +  K  G  D S+   L+    V  LI+ A++ ENL + + GW
Sbjct: 2169 PRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKN----------------LSIQRYAVIPLSTNSGLIGW----VPHCDTLH----ALIRDYRE--------KKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRTTCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVELGEPAHKKAGTTVPESIHSFIGDGLVKP-EALNKKAIQIINRVRDKLTGR-DFSHDDTLDVPTQVELLIKQATSHENLCQCYIGW 2545          
BLAST of Serine-protein kinase ATM vs. UniProt/SwissProt
Match: sp|Q6PQD5|ATM_PIG (Serine-protein kinase ATM OS=Sus scrofa OX=9823 GN=ATM PE=3 SV=2)

HSP 1 Score: 486.493 bits (1251), Expect = 9.063e-137
Identity = 324/991 (32.69%), Postives = 537/991 (54.19%), Query Frame = 3
Query: 5517 EAKIDILWKLTRWGDEEKLEINNLSQENVCSLAMYDFLYS-RSEHVSEFYRN-------HVVDSCKISWDQEACFRPLIERATLFGNETSLPTILESLIRIANKSNIDQLDSSIV---WA---LIRSNRFARNLEIVNQQLLGISDLAKRCKRHEYIDFIRDMLNLHEVDNSILKCSGESSLFRTIDIFSQKT-ETEETKKSFLQLE--QFIYDSQKHILTC----QQIKR------NHDLFFKLYFKAVSKICA-WNQEYPVHSVSHIRTKILEPAMGVFGKSLKQESDMLS--------TMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWDE--LNNLSQDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSE--NNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXAND------KMNSRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            E    + W+  +W  +  + +N   +      ++Y+ L S R    S FY +        V + CK S +      P + R    G        LE++  + ++S  D+  S +    W    L++ + F+    I+  + + +  L ++   +   + ++D+L  H V+ S+L  + +++      IF  K   +     S  QLE  Q  +  ++  L      Q IK+       +D   KL      ++C  W  E  + + + I    LE A+ + G    + +D L         +++ FS  QY  I  YM+SSE+EN+  +L  +K +V  L + + +   R  ++ Q E++ DE  L  L +DR+RFL  A  +   CL + +G+D  IF L S+WL N    ++N ++     KI ++KFL LM QL AR+ ++      F   L  LI RI +DHP H+++ +LA+ NAN+D  L K ++ +S +   +      +++   + A   V   ++  +  ++R  + L  AYI  AN+D + ++    K ++ P +  + ++     + VPT+ I +D + +Y    +  I  F   + L GG+NLPKI+ C  SDG +RRQLVK  DDLRQD+VMQQVF + N+LL  + + T K               R ++I TYKV+P++Q SG++EWC  TVP+G++L N+ TGAH+RYRP+D +P+QC+K++  +  ++ +++ E F +I    QPV  YF  EKF +   WF+ R +Y  S+A +SIVG+ILGLGDRHVQNIL++  +AEL+HID G+AF+ GK++PT E VPFRLTRD+V G+G  GVEG F+  C   + ++R+ ++ +LT++EVLL+DPL  W +NP  A  L  + E +++ ++T     +  E   N S    S N++AERV++ +  K  G  + + L+  G VN+LIQ A + +NL+++F GW+A++
Sbjct: 2098 ELHYQVAWRNMQW--DSCVSVNKGMEGTSYHESLYNALQSLRDREFSTFYESLKYARVKEVEELCKGSLESVYSLYPTLSRLQAIGE-------LENIGELFSRSVTDRQPSEVYNKWWKHSQLLKDSDFSFQEPIMALRTVILEILMEKEMENSQRECLKDILTKHLVELSLLARTFQNTQLPERAIFQIKQYNSANCGVSEWQLEEAQVFWAKKEQSLALSILKQMIKKLDASCTENDPRLKLIHIECLRVCGTWLAETCLENPAVIMQTYLEKAVELAGNYDGESNDELRNGKMKAFLSLARFSDTQYQRIENYMKSSEFENKQALLKRAKEEVGLLREHKIQTN-RYTIKVQRELELDEGALRALKKDRKRFLCKAVENYINCLLSGEGHDMWIFRLCSLWLENSGVSEVNGMMKRDGMKIPSYKFLPLMYQLAARMGTKMMGGLGFHDVLNSLISRISVDHPHHTLFIILALANANKDEFLTKPEAARSSRITKNTPKESSQLDEDRTEAANKVICTLRNRRRQMVRSVEALCDAYIILANLDATQWRTQ-RKGIRIPADQPITKLKNLEDVVVPTMEIKVDPTGEYG--NMVTIQSFKPEFRLAGGLNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLL-QRNTETRK---------------RKLTICTYKVVPLSQRSGVLEWCTGTVPIGEYLVNNDTGAHKRYRPKDFSPVQCQKKMMEAQNKSFEEKYEIFMNICQNFQPVFRYFCMEKFLDPAVWFERRLAYTQSVATSSIVGYILGLGDRHVQNILINEQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMRNSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDESELHSTPRADDQ--ECKRNLSDTDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNFLIQQAMDPKNLSKLFSGWKAWV 3057          
BLAST of Serine-protein kinase ATM vs. UniProt/SwissProt
Match: sp|Q13315|ATM_HUMAN (Serine-protein kinase ATM OS=Homo sapiens OX=9606 GN=ATM PE=1 SV=4)

HSP 1 Score: 483.026 bits (1242), Expect = 1.158e-135
Identity = 323/954 (33.86%), Postives = 523/954 (54.82%), Query Frame = 3
Query: 5613 AMYDFLYS-RSEHVSEFYRNHVVDSCKISWDQEACFRPLIERATLFGNETSLPTI--LESLIRIANKSNIDQLDSS--IVWA----LIRSNRFARNLEIVNQQLLGISDLAKRCKRHEYIDFIRDMLNLHEVDNSILKCSGESSLFRTIDIFSQKT-ETEETKKSFLQLE--QFIYDSQKHILTC----QQIKR------NHDLFFKLYFKAVSKICA-WNQEYPVHSVSHIRTKILEPAMGVFGKSLKQESDMLS--------TMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWDEL--NNLSQDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSE--NNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXAND--KMNSRI----SVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            ++Y+ L S R    S FY +  +   ++   +E C R L    +L+   + L  I  LES+  + ++S   +  S   I W     L++ + F+    I+  + + +  L ++   +   + I+D+L  H V+ SIL  + +++      IF  K   +     S  QLE  Q  +  ++  L      Q IK+       ++   KL +    ++C  W  E  + + + I    LE A+ V G    + SD L         +++ FS  QY  I  YM+SSE+EN+  +L  +K +V  L + + +   R  ++ Q E++ DEL    L +DR+RFL  A  +   CL + + +D  +F L S+WL N    ++N ++     KI T+KFL LM QL AR+ ++      F   L  LI RI +DHP H+++ +LA+ NANRD  L K +  +  +   +  K +S++    + A   +   ++  +  ++R  + L  AYI  AN+D + +K    K +  P +  + ++     + VPT+ I +D + +Y    L  I  F   + L GG+NLPKI+ C  SDG +RRQLVK  DDLRQD+VMQQVF + N+LL  + + T K               R ++I TYKV+P++Q SG++EWC  TVP+G++L N++ GAH+RYRP D +  QC+K++    +++ +++ E F D+    QPV  YF  EKF +   WF+ R +Y  S+A +SIVG+ILGLGDRHVQNIL++  +AEL+HID G+AF+ GK++PT E VPFRLTRD+V G+G  GVEG F+  C   + ++R+ ++ +LT++EVLL+DPL  W +NP  A  L+ ++  +++       ++   E   N S    S N++AERV++ +  K  G  + + L+  G VN LIQ A + +NL+R+F GW+A++
Sbjct: 2127 SLYNALQSLRDREFSTFYES--LKYARVKEVEEMCKRSLESVYSLYPTLSRLQAIGELESIGELFSRSVTHRQLSEVYIKWQKHSQLLKDSDFSFQEPIMALRTVILEILMEKEMDNSQRECIKDILTKHLVELSILARTFKNTQLPERAIFQIKQYNSVSCGVSEWQLEEAQVFWAKKEQSLALSILKQMIKKLDASCAANNPSLKLTYTECLRVCGNWLAETCLENPAVIMQTYLEKAVEVAGNYDGESSDELRNGKMKAFLSLARFSDTQYQRIENYMKSSEFENKQALLKRAKEEVGLLREHKIQTN-RYTVKVQRELELDELALRALKEDRKRFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENSGVSEVNGMMKRDGMKIPTYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANRDEFLTKPEVARRSRITKNVPKQSSQLDEDRTEAANRIICTIRSRRPQMVRSVEALCDAYIILANLDATQWKTQ-RKGINIPADQPITKLKNLEDVVVPTMEIKVDHTGEYG--NLVTIQSFKAEFRLAGGVNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLL-QRNTETRK---------------RKLTICTYKVVPLSQRSGVLEWCTGTVPIGEFLVNNEDGAHKRYRPNDFSAFQCQKKMMEVQKKSFEEKYEVFMDVCQNFQPVFRYFCMEKFLDPAIWFEKRLAYTRSVATSSIVGYILGLGDRHVQNILINEQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMRNSQETLLTIVEVLLYDPLFDWTMNPLKA--LYLQQRPEDETELHPTLNADDQECKRNLSDIDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAIDPKNLSRLFPGWKAWV 3056          
BLAST of Serine-protein kinase ATM vs. UniProt/SwissProt
Match: sp|Q62388|ATM_MOUSE (Serine-protein kinase ATM OS=Mus musculus OX=10090 GN=Atm PE=1 SV=2)

HSP 1 Score: 480.715 bits (1236), Expect = 5.186e-135
Identity = 279/754 (37.00%), Postives = 442/754 (58.62%), Query Frame = 3
Query: 6144 RNHDLFFKLYFKAVSKIC-AWNQEYPVHSVSHIRTKILEPAMGVFG------KSLKQ-ESDMLSTMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWDE--LNNLSQDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSE--NNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDX--XXXXXXXXXXXXXANDKMNSRI----SVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            + +D   K+ +    ++C +W  E  + + + I    LE A+ V G      + L+  +     +++ FS  QY  I  YM+SSE+EN+  +L  +K +V  L + + +   R  ++ Q E++ DE  L  L +DR+RFL  A  +   CL + + +D  +F L S+WL N    ++N ++     KI ++KFL LM QL AR+ ++      F   L  LI RI LDHP H+++ +LA+ NAN+D      ++     I ++  K NS +    + A T +   ++  +  +++D + L  AYI  AN+D S ++    K +  P N  + ++     + VPT+ I +D + +Y  + L  I  F   + L GG+NLPKI+ C  SDG +RRQLVK  DDLRQD+VMQQVF + N+LL  + + T K               R ++I TYKV+P++Q SG++EWC  TVP+G++L N + GAH+RYRP D +  QC+K++    +++ +++ +TF  I    +PV  YF  EKF +   WF+ R +Y  S+A +SIVG+ILGLGDRHVQNIL++  +AEL+HID G+AF+ GK++PT E VPFRL+RD+V G+G  GVEG F+  C   + ++RS ++ +LT++EVLL+DPL  W +NP  A  L  + E ++D ++T N   +  E   + S    S N++AERV++ +  K  G  + + L+  G VN LIQ A + +NL+R+F GW+A++
Sbjct: 2335 KENDAGLKVIYAECLRVCGSWLAETCLENPAVIMQTYLEKAVKVAGSYDGNSRELRNGQMKAFLSLARFSDTQYQRIENYMKSSEFENKQTLLKRAKEEVGLLREHKIQTN-RYTVKVQRELELDECALRALREDRKRFLCKAVENYINCLLSGEEHDLWVFRLCSLWLENSGVSEVNGMMKKDGMKISSYKFLPLMYQLAARMGTKMTGGLGFHEVLNNLISRISLDHPHHTLFIILALANANKDEFLSKPETTRRSRITKSTSKENSHLDEDRTEAATRIIHSIRSKRCKMVKDMEALCDAYIILANMDASQWRAQ-RKGINIPANQPITKLKNLEDVVVPTMEIKVDPTGEY--ENLVTIKSFKTEFRLAGGLNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLL-QRNTETRK---------------RKLTICTYKVVPLSQRSGVLEWCTGTVPIGEYLVNSEDGAHRRYRPNDFSANQCQKKMMEVQKKSFEEKYDTFMTICQNFEPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHVQNILINEQSAELVHIDLGVAFEQGKILPTPETVPFRLSRDIVDGMGITGVEGVFRRCCEKTMEVMRSSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDESDLHSTPNADDQ--ECKQSLSDTDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWKAWV 3066          
BLAST of Serine-protein kinase ATM vs. UniProt/SwissProt
Match: sp|Q9M3G7|ATM_ARATH (Serine/threonine-protein kinase ATM OS=Arabidopsis thaliana OX=3702 GN=ATM PE=1 SV=1)

HSP 1 Score: 385.956 bits (990), Expect = 6.664e-106
Identity = 226/646 (34.98%), Postives = 352/646 (54.49%), Query Frame = 3
Query: 6465 LEKQSEVDWDELNNLSQDRERFLLSAAISCSECLQNEDGNDFKI-FHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSENNKS----FEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMNSRISVAYTMVEQLVKES--------QSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKL-PVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKS-NDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWL--ANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            L+KQ  +D +E   L  DR+ FL  A      CL+  D  D ++ F  +SMW S  S + + + +   I +++++KF+ L+ Q+ +RL S  ++S    F+  L  LI+++ +DHP+H+I  LLA+ N +R                 D   SR S    M ++L  E            +IR    L   YI  A ++    ++D ++K+  P     +R  KQ++L PV T +IP+DRS +Y+    P   G  D  ++  GIN PK+V C  SDG K +QL KS NDDLRQD+VM+Q F +VN+ L N                    + R +++RTYKVIP T ++G++EW + T+PLGD+L  ++   GAH RY   +    +CR+ +      + K + + F D+ T  +PV+ YF  EKF +   WF  R +Y  S+A +S+VG+I+GLGDRH  NIL+D  TAE++HID G+AF+ G ++ T ERVPFRLTRD++ G+G  GVEG F+  C + L+++R+ K+ +LT++EV +HDPL+ W L+P  A  L  ++E ++          +  EG           N+ A R ++ + +K  G       +  G    LIQ A + + L+ MF GW A++
Sbjct: 3265 LQKQLTMDKEEAEKLQVDRDNFLKLALEGYKRCLEIGDKYDVRVVFRQVSMWFSLASQKNVIDNMLSTIKEVQSYKFIPLVYQIASRLGSSKDESGSNSFQSALVSLIRKMAIDHPYHTILQLLALANGDR---------------IKDNQRSRNSFVVDMDKKLAAEHLLQDVSHYHGPMIRQMKQLVDIYIKLAELETR--REDTNRKVALPRE---IRSVKQLELVPVVTATIPVDRSCQYNEGSFPFFRGLSDSVTVMNGINAPKVVECFGSDGQKYKQLAKSGNDDLRQDAVMEQFFGLVNTFLHNNRDT----------------WKRRLAVRTYKVIPFTPSAGVLEWVDGTIPLGDYLIGSSRSEGAHGRYGIGNWKYPKCREHMS-----SAKDKRKAFVDVCTNFRPVMHYFFLEKFLQPADWFVKRLAYTRSVAASSMVGYIVGLGDRHAMNILIDQATAEVVHIDLGVAFEQGLMLKTPERVPFRLTRDIIDGMGITGVEGVFRRCCEETLSVMRTNKEALLTIVEVFIHDPLYKWALSPLKA--LQRQKETEDYDGMNLEGLQEEFEG-----------NKDATRALMRVKQKLDGYEGGEMRSIHGQAQQLIQDAIDTDRLSHMFPGWGAWM 3856          
BLAST of Serine-protein kinase ATM vs. UniProt/SwissProt
Match: sp|Q5EAK6|ATM_DROME (Serine/threonine-protein kinase ATM OS=Drosophila melanogaster OX=7227 GN=tefu PE=2 SV=1)

HSP 1 Score: 337.421 bits (864), Expect = 3.249e-91
Identity = 226/699 (32.33%), Postives = 348/699 (49.79%), Query Frame = 3
Query: 6288 KQESDMLSTMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKI---LEKQSEVDWDELNNLSQDRERFL-LSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSENNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMNSRISVAYTMVEQLVKE--SQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLA-NDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKF----AGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            KQ +   +T++ ++ ++Y  ++ Y  S EY+  +K + E  R  +  V  R     R I   +++ + +D  +LN + +    +L L+     + C  +   +   I+ ++S+W +N ++++    I D I  + ++KF+    QL ARLNS+N  S    L  L+ +   DHP+H+ Y L  +  A+ D                +    R  +A  ++  + ++  +  +  +  + L  A I +AN   +   + +   ++      + R      +  PTL +P+  S +YS+     +V + +  +  GG+N P  + C  SDG  R QLVK  DDLRQD+VMQQVF +VN LL                  S FI  R + +RTYKV P++  SGI+EWC ++VP+G +L    K GAH RYRP D    +CRK      +   + R   +K I   I+PV  YF  EKFP    WF+ R +Y NS+A  S+VG++LGLGDRH QNIL+D  TAE+IHIDFGIAF+ GK+  T E VPFRLTRD V  +G  G +G F  +C   +++LR  K +  T++EVLL+DPL  W        VL  K+                      +     S N +A+R +L +  K     AG +  S  N E  V  LI  A+   NL  +F GW  +L
Sbjct: 2133 KQRTAAYATIAKYADREYQQLHDYRHSQEYQT-LKDIIEQNRQTAEKVTQRENQDRRVISVQMKRYASLDEQQLNQIEEKLTEYLRLALTNYMAYCRLDSGFSSAAIYRIISLWFTNATSKQCQECIKDEILTVPSYKFICAANQLTARLNSKNT-SLLKGLTDLLVQCGKDHPYHTFYQLYPLVFAHLD--------------GENSNTERSGIARKIIAMICEKNGTAGECSKQLESLLPALITFANEGKTNDNRPVSDSVRNKQFDKVRRWRNLNAVHCPTLELPVMPSKEYSIIS---VVKWTNETTQCGGLNAPVKIMCVCSDGKIRAQLVKGKDDLRQDAVMQQVFGIVNELLNQD---------------SEFI-ERKLKLRTYKVTPLSMRSGILEWCTNSVPVGHYLVVEGKGGAHARYRPNDWNNNKCRKLSSDHLKSPKETRYAIYKKICENIKPVFHYFLLEKFPIPGVWFERRLAYTNSVATTSMVGYVLGLGDRHTQNILVDQQTAEVIHIDFGIAFEQGKIQTTPETVPFRLTRDFVAPMGICGTKGVFAKSCEATMHILRRYKSVFTTILEVLLYDPLFIWG-------VLKKKQSP--------------------QQSGEESVNLVAQRALLLVQNKLDGREAGTMGDS--NVEAQVERLINEATLPSNLCMLFPGWDPHL 2767          
BLAST of Serine-protein kinase ATM vs. TrEMBL
Match: M1EFK0 (Ataxia telangiectasia mutated (Fragment) OS=Mustela putorius furo OX=9669 PE=2 SV=1)

HSP 1 Score: 481.485 bits (1238), Expect = 1.992e-144
Identity = 280/755 (37.09%), Postives = 440/755 (58.28%), Query Frame = 3
Query: 6150 HDLFFKLYFKAVSKICA-WNQEYPVHSVSHIRTKILEPAMGVFGKSLKQESDMLS--------TMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWDE--LNNLSQDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSE--NNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXX------XXXXXANDKMNSRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEG---RFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAY 8348
            +D   +L +    ++C  W  E  + + + I    LE A+ V      + SD L         +++ FS  QY  I  YM+SSE+EN+  +L  +K +V  L + + +   R  ++ Q E++ DE  L  L +DR+RFL  A  +   CL + +G+D  IF L S+WL N     +N ++     KI ++KFL LM QL AR+ ++      F   L  LI RI +DHP H+++ +LA+ NAN+D  L K ++       K+  + +  ++   + A   +   ++  +  ++R  + L  AYI  AN+D + +K    K +  P +  + ++     + VPT+ I +D + +Y    L  I  F   + L GG+NLPKI+ C  SDG +RRQLVK  DDLRQD+VMQQVF + N+LL  + + T K               R ++I TYKV+P++Q SG++EWC  TVP+G++L N++ GAH+RYRP+D + + C+K++    +++ +++ +TF D+  K QPV  YF  EKF +   WF+ R +Y  S+A +SIVG+ILGLGDRHVQNIL++  +AEL+HID G+AF+ GK++PT E VPFRLTRD+V G+G  GVEG   RF+  C   + ++RS ++ +LT++EVLL+DPL  W +NP  A  L+ ++  ++D    S  + +  E   N S    S N++AERV++ +  K  G  + + L+  G VN LIQ A + +NL+R+F GW+A+
Sbjct:   27 NDPDLRLIYAECLRVCGTWLAETCLENPAVIMQTYLEKAVEVARNYDGESSDELRNGKMKAFLSLARFSDTQYQRIENYMKSSEFENKQALLKRAKEEVGLLREHKIQTN-RYTVKVQRELELDECALRALKEDRKRFLCKAVENYISCLLSGEGHDMWIFRLCSLWLENSGVSDVNGMMKTDGMKIPSYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANKDEFLTKPEAARRNRIIKNAPKQSSPLDEDRTEAANRIIHTIRSRRPQMVRSVEALCDAYIILANLDAAQWKTQ-RKGINIPADQPITKLKNLEDVVVPTMEIKVDPTGEYR--NLVTIESFKAEFRLAGGLNLPKIIDCLGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLL-QRNTETRK---------------RKLTICTYKVVPLSQRSGVLEWCTGTVPIGEFLVNNENGAHKRYRPKDLSAIHCQKKMMDVQKKSFEEKYKTFMDVCQKFQPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHVQNILINEQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRFRRCCEKTMEVMRSSQETLLTIVEVLLYDPLFDWTMNPLKA--LYLQQRPEDDTELQSTPAGEDQECKRNLSDTDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWKAW 759          
BLAST of Serine-protein kinase ATM vs. TrEMBL
Match: Q6NX74 (Atm protein (Fragment) OS=Mus musculus OX=10090 GN=Atm PE=2 SV=1)

HSP 1 Score: 481.485 bits (1238), Expect = 4.589e-144
Identity = 279/754 (37.00%), Postives = 442/754 (58.62%), Query Frame = 3
Query: 6144 RNHDLFFKLYFKAVSKIC-AWNQEYPVHSVSHIRTKILEPAMGVFG------KSLKQ-ESDMLSTMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWDE--LNNLSQDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSE--NNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDX--XXXXXXXXXXXXXANDKMNSRI----SVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            + +D   K+ +    ++C +W  E  + + + I    LE A+ V G      + L+  +     +++ FS  QY  I  YM+SSE+EN+  +L  +K +V  L + + +   R  ++ Q E++ DE  L  L +DR+RFL  A  +   CL + + +D  +F L S+WL N    ++N ++     KI ++KFL LM QL AR+ ++      F   L  LI RI LDHP H+++ +LA+ NAN+D      ++     I ++  K NS +    + A T +   ++  +  +++D + L  AYI  AN+D S ++    K +  P N  + ++     + VPT+ I +D + +Y  + L  I  F   + L GG+NLPKI+ C  SDG +RRQLVK  DDLRQD+VMQQVF + N+LL  + + T K               R ++I TYKV+P++Q SG++EWC  TVP+G++L N + GAH+RYRP D +  QC+K++    +++ +++ +TF  I    +PV  YF  EKF +   WF+ R +Y  S+A +SIVG+ILGLGDRHVQNIL++  +AEL+HID G+AF+ GK++PT E VPFRL+RD+V G+G  GVEG F+  C   + ++RS ++ +LT++EVLL+DPL  W +NP  A  L  + E ++D ++T N   +  E   + S    S N++AERV++ +  K  G  + + L+  G VN LIQ A + +NL+R+F GW+A++
Sbjct:   59 KENDAGLKVIYAECLRVCGSWLAETCLENPAVIMQTYLEKAVKVAGSYDGNSRELRNGQMKAFLSLARFSDTQYQRIENYMKSSEFENKQTLLKRAKEEVGLLREHKIQTN-RYTVKVQRELELDECALRALREDRKRFLCKAVENYINCLLSGEEHDLWVFRLCSLWLENSGVSEVNGMMKKDGMKISSYKFLPLMYQLAARMGTKMTGGLGFHEVLNNLISRISLDHPHHTLFIILALANANKDEFLSKPETTRRSRITKSTSKENSHLDEDRTEAATRIIHSIRSKRCKMVKDMEALCDAYIILANMDASQWRAQ-RKGINIPANQPITKLKNLEDVVVPTMEIKVDPTGEY--ENLVTIKSFKTEFRLAGGLNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLL-QRNTETRK---------------RKLTICTYKVVPLSQRSGVLEWCTGTVPIGEYLVNSEDGAHRRYRPNDFSANQCQKKMMEVQKKSFEEKYDTFMTICQNFEPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHVQNILINEQSAELVHIDLGVAFEQGKILPTPETVPFRLSRDIVDGMGITGVEGVFRRCCEKTMEVMRSSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDESDLHSTPNADDQ--ECKQSLSDTDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWKAWV 790          
BLAST of Serine-protein kinase ATM vs. TrEMBL
Match: S4RPL8 (Uncharacterized protein OS=Petromyzon marinus OX=7757 PE=3 SV=1)

HSP 1 Score: 489.574 bits (1259), Expect = 3.193e-143
Identity = 278/769 (36.15%), Postives = 443/769 (57.61%), Query Frame = 3
Query: 6159 FFKLYFKAVSKICAWNQEYPVHSVSHIRTKILEPAMGVFGKSLKQ--------------ESDMLSTMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWDE--LNNLSQDRERFLLSAAISCSECLQNEDGN-DFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSE--NNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXA-----NDKMNS-------RISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRI-ETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFD---NKSRPG---SSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
               LY + + +   W  E    S S I ++ LE ++ V  ++                  + +  +++ F+  Q+  I  YMRS+EYEN+  +L ++K DV+ L  L+ + P R +++ Q E D DE  L +L QDRERFL+ A ++   CL++   + + + F L+S+WL N + +++N+++   +  I  HKFL L+ QL AR+ ++    ++F   L+KLI R+ L HP H++  +LA+ NA +D  L+   +    +        D   S       R+     +VEQ V++ Q +++RD + L  AYI  AN++  A+++   K +  P +  +  I    K+ +PTL + +D + +Y    L  +  F   + L GG+NLPKI+ C+ SDG   RQLVK  DDLRQD+VMQQVF + N LL                  SA    R +SIRTYKV+P++Q SG++EWC  T+P+GD+L    TGAH +YRP D   + CRK + ++A++     +   ++++    +PV  +F +E+F +   WF+ R SY  S+A +SIVG+I+GLGDRHVQNIL+D+N+AEL+HID G+AF+ G+++PT E VPFRLTRD+V G+G  GVEG F+  C   + ++R+ ++ +LT++EVLL DPL  W +NP  A  L T+ E + +  +T   +           ++ R G    S N+MAERV++ + +K  G  + S L+  G VN LIQ A++ +NL+R+F GWQ ++
Sbjct:  355 LLALYAECLGRYGHWLAETCSESPSIILSEYLEKSVSVAERAWGDGSGGSDEGEGGRVCRAALYLSLARFADAQHRSIVAYMRSAEYENKRALLRKAKEDVTLLQSLKLQ-PSRYMVKLQRECDLDERELLSLRQDRERFLVEALVNYVRCLRSGGAHGEARAFRLVSLWLENSAEQQVNDVMRTGVTDIPPHKFLPLIYQLAARMGTKMAGGEAFHSILQKLILRVTLTHPHHALLVVLALANAGKDELLQTVAARDGARGGSRLSRGDSKGSSAPSDDDRVRATRALVEQ-VRKQQPELVRDTEKLCDAYIMLANMNAEAWRKQT-KDMLIPKDQPIKEIRNLYKVVIPTLELKVDPTGQYP--DLVTVRAFRPHFRLAGGVNLPKIIDCEGSDGRTYRQLVKGRDDLRQDAVMQQVFHMCNELLAG----------------SAETRTRKLSIRTYKVVPLSQRSGVLEWCVGTMPIGDYLVQKDTGAHTKYRPNDWPSMHCRKFMNVAAQDRRNGDLFLAYQELCHHFRPVFRHFFWERFLDPAVWFERRLSYTRSVATSSIVGYIVGLGDRHVQNILIDLNSAELVHIDLGVAFEQGRILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMRNSQEALLTIVEVLLFDPLFDWTMNPLKALTLQTRTEDETEGTSTMGPTLGKAPASGRAVHQERNGMDPQSLNKMAERVLMRLQQKLKGVEEGSVLSVPGQVNLLIQQATDPKNLSRLFPGWQPWV 1102          
BLAST of Serine-protein kinase ATM vs. TrEMBL
Match: A0A2Y9RMH1 (serine-protein kinase ATM-like OS=Trichechus manatus latirostris OX=127582 GN=LOC111821652 PE=3 SV=1)

HSP 1 Score: 474.167 bits (1219), Expect = 1.061e-142
Identity = 266/690 (38.55%), Postives = 418/690 (60.58%), Query Frame = 3
Query: 6312 TMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWDE--LNNLSQDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSE--NNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXAND--KMNSRI----SVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            +++ FS  QY  I  YM+SSE+EN+  +L  +K +V  L + + +   R  ++ Q E++ DE  L  L +DR+RFL  A  +   CL + + +D  +F L S+WL N S  ++N ++  V  KI ++KFL LM QL AR+ ++      F   L  LI RI +DHP H+++ +LA+ NAN+D  L K ++ +  +   +  K +S++    + A   +   +K  +  ++R+ + L  AYI  AN+D S +K    K +  P +  + ++     + VPT+ I +D + +Y    L  I  F   + L GG+NLPKI+ C  SDG +RRQLVK  DDLRQD+VMQQVF + N+LL  + + T K               R ++I TYKV+P++Q SG++EWC  TVP+G++L N++ GAH+RYRP+D +  QC+K++    +++ +++   F DI    QPV  YF  EKF +   WF+ R +Y  S+A +SIVG+ILGLGDRHVQNIL++  +AEL+HID G+AF+ GK++PT E VPFRLTRD+V G+G  GVEG F+  C   + ++R+ ++ +LT++EVLL+DPL  W +NP  A  L+ ++  +++    S  ++   E   N S    S N++AERV++ +  K  G  + + L+  G VN LIQ A + +NL+ +F GW+A++
Sbjct:   33 SLARFSDTQYQRIENYMKSSEFENKQALLKRAKEEVGLLKEHKIQTT-RYTVKVQRELELDECALQALKEDRKRFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENASISEVNGMMKRVGMKIPSYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISVDHPHHTLFIILALANANKDEFLTKPEAARRNRITKNAPKQSSQLDEDRTEAANKIICTIKSRRPQMVRNVEALCDAYILLANLDASQWKTQ-RKGINIPADQPITKLKNLEDVVVPTMEIKVDPTGEYG--NLVTIQSFKAEFRLAGGLNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLL-QRNTETRK---------------RKLTICTYKVVPLSQRSGVLEWCTGTVPIGEFLVNNEDGAHKRYRPKDFSAYQCQKKMMEVQKKSFEEKYAAFMDICQNFQPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHVQNILINEQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMRNSQETLLTIVEVLLYDPLFDWTMNPLKA--LYLQQRPEDETELNSTLNADDQECKRNVSDIDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSWLFPGWKAWV 700          
BLAST of Serine-protein kinase ATM vs. TrEMBL
Match: A0A5K4FBY7 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 510.76 bits (1314), Expect = 3.066e-142
Identity = 297/828 (35.87%), Postives = 454/828 (54.83%), Query Frame = 3
Query: 6153 DLFFKLYFKAVSKICAWNQEYPVHSVSHIRTKILEPAMGVFGK-SLKQESDMLSTMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWDELNNLSQDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNE------KLNNIISDVIGKIETHKFLVLMPQLCARLNS--ENNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNA---------------NRDXXXXXXXXXXXXXXANDKMNSRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLR-IAKQVK-------------LPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKG---------SITYKANSIK-SSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSR-----------------PGSSQ-------------NQMAERVILEMSRKFAGAVDSSYL--------NCE---------GHVNYLIQTASNVENLARMFHGWQAYL 8351
            D +   Y   ++ +C W  E    S + +    + PA+ +  +  L  +++    ++ FS  Q+T +N Y+ SSE+  R   LT++++DV  L DL  K  L ++L++QS ++ DEL  L+ D + FL ++  + ++CL   D ++  IF  +S+WLS+ +++      K+N I+S+ +  I   KFL L+PQL  RL+S  + + SF+  L KLI+R++  HP HS + LL + NA               +      K+ +     +++ +++ RI  A  +  +L    + +++     L  AY+ WAN D+  +K +    +  P +C L   ++  +K             + +PT + PIDRS  Y    L  + GF   + L GGINLPK++ C  +DG   RQLVK  DD RQD+VMQQVF   N LL   G         S T + N +K  ++W     +  I IRTYKVIPM Q SG+IEWCEDTVPLGDWLAN++TGAHQRYRP+D  P+Q ++RL +  ++   +++  F +I  K++PVL YF  E+FP  + WF +R +Y  S+A+ S+VG+++GLGDRH  N+LL  +T E+IHID G+AFD G+L+PT E VPFRLTRDLVH LGP G++  F      VL  LR+  D+ILTL++VLL DPL+SW L+P     L  KR   N  + + ++S    + + N ++                 P + Q             NQ+AERV+L +  K  G V  + +        NC          GH+  L++ A++  NL+RM+ GWQAYL
Sbjct: 1640 DGYINCYIHGITVLCNWLYESRTKSAADLLLNYINPAINLAQRLKLNPDANAFMCLAKFSDAQFTTLNSYLTSSEFATRQNFLTQAQKDVIVLSDLGEKSRLLRLLQRQSALEIDELTALTTDADHFLEASIDAYAQCLSLSDDHNLSIFRFISLWLSSINSKFPNRASKMNKIMSERLPSIRADKFLPLVPQLAVRLSSKCDADSSFQNILMKLIERMVDWHPHHSAFTLLFLVNAKLDDDNNDNDGSRQRSTRVNSLKASTETIPNQSSTELSCRIQAAQQLYNRLSIGRRKELLYQMKYLAEAYVDWANTDVDKYKTNA-GNISLPNSCKLYGLVSPSLKRSSSRTMDCLLELVALPTCTFPIDRSGTYPNSSLIRVGGFSPDFRLVGGINLPKVIGCLGTDGKLYRQLVKGKDDPRQDAVMQQVFIAANCLLTKYGKSNKIDLPHSSTSQVNILKYRANW--LDMDNGIRIRTYKVIPMAQRSGVIEWCEDTVPLGDWLANERTGAHQRYRPRDMPPIQAKQRLGVVKDKTPDRKLVAFNEICEKLKPVLAYFFLEQFPNPKNWFVSRMAYIRSIAVTSVVGYLVGLGDRHPHNLLLHKSTGEIIHIDLGVAFDQGRLLPTPEMVPFRLTRDLVHALGPLGLQTGFIPAAETVLRELRNGSDVILTLLQVLLFDPLYSWSLSPAQLYALEAKRAEINTLDKSKSSSHFFNDHYRNTNKENFKMNTLQPNENSLIFPSNQQLYNTNMISENEPVNQLAERVLLGVKGKLQGLVSGNLVVNSNETSSNCSGGLDQLDVAGHIGLLVRAATDYSNLSRMYFGWQAYL 2464          
BLAST of Serine-protein kinase ATM vs. Ensembl Cavefish
Match: atm (ATM serine/threonine kinase [Source:ZFIN;Acc:ZDB-GENE-040809-1])

HSP 1 Score: 483.411 bits (1243), Expect = 9.010e-137
Identity = 280/741 (37.79%), Postives = 433/741 (58.43%), Query Frame = 3
Query: 6189 KIC-AWNQEYPVHSVSHIRTKILEPAMGVF-----GKSLKQESDMLS---TMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWD--ELNNLSQDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCAR-------LNSENNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMN-SRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEG-FDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            ++C +W  E  + S + I    LE A+  F         KQ+S M     +++ FS  QY  I  YMRSSE+EN+  +L ++K +V  L+  R     R  ++ Q E++ D   L NL  DR RFLL A  +   CL+  + +D  IF L S+WL N   + +N+++ + + KI ++KFL LM QL AR       L ++    F   L +LI R  +DHP H+++ +LA+ NAN+D    +S+  ++       ++  R  VA  ++  ++++ ++ +I+  + L +AYI  A +D S  K +  K +  P +  +++I     + +PT+ I +D S KY  + L  I  F   + L GG+NLPKI+ C  SDG  RRQLVK  DDLRQD+VMQQVF + ++LL                  +A    R ++IR YKV+P +Q SG++EWC  TVP+G++L + + GAH+R+RPQD T L CRK++  +      K+++ F ++    +PV  YF  E+F +   W + R +Y  S+A +SIVG+I+GLGDRH+QNIL+D  TAEL+HID G+AF+ GK++PT E VPFRL+RD+V G+G  GVEG F+  C   + ++RS ++++LT++EVLL+DPL  W +NP  A  L  +++   + N T N +    E     KS    S N++AERV+L +  K  G  + + L+  G VN LIQ A + +NL+R+F GWQA++
Sbjct: 2337 RLCGSWLSETCLESPAVILESYLERAVEAFEDHGGAPDPKQQSQMTQAFLSLARFSDAQYQGIENYMRSSEFENKQALLEKAKEEVD-LMKERNVTNNRYTVKVQRELELDVRALANLRADRRRFLLKAVENYIRCLELGEEHDTWIFRLASLWLENADVKNVNDMMKEGVKKIPSYKFLPLMYQLAARMGTKLSNLPTQEEAGFHSVLNELICRASMDHPHHTLFIILALVNANKDESFSRSRLSRNSARQPSPLDLERAEVAQKII-NVIRKQKAQMIQGIETLCSAYITLAYMDASRHKTE-KKAIPIPADQPIMKIKDLDNVIIPTMDIKVDPSGKY--EDLVTISSFKPHFHLAGGVNLPKIIDCVGSDGKSRRQLVKGQDDLRQDAVMQQVFHMCSTLLQR----------------NAETRKRKLNIRRYKVVPFSQRSGVLEWCSGTVPIGEFLVDPQKGAHKRFRPQDWTSLACRKKMMEAQRMEFDKKLQAFTEVCQNFRPVFRYFCMERFLDPAVWLEKRLAYTRSVATSSIVGYIVGLGDRHIQNILIDEQTAELVHIDLGVAFEQGKILPTPETVPFRLSRDIVDGMGITGVEGVFRRCCEKTMEVMRSSQEVLLTIVEVLLYDPLFDWTMNPLKAFHLQQQQDEQAELNATLNPTPAGEEPEAHRKSSDSQSFNKVAERVLLRLQEKLKGVEEGAVLSVGGQVNLLIQQAMDPKNLSRLFPGWQAWV 3056          
BLAST of Serine-protein kinase ATM vs. Ensembl Cavefish
Match: atm (ATM serine/threonine kinase [Source:ZFIN;Acc:ZDB-GENE-040809-1])

HSP 1 Score: 482.256 bits (1240), Expect = 2.047e-136
Identity = 280/741 (37.79%), Postives = 433/741 (58.43%), Query Frame = 3
Query: 6189 KIC-AWNQEYPVHSVSHIRTKILEPAMGVF-----GKSLKQESDMLS---TMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWD--ELNNLSQDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCAR-------LNSENNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMN-SRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEG-FDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            ++C +W  E  + S + I    LE A+  F         KQ+S M     +++ FS  QY  I  YMRSSE+EN+  +L ++K +V  L+  R     R  ++ Q E++ D   L NL  DR RFLL A  +   CL+  + +D  IF L S+WL N   + +N+++ + + KI ++KFL LM QL AR       L ++    F   L +LI R  +DHP H+++ +LA+ NAN+D    +S+  ++       ++  R  VA  ++  ++++ ++ +I+  + L +AYI  A +D S  K +  K +  P +  +++I     + +PT+ I +D S KY  + L  I  F   + L GG+NLPKI+ C  SDG  RRQLVK  DDLRQD+VMQQVF + ++LL                  +A    R ++IR YKV+P +Q SG++EWC  TVP+G++L + + GAH+R+RPQD T L CRK++  +      K+++ F ++    +PV  YF  E+F +   W + R +Y  S+A +SIVG+I+GLGDRH+QNIL+D  TAEL+HID G+AF+ GK++PT E VPFRL+RD+V G+G  GVEG F+  C   + ++RS ++++LT++EVLL+DPL  W +NP  A  L  +++   + N T N +    E     KS    S N++AERV+L +  K  G  + + L+  G VN LIQ A + +NL+R+F GWQA++
Sbjct: 2311 RLCGSWLSETCLESPAVILESYLERAVEAFEDHGGAPDPKQQSQMTQAFLSLARFSDAQYQGIENYMRSSEFENKQALLEKAKEEVD-LMKERNVTNNRYTVKVQRELELDVRALANLRADRRRFLLKAVENYIRCLELGEEHDTWIFRLASLWLENADVKNVNDMMKEGVKKIPSYKFLPLMYQLAARMGTKLSNLPTQEEAGFHSVLNELICRASMDHPHHTLFIILALVNANKDESFSRSRLSRNSARQPSPLDLERAEVAQKII-NVIRKQKAQMIQGIETLCSAYITLAYMDASRHKTE-KKAIPIPADQPIMKIKDLDNVIIPTMDIKVDPSGKY--EDLVTISSFKPHFHLAGGVNLPKIIDCVGSDGKSRRQLVKGQDDLRQDAVMQQVFHMCSTLLQR----------------NAETRKRKLNIRRYKVVPFSQRSGVLEWCSGTVPIGEFLVDPQKGAHKRFRPQDWTSLACRKKMMEAQRMEFDKKLQAFTEVCQNFRPVFRYFCMERFLDPAVWLEKRLAYTRSVATSSIVGYIVGLGDRHIQNILIDEQTAELVHIDLGVAFEQGKILPTPETVPFRLSRDIVDGMGITGVEGVFRRCCEKTMEVMRSSQEVLLTIVEVLLYDPLFDWTMNPLKAFHLQQQQDEQAELNATLNPTPAGEEPEAHRKSSDSQSFNKVAERVLLRLQEKLKGVEEGAVLSVGGQVNLLIQQAMDPKNLSRLFPGWQAWV 3030          
BLAST of Serine-protein kinase ATM vs. Ensembl Cavefish
Match: atr (ATR serine/threonine kinase [Source:ZFIN;Acc:ZDB-GENE-070912-458])

HSP 1 Score: 205.297 bits (521), Expect = 4.430e-52
Identity = 154/589 (26.15%), Postives = 271/589 (46.01%), Query Frame = 3
Query: 6639 KLNNIISDVIGKIETHKFLVLMPQLCARLNSENNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMNSRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAK--QVKLPVPTLSIPIDRSLKYS---LDRLP----LIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDS--TPLQCRKRLQISAEENIKKRIETFKDIL-TKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSS------YLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            K+N +IS+    +  ++FL    QL +R+   ++  F + L  +  ++ L +P  +++ + A+  ++  +                +MN    +    V   +K S    I DA+ LT   +   N  +      +   + F L   L+  +   ++ +P+ ++ IP   S   +    D  P     + GFDD   +   +  PK +  + SDG     + K  DDLR+D  + +   ++N  L                   A    R + IRTY VIP+ +  GIIEW  +T  L   L       ++ Y+ +    T  + RK + +    +++++++  KD+L  +  PV   +    FP+   W+ +R +Y  S A+ S+VG++LGLGDRH +NIL D  T E +H+DF   F+ G+     E VPFRLT+++VH +GP G EG F+  C   L L+R Q++ ++++++  LHDPL  W   P    +   K +A+                       G   N+ A+  + ++ ++  G + +        L+ EGHV+YLIQ A++   L +M+ GW  YL
Sbjct: 1915 KINAVISEHTSNLSPYQFLTAFSQLISRVCHSSDDVFSV-LMDIAAKVFLAYPQQAMWMMTAVSKSSYPT----------------RMNRCKEILKKAVS--LKSSFGKFIEDANRLTDKLVELCNKPVDGNSSTLSMSVHFKLLKRLVEESSFSEILIPLQSVLIPTLPSTGGANPHHDAFPGHWVYLSGFDDSVEILASLQKPKKISLRGSDGKFYTMMCKPKDDLRKDCRLMEFNCLINKCLRK----------------DAESRRRDLHIRTYAVIPLNEECGIIEWVNNTAGLRHIL-------NKLYKEKGIYLTGKELRKMI-LPKTASLQEKLKLHKDVLCARHPPVFHDWFLRTFPDPTSWYNSRSAYCRSTAVMSMVGYVLGLGDRHGENILFDSLTGECVHVDFNCLFNKGETFDVPEVVPFRLTQNMVHAMGPMGTEGLFRQACEVTLRLMRDQREPLMSVLKTFLHDPLVEWS-KPVKGSL---KTQANES---------------------GEIVNEKAKTHVQDIEQRLQGVIKNRNKVMGLPLSIEGHVHYLIQEATDDNLLCQMYLGWGPYL 2435          
BLAST of Serine-protein kinase ATM vs. Ensembl Cavefish
Match: mtor (mechanistic target of rapamycin kinase [Source:NCBI gene;Acc:103042377])

HSP 1 Score: 157.918 bits (398), Expect = 1.001e-37
Identity = 123/412 (29.85%), Postives = 203/412 (49.27%), Query Frame = 3
Query: 7224 PKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFH--------------FEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPT-QERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFD----NKSRPGSS------------------QNQMAERVILEMSRKFAGAVDSSY---LNCEGHVNYLIQTASNVENLARMFHGW 8339
            P+ +    S+G +   L+K ++DLRQD  + Q+F +VN+LL N  +   K                 +SI+ Y VIP++  SG+I W    VP  D L        + YR         +K++ ++ E  I  R+    D LT ++ V  + H              + K P S+ WF  R +Y  SLA+ S+VG+ILGLGDRH  N++LD  + +++HIDFG  F++        E++PFRLTR L + +   G++G ++ TC  V+ +LR  +D ++ ++E  ++DPL +W+L   + +   TKR      + T+  S +T+EG D       +PG++                   N+ A ++I  +  K  G  D S+   L+    V  LI+ A++ ENL + + GW
Sbjct: 2138 PRKLTIMGSNGHEFMFLLKGHEDLRQDERVMQLFGLVNTLLANDPASLRKN----------------LSIQRYAVIPLSTNSGLIGW----VPHCDTLH----ALIRDYRE--------KKKILLNIEHRIMLRMAPDYDHLTLMEKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHRDSVMAVLEAFVYDPLLNWRLMDTNTK--GTKRSRTRTDSYTAGQSVETMEGIDLGETTHKKPGTTVPESIHSFIGDGLVQPEALNKKAIQIINRVRDKLTGR-DFSHDETLDVPTQVELLIKQATSHENLCQCYIGW 2514          
BLAST of Serine-protein kinase ATM vs. Ensembl Cavefish
Match: smg1 (SMG1 nonsense mediated mRNA decay associated PI3K related kinase [Source:ZFIN;Acc:ZDB-GENE-061013-767])

HSP 1 Score: 140.198 bits (352), Expect = 2.499e-32
Identity = 94/337 (27.89%), Postives = 156/337 (46.29%), Query Frame = 3
Query: 7224 PKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPL----GDWLANDKT----GAHQRYRPQDSTPLQCRKR-----------LQISAEENIKKR---IETFKDILTKIQP-----VLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKL-------------NPQHARVLHTKREADND 8114
            PK ++   SDG     L K  +DL  D  + Q  S+VN++         K N  +S  + A         R Y V P+   SG+I+W +   PL      W   +       A   Y+   + P+  R               +    ++ +R   +   +D+L ++       +L    +        W++  +SYA S A+ S+VG+I+GLGDRH+ N+L+D+ T E++HID+ + F+ GK +   E+VPFR+T ++   LG  GVEG F+ +C  V+ ++R  ++ +LTL+E  ++DPL  W                 Q A    +KRE + D
Sbjct: 2121 PKKLYFLGSDGKNYPYLFKGLEDLHLDERIMQFLSIVNTMFT-------KVNQQESPRFHA---------RHYSVTPLGTRSGLIQWVDGATPLFGLYKRWQQREAVLQAQKAQDSYQQPQNLPMVPRPSELYYSKIGPALKAVGLSLDVSRRDWPLSVMRDVLRELMEATPPNLLAKELWCSCTTPSEWWRVTQSYARSTAVMSMVGYIIGLGDRHLDNVLIDMTTGEVVHIDYNVCFEKGKSLRVPEKVPFRMTHNIETALGVTGVEGIFRLSCEQVVQMMRRGRETLLTLLEAFVYDPLVDWTAGGEVGFAGAVYGGGGQQAESKQSKREMERD 2441          
BLAST of Serine-protein kinase ATM vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007186.1 (pep scaffold:Pmarinus_7.0:GL476459:175296:202639:-1 gene:ENSPMAG00000006485.1 transcript:ENSPMAT00000007186.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 489.574 bits (1259), Expect = 2.454e-147
Identity = 278/769 (36.15%), Postives = 443/769 (57.61%), Query Frame = 3
Query: 6159 FFKLYFKAVSKICAWNQEYPVHSVSHIRTKILEPAMGVFGKSLKQ--------------ESDMLSTMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWDE--LNNLSQDRERFLLSAAISCSECLQNEDGN-DFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSE--NNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXA-----NDKMNS-------RISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRI-ETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFD---NKSRPG---SSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
               LY + + +   W  E    S S I ++ LE ++ V  ++                  + +  +++ F+  Q+  I  YMRS+EYEN+  +L ++K DV+ L  L+ + P R +++ Q E D DE  L +L QDRERFL+ A ++   CL++   + + + F L+S+WL N + +++N+++   +  I  HKFL L+ QL AR+ ++    ++F   L+KLI R+ L HP H++  +LA+ NA +D  L+   +    +        D   S       R+     +VEQ V++ Q +++RD + L  AYI  AN++  A+++   K +  P +  +  I    K+ +PTL + +D + +Y    L  +  F   + L GG+NLPKI+ C+ SDG   RQLVK  DDLRQD+VMQQVF + N LL                  SA    R +SIRTYKV+P++Q SG++EWC  T+P+GD+L    TGAH +YRP D   + CRK + ++A++     +   ++++    +PV  +F +E+F +   WF+ R SY  S+A +SIVG+I+GLGDRHVQNIL+D+N+AEL+HID G+AF+ G+++PT E VPFRLTRD+V G+G  GVEG F+  C   + ++R+ ++ +LT++EVLL DPL  W +NP  A  L T+ E + +  +T   +           ++ R G    S N+MAERV++ + +K  G  + S L+  G VN LIQ A++ +NL+R+F GWQ ++
Sbjct:  355 LLALYAECLGRYGHWLAETCSESPSIILSEYLEKSVSVAERAWGDGSGGSDEGEGGRVCRAALYLSLARFADAQHRSIVAYMRSAEYENKRALLRKAKEDVTLLQSLKLQ-PSRYMVKLQRECDLDERELLSLRQDRERFLVEALVNYVRCLRSGGAHGEARAFRLVSLWLENSAEQQVNDVMRTGVTDIPPHKFLPLIYQLAARMGTKMAGGEAFHSILQKLILRVTLTHPHHALLVVLALANAGKDELLQTVAARDGARGGSRLSRGDSKGSSAPSDDDRVRATRALVEQ-VRKQQPELVRDTEKLCDAYIMLANMNAEAWRKQT-KDMLIPKDQPIKEIRNLYKVVIPTLELKVDPTGQYP--DLVTVRAFRPHFRLAGGVNLPKIIDCEGSDGRTYRQLVKGRDDLRQDAVMQQVFHMCNELLAG----------------SAETRTRKLSIRTYKVVPLSQRSGVLEWCVGTMPIGDYLVQKDTGAHTKYRPNDWPSMHCRKFMNVAAQDRRNGDLFLAYQELCHHFRPVFRHFFWERFLDPAVWFERRLSYTRSVATSSIVGYIVGLGDRHVQNILIDLNSAELVHIDLGVAFEQGRILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMRNSQEALLTIVEVLLFDPLFDWTMNPLKALTLQTRTEDETEGTSTMGPTLGKAPASGRAVHQERNGMDPQSLNKMAERVLMRLQQKLKGVEEGSVLSVPGQVNLLIQQATDPKNLSRLFPGWQPWV 1102          
BLAST of Serine-protein kinase ATM vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003429.1 (pep scaffold:Pmarinus_7.0:GL476508:503342:564700:-1 gene:ENSPMAG00000003096.1 transcript:ENSPMAT00000003429.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 183.341 bits (464), Expect = 4.662e-46
Identity = 146/600 (24.33%), Postives = 262/600 (43.67%), Query Frame = 3
Query: 6639 KLNNIISDVIGKIETHKFLVLMPQLCARLNSENNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMNSRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVK-LPVPTLSIPIDRSLKYSLDRLP--------------LIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLG---DWLANDK-TGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKD-ILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIIL---TLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSS-------YLNCEGHVNYLIQTASNVENLARMFHGWQAY 8348
            K+  I+++   K+  ++FL    QL +R+    + +    L+ +I +++  +P  +++ ++A+  ++                 +     R    +    Q V  S    IRD   LT   +   N      K  + K+    +N +   + + V       + IP+   +  +L   P               IVGF D   +   +  PK +  + SDG     + K  DDLR+D  + +  S++N  L  K + + +               R + I TY VIP+ +  G++EW  +T  L    D L N+K  G       +   P+          E  +++++  ++D +L    PV   +    FP+   W+ +R  Y  S A+ S+VG++LGLGDRH +NIL D  T E +H+DF   F+ G      E VPFRLT ++VH +GP G+EG F+  C   + ++  Q++ ++   ++++  +HDPL  W   P H     +  EA                        G   N+ A++++ ++ ++  G + +         L+ EGHV+YLIQ A+N + L +M+ GW  +
Sbjct: 2115 KIIKIMTEHTQKLAPYQFLTAFSQLISRI-CHPHAAVCAALQAIIVKVLTRYPQQALWMMMAVSKSS-----------------HAARAERCKAIFGKAVQ-VDGSLRKFIRDGTSLTDLLLELCN------KPTMDKQTTMSMNVNFRGLKRLVDDTNFSNVLIPLQAVMTPTLPSTPGGHADHDPFPGNMAYIVGFHDPVEVLSSLQKPKKICIRGSDGRSYPMMCKPKDDLRKDCRLMEFNSLINKDLLRKDAESRR---------------RDLRICTYAVIPLNEECGLVEWVNNTESLRTIVDILYNEKGIGLTMSEVSKCILPI----------ETPLEQKLSMYRDKLLPPHPPVFHEWFLRTFPDPTSWYSSRLGYTRSTAVMSMVGYVLGLGDRHGENILFDSLTGECMHVDFNCLFNKGLTFGVPELVPFRLTHNMVHAMGPMGLEGLFRRACEVTMRVMCDQRESLIRGASVLKTFIHDPLVEWS-RPLHGSWRGSANEA------------------------GEVVNEKAKQIVQDIEQRLHGVIKNPNNRVRGLPLSIEGHVHYLIQEATNEKLLCQMYLGWAPF 2639          
BLAST of Serine-protein kinase ATM vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003412.1 (pep scaffold:Pmarinus_7.0:GL476508:503342:564700:-1 gene:ENSPMAG00000003096.1 transcript:ENSPMAT00000003412.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.956 bits (463), Expect = 5.365e-46
Identity = 146/600 (24.33%), Postives = 262/600 (43.67%), Query Frame = 3
Query: 6639 KLNNIISDVIGKIETHKFLVLMPQLCARLNSENNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMNSRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVK-LPVPTLSIPIDRSLKYSLDRLP--------------LIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLG---DWLANDK-TGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKD-ILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIIL---TLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSS-------YLNCEGHVNYLIQTASNVENLARMFHGWQAY 8348
            K+  I+++   K+  ++FL    QL +R+    + +    L+ +I +++  +P  +++ ++A+  ++                 +     R    +    Q V  S    IRD   LT   +   N      K  + K+    +N +   + + V       + IP+   +  +L   P               IVGF D   +   +  PK +  + SDG     + K  DDLR+D  + +  S++N  L  K + + +               R + I TY VIP+ +  G++EW  +T  L    D L N+K  G       +   P+          E  +++++  ++D +L    PV   +    FP+   W+ +R  Y  S A+ S+VG++LGLGDRH +NIL D  T E +H+DF   F+ G      E VPFRLT ++VH +GP G+EG F+  C   + ++  Q++ ++   ++++  +HDPL  W   P H     +  EA                        G   N+ A++++ ++ ++  G + +         L+ EGHV+YLIQ A+N + L +M+ GW  +
Sbjct: 2149 KIIKIMTEHTQKLAPYQFLTAFSQLISRI-CHPHAAVCAALQAIIVKVLTRYPQQALWMMMAVSKSS-----------------HAARAERCKAIFGKAVQ-VDGSLRKFIRDGTSLTDLLLELCN------KPTMDKQTTMSMNVNFRGLKRLVDDTNFSNVLIPLQAVMTPTLPSTPGGHADHDPFPGNMAYIVGFHDPVEVLSSLQKPKKICIRGSDGRSYPMMCKPKDDLRKDCRLMEFNSLINKDLLRKDAESRR---------------RDLRICTYAVIPLNEECGLVEWVNNTESLRTIVDILYNEKGIGLTMSEVSKCILPI----------ETPLEQKLSMYRDKLLPPHPPVFHEWFLRTFPDPTSWYSSRLGYTRSTAVMSMVGYVLGLGDRHGENILFDSLTGECMHVDFNCLFNKGLTFGVPELVPFRLTHNMVHAMGPMGLEGLFRRACEVTMRVMCDQRESLIRGASVLKTFIHDPLVEWS-RPLHGSWRGSANEA------------------------GEVVNEKAKQIVQDIEQRLHGVIKNPNNRVRGLPLSIEGHVHYLIQEATNEKLLCQMYLGWAPF 2673          
BLAST of Serine-protein kinase ATM vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003421.1 (pep scaffold:Pmarinus_7.0:GL476508:503342:564700:-1 gene:ENSPMAG00000003096.1 transcript:ENSPMAT00000003421.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.956 bits (463), Expect = 6.548e-46
Identity = 146/600 (24.33%), Postives = 262/600 (43.67%), Query Frame = 3
Query: 6639 KLNNIISDVIGKIETHKFLVLMPQLCARLNSENNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMNSRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVK-LPVPTLSIPIDRSLKYSLDRLP--------------LIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLG---DWLANDK-TGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKD-ILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIIL---TLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSS-------YLNCEGHVNYLIQTASNVENLARMFHGWQAY 8348
            K+  I+++   K+  ++FL    QL +R+    + +    L+ +I +++  +P  +++ ++A+  ++                 +     R    +    Q V  S    IRD   LT   +   N      K  + K+    +N +   + + V       + IP+   +  +L   P               IVGF D   +   +  PK +  + SDG     + K  DDLR+D  + +  S++N  L  K + + +               R + I TY VIP+ +  G++EW  +T  L    D L N+K  G       +   P+          E  +++++  ++D +L    PV   +    FP+   W+ +R  Y  S A+ S+VG++LGLGDRH +NIL D  T E +H+DF   F+ G      E VPFRLT ++VH +GP G+EG F+  C   + ++  Q++ ++   ++++  +HDPL  W   P H     +  EA                        G   N+ A++++ ++ ++  G + +         L+ EGHV+YLIQ A+N + L +M+ GW  +
Sbjct: 2135 KIIKIMTEHTQKLAPYQFLTAFSQLISRI-CHPHAAVCAALQAIIVKVLTRYPQQALWMMMAVSKSS-----------------HAARAERCKAIFGKAVQ-VDGSLRKFIRDGTSLTDLLLELCN------KPTMDKQTTMSMNVNFRGLKRLVDDTNFSNVLIPLQAVMTPTLPSTPGGHADHDPFPGNMAYIVGFHDPVEVLSSLQKPKKICIRGSDGRSYPMMCKPKDDLRKDCRLMEFNSLINKDLLRKDAESRR---------------RDLRICTYAVIPLNEECGLVEWVNNTESLRTIVDILYNEKGIGLTMSEVSKCILPI----------ETPLEQKLSMYRDKLLPPHPPVFHEWFLRTFPDPTSWYSSRLGYTRSTAVMSMVGYVLGLGDRHGENILFDSLTGECMHVDFNCLFNKGLTFGVPELVPFRLTHNMVHAMGPMGLEGLFRRACEVTMRVMCDQRESLIRGASVLKTFIHDPLVEWS-RPLHGSWRGSANEA------------------------GEVVNEKAKQIVQDIEQRLHGVIKNPNNRVRGLPLSIEGHVHYLIQEATNEKLLCQMYLGWAPF 2659          
BLAST of Serine-protein kinase ATM vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010422.1 (pep scaffold:Pmarinus_7.0:GL478779:2292:46075:1 gene:ENSPMAG00000009431.1 transcript:ENSPMAT00000010422.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 2.142e-10
Identity = 63/258 (24.42%), Postives = 106/258 (41.09%), Query Frame = 3
Query: 7287 DDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQ-RWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSW 8057
            +DL  D  + Q  S+VN++         K N     +W  F        R Y V P+   SG+I+W +   PL         G ++R++          +R  ++A   +                       E  P S+ R    RK   N L              RH++     V++ + + +    AF++       E+VPFR+T+D+   LG  GVEG F+ +C  +L ++R  ++ +LTL+E  ++DPL  W
Sbjct: 2110 EDLHLDERIMQFLSIVNNMF-------VKGNG---REWHRF------HARHYSVTPLGSRSGLIQWVDGATPL--------FGLYKRWQ----------QRETLTAGHKV-----------------------ELVPCSRIRLADPRKQIKNFL--------------RHLREC--AVSSFKSVRVTKARAFEV------PEKVPFRMTQDIERALGVTGVEGIFRLSCEQILQIMRRGRETLLTLLEAFVYDPLVDW 2288          
BLAST of Serine-protein kinase ATM vs. Ensembl Yeast
Match: TEL1 (Protein kinase primarily involved in telomere length regulation; contributes to cell cycle checkpoint control in response to DNA damage; acts with Red1p and Mec1p to promote interhomolog recombination by phosphorylation of Hop1; functionally redundant with Mec1p; regulates P-body formation induced by replication stress; homolog of human ataxia-telangiectasia mutated (ATM) gene [Source:SGD;Acc:S000000184])

HSP 1 Score: 271.552 bits (693), Expect = 4.468e-73
Identity = 194/606 (32.01%), Postives = 309/606 (50.99%), Query Frame = 3
Query: 6609 SMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSENNKSFEINLEKLIKRIILDHPFHSIYNLLAI----RNANRDXXXXXXXXXXXXXXANDKMNSRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWAN--VDMSAFKQDIHKKLKFPLNCSLLRIA---------KQV---KLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQG-GINLPKIVWCQSSDGLKRRQLVK-SNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNP--QHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGS----SQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAY 8348
             +W  N+ N K+N ++   IG I + KFL  + Q+ ++++ E N+ F+  L+  +KR++   P+ S+Y++++I    + +N+D                    + IS     V++++ E Q     D       Y+       +MS    +    LKF  N   LR+A         KQ+   KLP+PT +  +  S      R P IV  ++   +   G++LPKIV    SDG  ++ L+K SNDDLRQD++M+QVF  VN +L N                   + N  + IRTYKV+P+   +GIIE+  ++  L   L+   T     +        Q RK ++    ++ ++R++ +  I  +I+P L  F F+ FP+   WF+A+K+Y   +A +SIVG+ILGLGDRH+ NILLD +T E IHID GIAFD GKL+P  E VPFRLTRD+V G G  GV+G F+ +C  V  +LR     ++ ++ +L  DPL+SW ++P  ++  +   + E  N               FDN S+  S    ++NQ + R +  +  K  G    + L+ E  V  LIQ A++  NL+ ++ GW  +
Sbjct: 2252 GLWFENDDNSKINQLLYKEIGTIPSWKFLPWVNQIASKISMEENE-FQKPLQLTMKRLLYKLPYDSLYSVMSILLYEKQSNKD--------------------TNISQKIQAVKKILLELQG---YDRGAFAKKYLLPVQEFCEMSVELAN----LKFVQNTKTLRLANLKIGQYWLKQLNMEKLPLPTSNFTVKSSADGRKAR-PYIVSVNETVGITTTGLSLPKIVTFNISDGTTQKALMKGSNDDLRQDAIMEQVFQQVNKVLQN----------------DKVLRNLDLGIRTYKVVPLGPKAGIIEFVANSTSLHQILSKLHTNDKITFD-------QARKGMKAVQTKSNEERLKAYLKITNEIKPQLRNFFFDSFPDPLDWFEAKKTYTKGVAASSIVGYILGLGDRHLNNILLDCSTGEPIHIDLGIAFDQGKLLPIPELVPFRLTRDIVDGFGVTGVDGLFRRSCERVYAVLRKDYVKVMCVLNILKWDPLYSWVMSPVKKYEHLFEEEHEITN---------------FDNVSKFISNNDRNENQESYRALKGVEEKLMG----NGLSVESSVQDLIQQATDPSNLSVIYMGWSPF 2786          
BLAST of Serine-protein kinase ATM vs. Ensembl Yeast
Match: TOR2 (PIK-related protein kinase and rapamycin target; subunit of TORC1, a complex that regulates growth in response to nutrients and TORC2, a complex that regulates cell-cycle dependent polarization of the actin cytoskeleton; involved in meiosis; TOR2 has a paralog, TOR1, that arose from the whole genome duplication [Source:SGD;Acc:S000001686])

HSP 1 Score: 160.614 bits (405), Expect = 2.040e-39
Identity = 116/405 (28.64%), Postives = 200/405 (49.38%), Query Frame = 3
Query: 7176 IVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAH---QRYRPQDSTPLQCRK--RLQISAEEN---IKKRIETFKDILTKIQPVLGY-FHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPT-QERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARV-----LHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSY--LNCEGHVNYLIQTASNVENLARMFHGW 8339
            I  F+ V+S+      P+    + SDG   + ++K ++D+RQDS++ Q+F +VN+LL N                 A  + R + I+ Y  IP++  SG++ W    VP  D         H   + +R     PL       LQ++ + +   + +++E F   L   +    Y   + K   S+ W + R +Y  SLA+ S+ G+ILGLGDRH  N++LD  T ++IHIDFG  F+   L     E+VPFRLTR L + +   G+EG F+ TC +V+ +LR  K  ++ ++E    DPL +W  +    ++     +       N+  +    + + ++  +N+ +  + +N  A  V+  ++ K  G     +  L+    V+ LIQ A++VENL + + GW
Sbjct: 2094 ISKFEPVFSVISSKQRPRKFCIKGSDGKDYKYVLKGHEDIRQDSLVMQLFGLVNTLLQN----------------DAECFRRHLDIQQYPAIPLSPKSGLLGW----VPNSDTF-------HVLIREHREAKKIPLNIEHWVMLQMAPDYDNLTLLQKVEVFTYALNNTEGQDLYKVLWLKSRSSETWLERRTTYTRSLAVMSMTGYILGLGDRHPSNLMLDRITGKVIHIDFGDCFEAAILREKFPEKVPFRLTRMLTYAMEVSGIEGSFRITCENVMKVLRDNKGSLMAILEAFAFDPLINWGFDLPTKKIEEETGIQLPVMNANELLSNGAITEEEVQRVENEHK-NAIRNARAMLVLKRITDKLTGNDIRRFNDLDVPEQVDKLIQQATSVENLCQHYIGW 2470          
BLAST of Serine-protein kinase ATM vs. Ensembl Yeast
Match: MEC1 (Genome integrity checkpoint protein and PI kinase superfamily member; Mec1p and Dun1p function in same pathway to regulate dNTP pools and telomere length; signal transducer required for cell cycle arrest and transcriptional responses to damaged or unreplicated DNA; facilitates replication fork progression and regulates P-body formation under replication stress; promotes interhomolog recombination by phosphorylating Hop1p; associates with shortened, dysfunctional telomeres [Source:SGD;Acc:S000000340])

HSP 1 Score: 155.606 bits (392), Expect = 7.377e-38
Identity = 140/583 (24.01%), Postives = 253/583 (43.40%), Query Frame = 3
Query: 6624 NESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSENNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMNSRISVAYTMVEQLVKESQS--DIIRDADILTTAYIHWANVDMSAFK----QDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPL--IVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAY 8348
            +++ E + + + + +    T+ +  ++ QL +RL   +  S +I +  L+  + +++P H ++ + A+ N+N                     + R+     ++E+  + SQ+  D++  A  LT A       D+ +      + + K  KF +N +   +   V+  +  +S     S++      P+  I+ F   Y +   +  PK +    SDG     + K  +D+RQD+   Q  + ++ LL              S D ++    R + I  Y V+ + +  GI+E   + V L   L+        +Y  +         R Q +A   +  ++E + + + K  P+L  +  E FP+   WF AR +YA S A+ ++VG ILGLGDRH +NILLD+ T +++H+DF   F+ GK +P  E VPFRLT +L+  LG  G EG FK +    L L+R  +  ++ +IE +++D                  R  D+            I G D +                          D   L+  G    LIQ A++ +NL++M+ GW  +
Sbjct: 1875 SKATEDICSHVEEALQHCPTYIWYFVLTQLLSRLLHSHQSSAQIIMHILLS-LAVEYPSHILWYITALVNSNS--------------------SKRVLRGKHILEKYRQHSQNPHDLVSSALDLTKALTRVCLQDVKSITSRSGKSLEKDFKFDMNVAPSAMVVPVRKNLDIISPLESNSMRGYQPFRPVVSIIRFGSSYKVFSSLKKPKQLNIIGSDGNIYGIMCKK-EDVRQDNQYMQFATTMDFLL--------------SKDIAS--RKRSLGINIYSVLSLREDCGILEMVPNVVTLRSILSTKYESLKIKYSLK-----SLHDRWQHTA---VDGKLEFYMEQVDKFPPILYQWFLENFPDPINWFNARNTYARSYAVMAMVGHILGLGDRHCENILLDIQTGKVLHVDFDCLFEKGKRLPVPEIVPFRLTPNLLDALGIIGTEGTFKKSSEVTLALMRKNEVALMNVIETIMYD------------------RNMDHSIQKALKVLRNKIRGIDPQ--------------------------DGLVLSVAGQTETLIQEATSEDNLSKMYIGWLPF 2367          
BLAST of Serine-protein kinase ATM vs. Ensembl Yeast
Match: TOR1 (PIK-related protein kinase and rapamycin target; subunit of TORC1, a complex that controls growth in response to nutrients by regulating translation, transcription, ribosome biogenesis, nutrient transport and autophagy; involved in meiosis; TOR1 has a paralog, TOR2, that arose from the whole genome duplication [Source:SGD;Acc:S000003827])

HSP 1 Score: 154.836 bits (390), Expect = 1.222e-37
Identity = 121/405 (29.88%), Postives = 196/405 (48.40%), Query Frame = 3
Query: 7176 IVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAH---QRYRPQDSTPLQCRK--RLQISAE-ENIK--KRIETFKDIL--TKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPT-QERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSW--KLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDN--KSRPGSSQNQMAERVILEMSRKFAGAVDSSY--LNCEGHVNYLIQTASNVENLARMFHGW 8339
            I  F+ ++S+      P+    + SDG   + ++K ++D+RQDS++ Q+F +VN+LL N                    + R + I+ Y  IP++  SG++ W    VP  D         H   + +R     PL       LQ++ + EN+   ++IE F   L  TK Q +       K   S+ W + R +Y  SLA+ S+ G+ILGLGDRH  N++LD  T ++IHIDFG  F+   L     E+VPFRLTR L + +   G+EG F+ TC +V+ +LR  K+ ++ ++E    DPL  W   L PQ             + +      + T+E   N    +   ++N  A  V+  ++ K  G     +  L+    V+ LIQ A+++E L + + GW
Sbjct: 2090 IAKFEPLFSVISSKQRPRKFSIKGSDGKDYKYVLKGHEDIRQDSLVMQLFGLVNTLLKNDSEC----------------FKRHLDIQQYPAIPLSPKSGLLGW----VPNSDTF-------HVLIREHRDAKKIPLNIEHWVMLQMAPDYENLTLLQKIEVFTYALDNTKGQDLYKILWL-KSRSSETWLERRTTYTRSLAVMSMTGYILGLGDRHPSNLMLDRITGKVIHIDFGDCFEAAILREKYPEKVPFRLTRMLTYAMEVSGIEGSFRITCENVMRVLRDNKESLMAILEAFALDPLIHWGFDLPPQKLTEQTGIPLPLINPSELLRKGAITVEEAANMEAEQQNETKNARAMLVLRRITDKLTGNDIKRFNELDVPEQVDKLIQQATSIERLCQHYIGW 2466          
BLAST of Serine-protein kinase ATM vs. Ensembl Yeast
Match: PIK1 (Phosphatidylinositol 4-kinase; catalyzes first step in the biosynthesis of phosphatidylinositol-4,5-biphosphate; may control cytokinesis through the actin cytoskeleton; may control nonselective autophagy and mitophagy through trafficking of Atg9p [Source:SGD;Acc:S000005211])

HSP 1 Score: 61.6178 bits (148), Expect = 2.000e-9
Identity = 38/123 (30.89%), Postives = 63/123 (51.22%), Query Frame = 3
Query: 7695 PESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEG----RFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLH 8051
            P   ++ +A+ ++A+SLA  S++ ++L + DRH  NI++D N   + HIDFG            E  PF+LT + +  LG  GVEG    +F          LR   D I+++ E++  D + 
Sbjct:  888 PNGFKYRRAQDNFASSLAAYSVICYLLQVKDRHNGNIMID-NEGHVSHIDFGFMLSNSPGSVGFEAAPFKLTYEYIELLG--GVEGEAFKKFVELTKSSFKALRKYADQIVSMCEIMQKDNMQ 1007          
BLAST of Serine-protein kinase ATM vs. Ensembl Nematostella
Match: EDO36404 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIS1])

HSP 1 Score: 456.833 bits (1174), Expect = 2.381e-131
Identity = 278/791 (35.15%), Postives = 433/791 (54.74%), Query Frame = 3
Query: 6105 DSQKHILTC-----QQIKRNHDLFFKLYFKAVSKICAWNQEYPVHSVSHIRTKILEP-AMGVFGKSLKQESDM---------LSTMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLR----KILEKQSEVDWDELNNLSQDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLN--SENNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMNS----------RISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQ-----DIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWL---ANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGF---DNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            ++  H+L C     Q +    +   +LY +A+    +W  E    + + I  + LE     + G + + ESD+           +++ ++  QY +I  YM+SS++EN+ +I  ++K + + L  +  + P R    + L  +SE+D +EL  +   +  FL  A  + ++ LQ  D  D ++F L S+W  N     +++I+ D I +I++ KFL LM QL ARL   S  + +F+  L +LI+R  +DHP H++  L+A+ NA+RD E               +  S          R+  A  ++E  +   +  +++    L  AYI  A  ++   K      DI   L      +L  +A      VPT  I +D   +Y  + +  +  F   +SL GG+NLPKI+ C  SDG+KRRQLVK  DDLRQD+VM+QVF +VN LL N                      R + +RTYKVIP++Q SG++EWCE T+PLG++L       TGAHQRY P+D +P+ CR+++       I         I+   +PV  +F  EKF +   WF+ R +Y  S A +SIVG+I+GLGDRHVQNIL+D N+AEL+HID G+AF+ GK++PT E VPFRLTRDLV G+G  GVEG F+  C   + ++R+ ++ ++T++EVLL+DPL+SW L+P+    L   +  DND +  S+T+   +      +N     S  N+MAERV+  + +K  G  D++ L+  G VN+LI+ A +V+NL R+F GWQ ++
Sbjct:  965 ETAMHLLKCLTKQLQAVCMYDEEEIRLYPQALGLYGSWMAETRSENPNKIIEEYLEKHGRRISGLAYRGESDVHIVVPNIDAYLSLARYADTQYQNIVDYMKSSDFENKQEIARDAKSEYNRLSKVVAR-PERDKYIRTLMVESEIDEEELRLMEDSKMNFLQKALENYAKTLQAGDKYDLRVFRLCSLWFDNCKTSFVDDIMKDSISRIQSRKFLPLMYQLAARLGMRSSQDDAFQATLGQLIERTCVDHPHHTLLILIALVNADRDREYTAPSRRNGRDSRASRNASKETKGFIDEARLEAASALIES-ISHQRGQLVQMTKSLCLAYIELAYWEVGHLKGKTGPFDIKDTLAIKKMNNLRHVA------VPTSDIKVDPLCRY--EEIVYVDRFMPTFSLAGGVNLPKIIACVGSDGVKRRQLVKGRDDLRQDAVMEQVFGMVNQLLANNTETR----------------KRKLRVRTYKVIPLSQRSGMLEWCEGTMPLGEYLIGSPGHNTGAHQRYNPRDWSPMDCRRKMASVVRNYI------LIGIMDHFKPVFRHFFLEKFVDPAEWFERRLAYTRSCATSSIVGYIVGLGDRHVQNILVDCNSAELVHIDLGVAFEQGKVLPTPETVPFRLTRDLVDGMGVTGVEGVFRRCCEKTMAVMRTSQEALVTILEVLLYDPLYSWTLSPEKKMALQATK-PDNDVSEISSTAVDLVGDLPNGENTENGASVGNKMAERVLSRLKQKLNGIEDNTQLSVTGQVNHLIRQAMDVKNLCRLFPGWQPWV 1722          
BLAST of Serine-protein kinase ATM vs. Ensembl Nematostella
Match: EDO44977 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU99])

HSP 1 Score: 162.155 bits (409), Expect = 1.899e-39
Identity = 114/402 (28.36%), Postives = 196/402 (48.76%), Query Frame = 3
Query: 7224 PKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEEN-----IKKRIETFKDILTKIQPV-LGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPT-QERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHA-RVLHTKREADNDCXXXXXXXXXXIEGFD-NKSRPGSSQ-------------------NQMAERVILEMSRKFAGA--VDSSYLNCEGHVNYLIQTASNVENLARMFHGW 8339
            P+ +    S+G     L+K ++DLRQD  + Q+F +VN+LL +    +                 R +SI+ Y VIP++  SG+I W    VP  D L        + YR +    L    R+ ++   +     + +++E F+  L       L    + K P S+ WF  R +Y  SLA+ S+VG++LGLGDRH  N++LD  T  ++HIDFG  F++        E++PFRLTR L + +   G++G ++ TC  V+  +R  KD ++ ++E  ++DPL +W+L    A ++  +K  +D      +  + + +EG D N+ +P + +                   N+ A  +I  +  K  G    + + L+    V+ LI+ A+  ENL + + GW
Sbjct: 2098 PRKLCLAGSNGSDFMFLLKGHEDLRQDERVMQLFGLVNTLLASDPETS----------------KRHLSIQRYAVIPLSTNSGLIGW----VPHCDTLH----ALIRDYREKKKILLNIEHRIMLTMAPDYDHLTLMQKVEVFEHALANTNGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYVLGLGDRHPSNLMLDRLTGRILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGIDGNYRLTCESVMRTMREHKDSVMAVLEAFVYDPLLNWRLMDNAAPKIKRSKGRSDT----MTEAAEEMLEGVDVNRDKPSAKKPAEPLHSIEEETGHKPEFLNKKALDIITRVRDKLTGRDFANRNTLDVPTQVDLLIKQATAHENLCQCYIGW 2471          
BLAST of Serine-protein kinase ATM vs. Ensembl Nematostella
Match: EDO29217 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T497])

HSP 1 Score: 145.206 bits (365), Expect = 6.301e-39
Identity = 80/235 (34.04%), Postives = 124/235 (52.77%), Query Frame = 3
Query: 7662 PVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSR-PGSSQNQMAERVILEMSRKFAGAVDSSY----LNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            PV G +  + F     W+++R +Y  + A+ S+VG+ILGLGDRH +NIL D    E +H+D    F+ G+     ERVPFRLT +LV  +G  G EG ++ +C   L L+RSQ D +LT++   +HDPL  W L P+                           G  +KS+  G   N+ A +++  + ++  G    +     L+ EG V+ LI  A++++NLA+M+ GW  YL
Sbjct:    4 PVFGEWFLKAFQNPTSWYESRLAYCRTTAVMSMVGYILGLGDRHGENILFDSTNGECVHVDLNCLFNKGETFDCPERVPFRLTHNLVDAMGLLGYEGVYRRSCEVTLRLMRSQCDSLLTVLGTFIHDPLMEW-LRPRGT------------------------PGDPSKSKDTGEVTNEEAVKILKSIEQRLKGYYSKNKIMIPLSIEGQVHKLITEATDIQNLAQMYIGWAPYL 213          
BLAST of Serine-protein kinase ATM vs. Ensembl Nematostella
Match: EDO48437 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJW4])

HSP 1 Score: 132.494 bits (332), Expect = 2.035e-30
Identity = 89/307 (28.99%), Postives = 152/307 (49.51%), Query Frame = 3
Query: 7224 PKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPL-------------GDWLANDKTGAHQR----YRPQD-----STPLQCRKRLQISAEENIKKR--IETFKDILTKI-----QPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSW 8057
            PK +    SDG +   L K  +DL  D  + Q  S+ N++         +A+S +   + A         R Y V P+   SG+I+W +  VP+              + L     G++Q      +P +      TP    K + +  +E+ +K   I   + +L ++       +L    +     +  W+   K+YA S A+ S++G+I+GLGDRH+ N+L+D  T E++HID+ + F+ G+ +   E+VPFR+T +L   LG  GVEG F+ +C  VL +L+  ++ +LTL+E  ++DPL  W
Sbjct:  433 PKKLVFVGSDGQRHTYLFKGLEDLHLDERIMQFLSICNNMF-------TRADSHRCPLFCA---------RHYSVTPLGPRSGLIQWVDGAVPVFALYKRWQQREAATNALLKSAQGSNQPPPPPMKPSELFYSKMTPALKEKGI-VDPKESGRKEWPIAVMRQVLEELIAETPSDLLSRELWCSSTGALEWWHMTKTYARSTAVMSMIGYIIGLGDRHLDNMLIDFTTGEVVHIDYNVCFEKGRGLRVPEKVPFRMTPNLEMALGVTGVEGMFRLSCEQVLKILKQGRETLLTLLEAFVYDPLVDW 722          
BLAST of Serine-protein kinase ATM vs. Ensembl Nematostella
Match: EDO34280 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPT8])

HSP 1 Score: 131.339 bits (329), Expect = 4.082e-30
Identity = 108/417 (25.90%), Postives = 182/417 (43.65%), Query Frame = 3
Query: 7176 IVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWL-----ANDKTGAHQRYRPQDSTPLQCRKRLQI--SAEENIKKRIETFKDILTKIQPVLGYFHFEKFPES-QRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAF-DLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKL------NPQHARVLHTKREADNDCXXXXXXXXXXIEG----------FDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            I GFD+   +   I  PK V  +  D      LVK  +D+R D  ++Q+F ++N ++    + +                 R + +RTY+VIPMTQ  G+IEW ++T PL + L      ++K     R + ++   L  R    I  S E N       FK    ++   L    F++   S + +   R  +A + A   I  ++LG+GDRH+ N L+D+ T  LI IDFG +F    + +P  E VPFRLTR   + L P    G  + T   V+  LR   +++L  ++V + +P   W++        QH  +     +          T+ + ++G           +   R  S    +    + +         + + L  E  V+ LI  A++V  L R + GW+A++
Sbjct: 1460 IAGFDEKVLVLASIRKPKRVTIRGDDERDHMFLVKGGEDIRLDQRIEQLFCMMNEVMSEDPACS----------------QRNLRLRTYQVIPMTQRVGLIEWLKNTKPLKELLHIAATESEKQAMVVRRKTKNMLDLTLRILFDIIISREANRTDTESEFKKKQAQVPWDLLRRAFQQLAASPEAYLTLRTHFARTHACICICQYVLGIGDRHLSNFLVDMRTGGLIGIDFGHSFGSATQFLPVPELVPFRLTRQFTNLLLPLKESGLVRNTMIHVMRALRGNHELLLNTMDVFVKEPSLDWQMFARKQAEDQHMEIGMYYEDLTWYPREKVLTAQRKLKGANPAFVTRQELELGHRRRSWFRNLQSACLGDRRHNVRAQKEENELTSEAQVDCLIDQATDVNILGRAWEGWEAWV 1860          
BLAST of Serine-protein kinase ATM vs. Ensembl Medaka
Match: atr (ATR serine/threonine kinase [Source:NCBI gene;Acc:101157099])

HSP 1 Score: 181.03 bits (458), Expect = 8.628e-45
Identity = 147/595 (24.71%), Postives = 260/595 (43.70%), Query Frame = 3
Query: 6639 KLNNIISDVIGKIETHKFLVLMPQLCARLNSENNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMNSRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWAN---------VDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQ--GGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDIL-TKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQ------MAERVILEMSRKFAGAVDSS------YLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            K+N+I+S+    +  ++FL    QL +R+   +++ F   L  ++ ++ L +P  +++ + A+  ++             +   N  +   IS+         K S    I DA+ LT   +   N         + +S   + + + ++ P    +L   + V +P    ++P         D  P    + D + ++    +  PK +  + SDG     + K  DDLR+D  + +   ++N  L                   A    R + IRTY VIP+ +  GIIEW  +T  L   L        + Y+ +     +  ++L +      ++++   K++L  +  PV   +    FP+      +R +Y  S A+ S+VG++LGLGDRH +NIL D  T E +H+DF   F+ G+     E VPFRLT+++VH +GP G EG F+  C   L L+R Q++ ++ L +  LHDPL  W                                   +K   G S+ Q      +A+  + ++ ++  G + S        L+ EGHV+YLIQ A++ + L +M+ GW  YL
Sbjct: 1651 KINSIVSEHCANLAPYQFLTAFSQLISRVCHSSDEVFA-ALMNIVAKVFLAYPQQAMWLMAAVSKSS---------YHMRMNRCNQILKKAISL---------KPSLDKFIGDANRLTDKLLELCNKPVDGNSTTLSISVHFKQLKRLVEEPTFSQILIPLQSVLIP----TLPSTGGTNAKHDAFPGHWAYLDGFEVEILASLQKPKKISLRGSDGRSYTMMCKPKDDLRKDCRLMEFNCLINKCLRKH----------------AESRRRELHIRTYAVIPLNEECGIIEWVNNTAGLRHILT-------KLYKERVYLSGKELRKLILPKTAPFEEKLRIHKEVLCARHPPVFHEWFLRTFPDPT---SSRSAYCRSTAVMSMVGYVLGLGDRHGENILFDSFTGECVHVDFNCLFNKGETFDVPEVVPFRLTQNMVHAMGPMGTEGLFRQACEVTLRLMRDQREPLMVL-KTFLHDPLVEW-----------------------------------SKQTKGLSKTQVHETGEIAKTHVCDIEQRLLGVIKSRNKVLGLPLSIEGHVHYLIQEATDEKLLCQMYLGWGPYL 2160          
BLAST of Serine-protein kinase ATM vs. Ensembl Medaka
Match: mtor (mechanistic target of rapamycin kinase [Source:ZFIN;Acc:ZDB-GENE-030131-2974])

HSP 1 Score: 155.221 bits (391), Expect = 8.050e-38
Identity = 121/412 (29.37%), Postives = 201/412 (48.79%), Query Frame = 3
Query: 7224 PKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFH--------------FEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPT-QERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFD----NKSRPGSSQ------------------NQMAERVILEMSRKFAGAVDSSY---LNCEGHVNYLIQTASNVENLARMFHGW 8339
            P+ +    S+G +   L+K ++DLRQD  + Q+F +VN+LL N  +   K                 +SI+ Y VIP++  SG+I W    VP  D L        + YR         +K++ ++ E  I  R+    D LT ++ V  + H              + K P S+ WF  R +Y  SLA+ S+VG+ILGLGDRH  N++LD  + +++HIDFG  F++        E++PFRLTR L + +   G++G ++ TC  V+ +LR  +D ++ ++E  ++DPL +W+L   + +   TKR      + T+  S + +EG D       + G++                   N+ A ++I  +  K  G  D S+   L+    V  LI+ A++ ENL + + GW
Sbjct:  357 PRKLTIMGSNGHEFMFLLKGHEDLRQDERVMQLFGLVNTLLANDPASLRKN----------------LSIQRYAVIPLSTNSGLIGW----VPHCDTLH----ALIRDYRE--------KKKILLNIEHRIMLRMAPDYDHLTLMEKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHRDSVMAVLEAFVYDPLLNWRLMDSNTK--GTKRSRTRTDSYTAGQSVEALEGIDLGETTHKKAGTTVPESIHSFIGDGLVQPEALNKKAIQIINRVRDKLTGR-DFSHDETLDVPTQVELLIKQATSHENLCQCYIGW 733          
BLAST of Serine-protein kinase ATM vs. Ensembl Medaka
Match: prkdc (protein kinase, DNA-activated, catalytic subunit [Source:NCBI gene;Acc:101171206])

HSP 1 Score: 122.865 bits (307), Expect = 4.448e-27
Identity = 86/302 (28.48%), Postives = 141/302 (46.69%), Query Frame = 3
Query: 7176 IVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIK-KRIETFKDILTKIQPVLG-----YFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAF-DLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWK 8060
            I GFD+   +   +  PK +  +  D      LVK  +DLRQD  ++Q+FS++N +L N  +                   R + + TY+VIP+T T G+IEW E+T  L D++    T                        EEN + KR +   + L  +Q V       +      PE+  +   R  + +S A+  +  +ILG+GDRH+ N +++V T  +I IDFG AF    + +P  E +PFRLT+  V+ + P    G  ++     L   R++ D++L  ++V + +P   WK
Sbjct: 3589 ITGFDERVMVMSSMRHPKRLIIRGDDERDHPFLVKGGEDLRQDQRIEQLFSIMNIVLSNDTACV----------------QRGLQLHTYQVIPLT-TVGLIEWMENTCTLKDFVYKTMT-----------------------EEENKRAKRADAVNNFLKVLQHVPADLLRSFLRMCNSPEA--FLSLRSHFISSHALLCVSHWILGIGDRHLSNFMVNVETGGMIGIDFGHAFGSATQFLPVPELMPFRLTQQFVNLMQPLKESGLIQSIMVHSLRAYRAEPDLLLNTMDVFIKEPCLDWK 3848          
BLAST of Serine-protein kinase ATM vs. Ensembl Medaka
Match: pik3c2g (phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 gamma [Source:NCBI gene;Acc:105354205])

HSP 1 Score: 61.6178 bits (148), Expect = 1.294e-8
Identity = 65/261 (24.90%), Postives = 111/261 (42.53%), Query Frame = 3
Query: 7272 LVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMP--TQERVPFRLTRDLVHGLGPFG-VEGRFKT---TCCDVLNLLRSQKDIILTLIEVLL 8036
            + K+ DDL QD ++ Q+  V++S+   +G                 +  +MI   TY+ I + +  G++E   + V L         G   RY   DS                    +E +  +L K Q   GY             +A  ++ +S A   +  FILG+ DRH  NI+L  +T  + HIDFG      ++     ++R PF  T ++ H +   G    RF+     CC   N++R +  +IL+++E++L
Sbjct:  848 ICKTGDDLNQDMLVLQIVRVMDSVWLQEG-----------------LDLQMI---TYRCISIGKAQGLVEVVPEAVTLAKIHQQWGVGGALRY---DS--------------------LEKWFHMLNKTQD--GYD------------EAVMNFIHSCAGWCVATFILGICDRHNDNIMLK-STGHMFHIDFGKIMGNAQMFAGFKRDRTPFVFTSEMQHFITGGGKTPQRFQNFVELCCRAYNIIRGRSALILSMLELML 1050          
BLAST of Serine-protein kinase ATM vs. Ensembl Medaka
Match: pik3c3 (phosphatidylinositol 3-kinase catalytic subunit type 3 [Source:NCBI gene;Acc:101175027])

HSP 1 Score: 60.077 bits (144), Expect = 3.603e-8
Identity = 67/297 (22.56%), Postives = 120/297 (40.40%), Query Frame = 3
Query: 7191 DVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKT--GAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVE--GRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNP 8069
            D  +L     +P  +  ++ DG     + K  DDLRQD ++ Q+ S+++ LL  +                    N  + +  YKV+  +   G +++ + +VP+ + LA +       +++ P +  P        IS+E                                        +Y  S A   ++ +ILG+GDRH+ N+LL   T +L HIDFG  + LG+        P +L++++V G+G    E    F+  C      LR   ++IL L  +++   +    L P
Sbjct:  595 DTATLFKSALMPAKLIFKTEDGAMYPVIFKHGDDLRQDQLILQIISLMDKLLRKE--------------------NLDLKLTPYKVLATSSKHGFMQFVQ-SVPVAEVLATEGNIQSFFRKHAPSEKGPYG------ISSE-------------------------------------VMDTYVKSCAGYCVITYILGVGDRHLDNLLL-TKTGKLFHIDFG--YILGRDP-KPLPPPMKLSKEMVEGMGGMQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEP 823          
BLAST of Serine-protein kinase ATM vs. Planmine SMEST
Match: SMESG000023629.1 (SMESG000023629.1)

HSP 1 Score: 3980.64 bits (10322), Expect = 0.000e+0
Identity = 2053/2059 (99.71%), Postives = 2057/2059 (99.90%), Query Frame = 3
Query: 1275 MRMLEVGLNNSNFVVRCQSQIAQIVSAINVCLNITNLSASVYSHLLKIVPKLMDKNLSSDNFCCLFESVFRCLLSESQALESLVTDTVSVLISIVKTGLLTTLPEGFWSKLMSLLPNESLFSFVSHVILHFNTNQPYRVLISVEISVQLLNWLLSFVCLPTTSFSDLSLLITVLVNRKSQKADCYTKQQCFPNQHRFPSVSYENAIKSCLLKQCPDFYPRTPITEVLQLSINSLDQSGMNILLKTFEIVSLTDSTDWLIVIFRFFRCLDQIDNPTKFRENIPVLRKAILHLKSIATLNQDLSPFLVEGLHSIDWKHLSALGTKIPELSQHISIMTAAVKACLVTSVFSHFNLTNLQQFRNQSHCYLSIFPDNLNGFIERFFTSFKLYNTNHIDLLRVFIESIASFKIRIKPEIISNLLMIIKESFKMFKRNYRVYGNLIEICLNIISILSDSFEMDNQKDFINCFHDLSGTINKIYMSYFPECHSIGRXXXXXXXXXFGYYWNNNSRIDPAGLLQARLSGICEAVFSNFSNGKSFSARLSASVFMEEVFRIAHPVVDLLEFFMKNFPENPLLITELWNSAGTDDELLYSDQNRARISSFLLMWTYSLSSEYSRRDISKFGSSVLPFITGRIPDISCQKPKSLSDFLSILYSKRFTSTMDITDFITAIMFPFIDNWIDLLADSQQPIELPGRVTISQIVQNNLKEFLWIISSCSDNDNRRSMISSYFPSVFDESQTVIDNLPNLVARIVISLDNSSSRCAAAALDYLLSILSIYEIRKLLNENILETIWEILSHLWEISRSFERFDRISIVLFSEYLNLPMSLSEWLLSKSGRLIDLVMFIVGKYSTDDIQDSYPSIWCLIIDIILSSCDNWHHNTNINPINDQFIGFLIIRHIRLLEISSKNHDNNDLQLLTLLIRLVSFSHRNIEAPNLDVNIFWYQKAFYFIAECSEKYINHKXXXXXXXXXXXXXPVTKYGGNLDGFIYRISGFNSFPSIILLRPEIDGISSIRNILISFDKFGLIILEKKTKSFVLLSEFLYGLLQTERIDPSIGDLLQKLQDILHLFLVSKMEIFPSLKSPETSDAIISCLMYLKLLLPQYHISPNQQLAIVGKFDQDPVISDQIDLLYHLSIICLQDFGNRSWXXXXXXXXXXQSINTSKNRFLTDILSLFHLDXXXXXXXXXYEKNLDFPAILKFLENSIPFCSHTQWRCELTKMLAVRSSKPVYNRCHPELVSSVGSISFYCLPRIFATVEFSTEETRILSQVINRILHEQHYCESRKIVLVDCVVKKLEYIIIEEGNCRNNWEDIDFFKAAEVAYCGKMYTATLMLLDKLWLKESNAEMNAGIVNLYYKTFKSLASQEDLTADRFLIXXXXXXXXXXXXXXXXXXLLWLIKNGKFKVLHRLLKAEKNSDIFSFKPEAKIDILWKLTRWGDEEKLEINNLSQENVCSLAMYDFLYSRSEHVSEFYRNHVVDSCKISWDQEACFRPLIERATLFGNETSLPTILESLIRIANKSNIDQLDSSIVWALIRSNRFARNLEIVNQQLLGISDLAKRCKRHEYIDFIRDMLNLHEVDNSILKCSGESSLFRTIDIFSQKTETEETKKSFLQLEQFIYDSQKHILTCQQIKRNHDLFFKLYFKAVSKICAWNQEYPVHSVSHIRTKILEPAMGVFGKSLKQESDMLSTMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWDELNNLSQDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSENNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMNSRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVI 7451
            MRMLEVGLNNSNFVVRCQSQIAQIVSAINVCLNITNLSASVYSHLLKIVPKLMDKNLSSDNFCCLFESVFRCLLSESQALESLVTDTVSVLISIVKTGLLTTLPEGFWSKLMSLLPNESLFSFVSHVILHFNTNQPYRVLISVEISVQLLNWLLSFVCLPTTSFSDLSLLITVLVNRKSQKADCYTKQQCFPNQHRFPSVSYENAIKSCLLKQCPDFYPRTPITEVLQLSINSLDQSGMNILLKTFEIVSLTDSTDWLIVIFRFFRCLDQIDNPTKFRENIPVLRKAILHLKSIATLNQDLSPFLVEGLHSIDWKHLSALGTKIPELSQHISIMTAAVKACLVTSVFSHFNLTNLQQFRNQSHCYLSIFPDNLNGFIERFFTSFKLYNTNHIDLLRVFIESIASFKIRIKPEIISNLLMIIKESFKMFKRNYRVYGNLIEICLNIISILSDSFEMDNQKDFINCFHDLSGTINKIYMSYFPECHSIGRLLAKLLALLFGYYWNNNSRIDPAGLLQARLSGICEAVFSNFSNGKSFSARLSASVFMEEVFRIAHPVVDLLEFFMKNFPENPLLITELWNSAGTDDELLYSDQNRARISSFLLMWTYSLSSEYSRRDISKFGSSVLPFITGRIPDISCQKPKSLSDFLSILYSKRFTSTMDITDFITAIMFPFIDNWIDLLADSQQPIELPGRVTISQIVQNNLKEFLWIISSCSDNDNRRSMISSYFPSVFDESQTVIDNLPNLVARIVISLDNSSSRCAAAALDYLLSILSIYEIRKLLNENILETIWEILSHLWEISRS+ERFDRISIVLFSEYLNLPMSLSEWLLSKSGRLIDLVMFIVGKYSTDDIQDSYPSIWCLIIDIILSSCDNWHHNTNINPINDQFIGFLIIRHIRLLEISSKNHDNNDLQLLTLLIRL+SFSHRNIEAPNLDVNIFWYQKAFYFIAECSEKYINHKSIIDDIISELLSSPVTKYGGNLDGFIYRISGFNSFPSIILLRPEIDGISSIRNILISFDKFGLIILEKKTKSFVLLSEFLYGLLQTERIDPSIGDLLQKLQDILHLFLVSKMEIFPSLKSPETSDAIISCLMYLKLLLPQYHISPNQQLAIVGKFDQDPVISDQIDLLYHLSIICLQDFGNRSWCSYLSLCSLYQSINTSKNRFLTDILSLFHLDKNNKKINIIYEKNLDFPAILKFLENSIPFCSHTQWRCELTKMLAVRSSKPVYNRCHPELVSSVGSISFYCLPRIFATVEFSTEETRILSQVINRILHEQHYCESRKIVLVDCVVKKLEYIIIEEGNCRNNWEDIDFFKAAEVAYCGKMYTATLMLLDKLWLKESNAEMNAGIVNLYYKTFKSLASQEDLTADRFLIGSSSQYNDYGDGDGDSNDLLWLIKNGKFKVLHRLLKAEKNSDIFSFKPEAKIDILWKLTRWGDEEKLEINNLSQENVCSLAMYDFLYSRSEHVSEFYRNHVVDSCKISWDQE CFRPLIERATLFGNETSLPTILESLIRIANKSNIDQLDSSIVWALIRSNRFARNLEIVNQQLLGISDLAKRCKRHEYIDFIRDMLNLHE+DNSILKCSGESSLFRTIDIFSQKTETEETKKSFLQLEQFIYDSQKHILTCQQIKRNHDLFFKLYFKAVSKICAWNQEYPVHSVSHIRTKILEPAMGVFGKSLKQESDMLSTMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWDELNNLSQDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSENNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDSELEKSKSLKSIKEANDKMNSRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYK +
Sbjct:    1 MRMLEVGLNNSNFVVRCQSQIAQIVSAINVCLNITNLSASVYSHLLKIVPKLMDKNLSSDNFCCLFESVFRCLLSESQALESLVTDTVSVLISIVKTGLLTTLPEGFWSKLMSLLPNESLFSFVSHVILHFNTNQPYRVLISVEISVQLLNWLLSFVCLPTTSFSDLSLLITVLVNRKSQKADCYTKQQCFPNQHRFPSVSYENAIKSCLLKQCPDFYPRTPITEVLQLSINSLDQSGMNILLKTFEIVSLTDSTDWLIVIFRFFRCLDQIDNPTKFRENIPVLRKAILHLKSIATLNQDLSPFLVEGLHSIDWKHLSALGTKIPELSQHISIMTAAVKACLVTSVFSHFNLTNLQQFRNQSHCYLSIFPDNLNGFIERFFTSFKLYNTNHIDLLRVFIESIASFKIRIKPEIISNLLMIIKESFKMFKRNYRVYGNLIEICLNIISILSDSFEMDNQKDFINCFHDLSGTINKIYMSYFPECHSIGRLLAKLLALLFGYYWNNNSRIDPAGLLQARLSGICEAVFSNFSNGKSFSARLSASVFMEEVFRIAHPVVDLLEFFMKNFPENPLLITELWNSAGTDDELLYSDQNRARISSFLLMWTYSLSSEYSRRDISKFGSSVLPFITGRIPDISCQKPKSLSDFLSILYSKRFTSTMDITDFITAIMFPFIDNWIDLLADSQQPIELPGRVTISQIVQNNLKEFLWIISSCSDNDNRRSMISSYFPSVFDESQTVIDNLPNLVARIVISLDNSSSRCAAAALDYLLSILSIYEIRKLLNENILETIWEILSHLWEISRSYERFDRISIVLFSEYLNLPMSLSEWLLSKSGRLIDLVMFIVGKYSTDDIQDSYPSIWCLIIDIILSSCDNWHHNTNINPINDQFIGFLIIRHIRLLEISSKNHDNNDLQLLTLLIRLISFSHRNIEAPNLDVNIFWYQKAFYFIAECSEKYINHKSIIDDIISELLSSPVTKYGGNLDGFIYRISGFNSFPSIILLRPEIDGISSIRNILISFDKFGLIILEKKTKSFVLLSEFLYGLLQTERIDPSIGDLLQKLQDILHLFLVSKMEIFPSLKSPETSDAIISCLMYLKLLLPQYHISPNQQLAIVGKFDQDPVISDQIDLLYHLSIICLQDFGNRSWCSYLSLCSLYQSINTSKNRFLTDILSLFHLDKNNKKINIIYEKNLDFPAILKFLENSIPFCSHTQWRCELTKMLAVRSSKPVYNRCHPELVSSVGSISFYCLPRIFATVEFSTEETRILSQVINRILHEQHYCESRKIVLVDCVVKKLEYIIIEEGNCRNNWEDIDFFKAAEVAYCGKMYTATLMLLDKLWLKESNAEMNAGIVNLYYKTFKSLASQEDLTADRFLIGSSSQYNDYGDGDGDSNDLLWLIKNGKFKVLHRLLKAEKNSDIFSFKPEAKIDILWKLTRWGDEEKLEINNLSQENVCSLAMYDFLYSRSEHVSEFYRNHVVDSCKISWDQEVCFRPLIERATLFGNETSLPTILESLIRIANKSNIDQLDSSIVWALIRSNRFARNLEIVNQQLLGISDLAKRCKRHEYIDFIRDMLNLHEIDNSILKCSGESSLFRTIDIFSQKTETEETKKSFLQLEQFIYDSQKHILTCQQIKRNHDLFFKLYFKAVSKICAWNQEYPVHSVSHIRTKILEPAMGVFGKSLKQESDMLSTMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWDELNNLSQDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSENNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDSELEKSKSLKSIKEANDKMNSRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKFL 2059          
BLAST of Serine-protein kinase ATM vs. Planmine SMEST
Match: SMESG000023629.1 (SMESG000023629.1)

HSP 1 Score: 3977.17 bits (10313), Expect = 0.000e+0
Identity = 2051/2057 (99.71%), Postives = 2055/2057 (99.90%), Query Frame = 3
Query: 1281 MLEVGLNNSNFVVRCQSQIAQIVSAINVCLNITNLSASVYSHLLKIVPKLMDKNLSSDNFCCLFESVFRCLLSESQALESLVTDTVSVLISIVKTGLLTTLPEGFWSKLMSLLPNESLFSFVSHVILHFNTNQPYRVLISVEISVQLLNWLLSFVCLPTTSFSDLSLLITVLVNRKSQKADCYTKQQCFPNQHRFPSVSYENAIKSCLLKQCPDFYPRTPITEVLQLSINSLDQSGMNILLKTFEIVSLTDSTDWLIVIFRFFRCLDQIDNPTKFRENIPVLRKAILHLKSIATLNQDLSPFLVEGLHSIDWKHLSALGTKIPELSQHISIMTAAVKACLVTSVFSHFNLTNLQQFRNQSHCYLSIFPDNLNGFIERFFTSFKLYNTNHIDLLRVFIESIASFKIRIKPEIISNLLMIIKESFKMFKRNYRVYGNLIEICLNIISILSDSFEMDNQKDFINCFHDLSGTINKIYMSYFPECHSIGRXXXXXXXXXFGYYWNNNSRIDPAGLLQARLSGICEAVFSNFSNGKSFSARLSASVFMEEVFRIAHPVVDLLEFFMKNFPENPLLITELWNSAGTDDELLYSDQNRARISSFLLMWTYSLSSEYSRRDISKFGSSVLPFITGRIPDISCQKPKSLSDFLSILYSKRFTSTMDITDFITAIMFPFIDNWIDLLADSQQPIELPGRVTISQIVQNNLKEFLWIISSCSDNDNRRSMISSYFPSVFDESQTVIDNLPNLVARIVISLDNSSSRCAAAALDYLLSILSIYEIRKLLNENILETIWEILSHLWEISRSFERFDRISIVLFSEYLNLPMSLSEWLLSKSGRLIDLVMFIVGKYSTDDIQDSYPSIWCLIIDIILSSCDNWHHNTNINPINDQFIGFLIIRHIRLLEISSKNHDNNDLQLLTLLIRLVSFSHRNIEAPNLDVNIFWYQKAFYFIAECSEKYINHKXXXXXXXXXXXXXPVTKYGGNLDGFIYRISGFNSFPSIILLRPEIDGISSIRNILISFDKFGLIILEKKTKSFVLLSEFLYGLLQTERIDPSIGDLLQKLQDILHLFLVSKMEIFPSLKSPETSDAIISCLMYLKLLLPQYHISPNQQLAIVGKFDQDPVISDQIDLLYHLSIICLQDFGNRSWXXXXXXXXXXQSINTSKNRFLTDILSLFHLDXXXXXXXXXYEKNLDFPAILKFLENSIPFCSHTQWRCELTKMLAVRSSKPVYNRCHPELVSSVGSISFYCLPRIFATVEFSTEETRILSQVINRILHEQHYCESRKIVLVDCVVKKLEYIIIEEGNCRNNWEDIDFFKAAEVAYCGKMYTATLMLLDKLWLKESNAEMNAGIVNLYYKTFKSLASQEDLTADRFLIXXXXXXXXXXXXXXXXXXLLWLIKNGKFKVLHRLLKAEKNSDIFSFKPEAKIDILWKLTRWGDEEKLEINNLSQENVCSLAMYDFLYSRSEHVSEFYRNHVVDSCKISWDQEACFRPLIERATLFGNETSLPTILESLIRIANKSNIDQLDSSIVWALIRSNRFARNLEIVNQQLLGISDLAKRCKRHEYIDFIRDMLNLHEVDNSILKCSGESSLFRTIDIFSQKTETEETKKSFLQLEQFIYDSQKHILTCQQIKRNHDLFFKLYFKAVSKICAWNQEYPVHSVSHIRTKILEPAMGVFGKSLKQESDMLSTMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWDELNNLSQDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSENNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDXXXXXXXXXXXXXXANDKMNSRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVI 7451
            MLEVGLNNSNFVVRCQSQIAQIVSAINVCLNITNLSASVYSHLLKIVPKLMDKNLSSDNFCCLFESVFRCLLSESQALESLVTDTVSVLISIVKTGLLTTLPEGFWSKLMSLLPNESLFSFVSHVILHFNTNQPYRVLISVEISVQLLNWLLSFVCLPTTSFSDLSLLITVLVNRKSQKADCYTKQQCFPNQHRFPSVSYENAIKSCLLKQCPDFYPRTPITEVLQLSINSLDQSGMNILLKTFEIVSLTDSTDWLIVIFRFFRCLDQIDNPTKFRENIPVLRKAILHLKSIATLNQDLSPFLVEGLHSIDWKHLSALGTKIPELSQHISIMTAAVKACLVTSVFSHFNLTNLQQFRNQSHCYLSIFPDNLNGFIERFFTSFKLYNTNHIDLLRVFIESIASFKIRIKPEIISNLLMIIKESFKMFKRNYRVYGNLIEICLNIISILSDSFEMDNQKDFINCFHDLSGTINKIYMSYFPECHSIGRLLAKLLALLFGYYWNNNSRIDPAGLLQARLSGICEAVFSNFSNGKSFSARLSASVFMEEVFRIAHPVVDLLEFFMKNFPENPLLITELWNSAGTDDELLYSDQNRARISSFLLMWTYSLSSEYSRRDISKFGSSVLPFITGRIPDISCQKPKSLSDFLSILYSKRFTSTMDITDFITAIMFPFIDNWIDLLADSQQPIELPGRVTISQIVQNNLKEFLWIISSCSDNDNRRSMISSYFPSVFDESQTVIDNLPNLVARIVISLDNSSSRCAAAALDYLLSILSIYEIRKLLNENILETIWEILSHLWEISRS+ERFDRISIVLFSEYLNLPMSLSEWLLSKSGRLIDLVMFIVGKYSTDDIQDSYPSIWCLIIDIILSSCDNWHHNTNINPINDQFIGFLIIRHIRLLEISSKNHDNNDLQLLTLLIRL+SFSHRNIEAPNLDVNIFWYQKAFYFIAECSEKYINHKSIIDDIISELLSSPVTKYGGNLDGFIYRISGFNSFPSIILLRPEIDGISSIRNILISFDKFGLIILEKKTKSFVLLSEFLYGLLQTERIDPSIGDLLQKLQDILHLFLVSKMEIFPSLKSPETSDAIISCLMYLKLLLPQYHISPNQQLAIVGKFDQDPVISDQIDLLYHLSIICLQDFGNRSWCSYLSLCSLYQSINTSKNRFLTDILSLFHLDKNNKKINIIYEKNLDFPAILKFLENSIPFCSHTQWRCELTKMLAVRSSKPVYNRCHPELVSSVGSISFYCLPRIFATVEFSTEETRILSQVINRILHEQHYCESRKIVLVDCVVKKLEYIIIEEGNCRNNWEDIDFFKAAEVAYCGKMYTATLMLLDKLWLKESNAEMNAGIVNLYYKTFKSLASQEDLTADRFLIGSSSQYNDYGDGDGDSNDLLWLIKNGKFKVLHRLLKAEKNSDIFSFKPEAKIDILWKLTRWGDEEKLEINNLSQENVCSLAMYDFLYSRSEHVSEFYRNHVVDSCKISWDQE CFRPLIERATLFGNETSLPTILESLIRIANKSNIDQLDSSIVWALIRSNRFARNLEIVNQQLLGISDLAKRCKRHEYIDFIRDMLNLHE+DNSILKCSGESSLFRTIDIFSQKTETEETKKSFLQLEQFIYDSQKHILTCQQIKRNHDLFFKLYFKAVSKICAWNQEYPVHSVSHIRTKILEPAMGVFGKSLKQESDMLSTMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWDELNNLSQDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSENNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDSELEKSKSLKSIKEANDKMNSRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYK +
Sbjct:    1 MLEVGLNNSNFVVRCQSQIAQIVSAINVCLNITNLSASVYSHLLKIVPKLMDKNLSSDNFCCLFESVFRCLLSESQALESLVTDTVSVLISIVKTGLLTTLPEGFWSKLMSLLPNESLFSFVSHVILHFNTNQPYRVLISVEISVQLLNWLLSFVCLPTTSFSDLSLLITVLVNRKSQKADCYTKQQCFPNQHRFPSVSYENAIKSCLLKQCPDFYPRTPITEVLQLSINSLDQSGMNILLKTFEIVSLTDSTDWLIVIFRFFRCLDQIDNPTKFRENIPVLRKAILHLKSIATLNQDLSPFLVEGLHSIDWKHLSALGTKIPELSQHISIMTAAVKACLVTSVFSHFNLTNLQQFRNQSHCYLSIFPDNLNGFIERFFTSFKLYNTNHIDLLRVFIESIASFKIRIKPEIISNLLMIIKESFKMFKRNYRVYGNLIEICLNIISILSDSFEMDNQKDFINCFHDLSGTINKIYMSYFPECHSIGRLLAKLLALLFGYYWNNNSRIDPAGLLQARLSGICEAVFSNFSNGKSFSARLSASVFMEEVFRIAHPVVDLLEFFMKNFPENPLLITELWNSAGTDDELLYSDQNRARISSFLLMWTYSLSSEYSRRDISKFGSSVLPFITGRIPDISCQKPKSLSDFLSILYSKRFTSTMDITDFITAIMFPFIDNWIDLLADSQQPIELPGRVTISQIVQNNLKEFLWIISSCSDNDNRRSMISSYFPSVFDESQTVIDNLPNLVARIVISLDNSSSRCAAAALDYLLSILSIYEIRKLLNENILETIWEILSHLWEISRSYERFDRISIVLFSEYLNLPMSLSEWLLSKSGRLIDLVMFIVGKYSTDDIQDSYPSIWCLIIDIILSSCDNWHHNTNINPINDQFIGFLIIRHIRLLEISSKNHDNNDLQLLTLLIRLISFSHRNIEAPNLDVNIFWYQKAFYFIAECSEKYINHKSIIDDIISELLSSPVTKYGGNLDGFIYRISGFNSFPSIILLRPEIDGISSIRNILISFDKFGLIILEKKTKSFVLLSEFLYGLLQTERIDPSIGDLLQKLQDILHLFLVSKMEIFPSLKSPETSDAIISCLMYLKLLLPQYHISPNQQLAIVGKFDQDPVISDQIDLLYHLSIICLQDFGNRSWCSYLSLCSLYQSINTSKNRFLTDILSLFHLDKNNKKINIIYEKNLDFPAILKFLENSIPFCSHTQWRCELTKMLAVRSSKPVYNRCHPELVSSVGSISFYCLPRIFATVEFSTEETRILSQVINRILHEQHYCESRKIVLVDCVVKKLEYIIIEEGNCRNNWEDIDFFKAAEVAYCGKMYTATLMLLDKLWLKESNAEMNAGIVNLYYKTFKSLASQEDLTADRFLIGSSSQYNDYGDGDGDSNDLLWLIKNGKFKVLHRLLKAEKNSDIFSFKPEAKIDILWKLTRWGDEEKLEINNLSQENVCSLAMYDFLYSRSEHVSEFYRNHVVDSCKISWDQEVCFRPLIERATLFGNETSLPTILESLIRIANKSNIDQLDSSIVWALIRSNRFARNLEIVNQQLLGISDLAKRCKRHEYIDFIRDMLNLHEIDNSILKCSGESSLFRTIDIFSQKTETEETKKSFLQLEQFIYDSQKHILTCQQIKRNHDLFFKLYFKAVSKICAWNQEYPVHSVSHIRTKILEPAMGVFGKSLKQESDMLSTMSTFSYQQYTHINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDWDELNNLSQDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEKLNNIISDVIGKIETHKFLVLMPQLCARLNSENNKSFEINLEKLIKRIILDHPFHSIYNLLAIRNANRDSELEKSKSLKSIKEANDKMNSRISVAYTMVEQLVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRIAKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKFL 2057          
BLAST of Serine-protein kinase ATM vs. Planmine SMEST
Match: SMESG000023630.1 (SMESG000023630.1)

HSP 1 Score: 525.783 bits (1353), Expect = 9.913e-171
Identity = 258/259 (99.61%), Postives = 258/259 (99.61%), Query Frame = 3
Query:   42 MESGRDVMTMFDITNIPKTKENIEKRLSLIKDSFLTFDSRGNVNDEYFNLKTHFDWYPFCQFLIKISMSFFELIVKKKSATTDLYKTPMNKKILDDIVYIYHFTLNNIDPENMNMDINGLLNNALNLTHQMVSTNLDMVQRFVNLIFTETIFDDKFAIVGEINIQFWEKAERFLCTLILNMRESDSQKSTLFLKSVFLIYKAMTPFKYPDLVLIIRTINHITSWNFCQNDKLALDIHGYISAIINQLILTVGTDAIKCL 818
            MESGRDVMTMFDITNIPKTKENIEKRLSLIKDSFLTFDSRGNVNDEYFNLKTHFDWYPFCQFLIKISMSFFELIVKKKSATTDLYKTPMNKKILDDIVYIYHFTLNNIDPENMNMDINGLLNNALNLTHQMVSTNLDMVQRFVNLIFTETIFDDKFAIVGEINIQFWEKAERFLCTLILNMRESDSQKSTLFLKSVFLIYKAMTPFKYPDLVLIIRTINHITSWNFCQNDKLALDIHGYISAIINQLILTVGTDAIK L
Sbjct:    1 MESGRDVMTMFDITNIPKTKENIEKRLSLIKDSFLTFDSRGNVNDEYFNLKTHFDWYPFCQFLIKISMSFFELIVKKKSATTDLYKTPMNKKILDDIVYIYHFTLNNIDPENMNMDINGLLNNALNLTHQMVSTNLDMVQRFVNLIFTETIFDDKFAIVGEINIQFWEKAERFLCTLILNMRESDSQKSTLFLKSVFLIYKAMTPFKYPDLVLIIRTINHITSWNFCQNDKLALDIHGYISAIINQLILTVGTDAIKYL 259          
BLAST of Serine-protein kinase ATM vs. Planmine SMEST
Match: SMESG000023628.1 (SMESG000023628.1)

HSP 1 Score: 317.39 bits (812), Expect = 1.561e-99
Identity = 159/159 (100.00%), Postives = 159/159 (100.00%), Query Frame = 3
Query: 7875 MPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            MPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCNNTSNTSSKTIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL
Sbjct:    1 MPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCNNTSNTSSKTIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 159          
BLAST of Serine-protein kinase ATM vs. Planmine SMEST
Match: SMESG000018015.1 (SMESG000018015.1)

HSP 1 Score: 174.866 bits (442), Expect = 3.503e-43
Identity = 115/376 (30.59%), Postives = 185/376 (49.20%), Query Frame = 3
Query: 7227 KIVWCQSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKSSDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAHQRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEKFPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHIDFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGV-EGRFKTTCCDVLNLLRSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCXXXXXXXXXXIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLIQTASNVENLARMFHGWQAYL 8351
            K++W   +DG K   +VK  DDLR+D  + ++  + N L+       +                R++ IRTY V P+ + SG+IEW  +T      + +      QR  P     L  R   +  + E  KK ++  K++L     V   +  +KFPE   W+++ + Y  S+A+ S+VG+ILGLGDRH++NIL D  + +++HID+   F+ GK +   E VPFRLTR++  GLGP G   G F+++C   LNLLR++ + I+ + + + +D L   K +P                                KS   S+   M E  + EM  +  G V+   L+ EG VNYLI  A + + L +M+ GW +++
Sbjct: 1062 KMIWI-GTDGKKYIMIVKPKDDLRRDCRIMELNGMFNRLMRRNSETRH----------------RLLYIRTYAVTPLGEKSGLIEWVNNTESFRQVVVDLHI---QRNNPIIWQKLHARYAQRGDSFE--KKLMKFTKEVLPLYPVVFNKWFLQKFPEPNAWYRSVQKYCRSVAVMSMVGYILGLGDRHIENILFDHTSGDVVHIDYNCLFNHGKTLEWPEVVPFRLTRNMQDGLGPCGENNGLFRSSCVATLNLLRNEIEPIMAVFKPMYYDTLTEVK-DPLI------------------------------KSNKQSNAVTMTENKLEEMENRLKGKVNQLPLSVEGEVNYLIAQAIDEKLLCQMYMGWGSFI 1384          
The following BLAST results are available for this feature:
BLAST of Serine-protein kinase ATM vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATM2.411e-13633.86ATM serine/threonine kinase [Source:HGNC Symbol;Ac... [more]
ATM2.411e-13633.86ATM serine/threonine kinase [Source:HGNC Symbol;Ac... [more]
ATR3.884e-5325.80ATR serine/threonine kinase [Source:HGNC Symbol;Ac... [more]
ATR4.216e-5325.80ATR serine/threonine kinase [Source:HGNC Symbol;Ac... [more]
ATR3.150e-4726.57ATR serine/threonine kinase [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Serine-protein kinase ATM vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atm-12.091e-4124.02Serine/threonine-protein kinase ATM [Source:UniPr... [more]
atm-12.464e-4124.02Serine/threonine-protein kinase ATM [Source:UniPr... [more]
let-3632.427e-3431.71Target of rapamycin homolog [Source:UniProtKB/Swi... [more]
let-3632.428e-3431.71Target of rapamycin homolog [Source:UniProtKB/Swi... [more]
smg-13.512e-2829.18Serine/threonine-protein kinase smg-1 [Source:Uni... [more]
back to top
BLAST of Serine-protein kinase ATM vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tefu3.242e-9232.33gene:FBgn0045035 transcript:FBtr0110874[more]
mei-411.122e-4124.75gene:FBgn0004367 transcript:FBtr0074271[more]
Tor3.837e-3928.23gene:FBgn0021796 transcript:FBtr0080422[more]
Tor3.870e-3928.23gene:FBgn0021796 transcript:FBtr0336615[more]
nonC6.910e-2826.37gene:FBgn0263968 transcript:FBtr0070972[more]
back to top
BLAST of Serine-protein kinase ATM vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atm3.262e-13336.41ATM serine/threonine kinase [Source:ZFIN;Acc:ZDB-G... [more]
atm7.599e-13336.41ATM serine/threonine kinase [Source:ZFIN;Acc:ZDB-G... [more]
atr2.052e-5526.73ATR serine/threonine kinase [Source:ZFIN;Acc:ZDB-G... [more]
AL844179.12.328e-3729.47pep chromosome:GRCz11:CHR_ALT_CTG8_1_27:46082265:4... [more]
mtor4.493e-3729.37mechanistic target of rapamycin kinase [Source:ZFI... [more]
back to top
BLAST of Serine-protein kinase ATM vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATM5.704e-13837.93ATM serine/threonine kinase [Source:NCBI gene;Acc:... [more]
ATM6.327e-13837.93ATM serine/threonine kinase [Source:NCBI gene;Acc:... [more]
ATM6.468e-13837.93ATM serine/threonine kinase [Source:NCBI gene;Acc:... [more]
ATM7.328e-13837.93ATM serine/threonine kinase [Source:NCBI gene;Acc:... [more]
ATM7.502e-13837.93ATM serine/threonine kinase [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Serine-protein kinase ATM vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atm6.564e-13637.00ataxia telangiectasia mutated [Source:MGI Symbol;A... [more]
Atm7.414e-13637.00ataxia telangiectasia mutated [Source:MGI Symbol;A... [more]
Atr2.820e-5325.93ataxia telangiectasia and Rad3 related [Source:MGI... [more]
Atr2.864e-5325.93ataxia telangiectasia and Rad3 related [Source:MGI... [more]
Mtor1.855e-3629.68mechanistic target of rapamycin kinase [Source:MGI... [more]
back to top
BLAST of Serine-protein kinase ATM vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6PQD5|ATM_PIG9.063e-13732.69Serine-protein kinase ATM OS=Sus scrofa OX=9823 GN... [more]
sp|Q13315|ATM_HUMAN1.158e-13533.86Serine-protein kinase ATM OS=Homo sapiens OX=9606 ... [more]
sp|Q62388|ATM_MOUSE5.186e-13537.00Serine-protein kinase ATM OS=Mus musculus OX=10090... [more]
sp|Q9M3G7|ATM_ARATH6.664e-10634.98Serine/threonine-protein kinase ATM OS=Arabidopsis... [more]
sp|Q5EAK6|ATM_DROME3.249e-9132.33Serine/threonine-protein kinase ATM OS=Drosophila ... [more]
back to top
BLAST of Serine-protein kinase ATM vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
M1EFK01.992e-14437.09Ataxia telangiectasia mutated (Fragment) OS=Mustel... [more]
Q6NX744.589e-14437.00Atm protein (Fragment) OS=Mus musculus OX=10090 GN... [more]
S4RPL83.193e-14336.15Uncharacterized protein OS=Petromyzon marinus OX=7... [more]
A0A2Y9RMH11.061e-14238.55serine-protein kinase ATM-like OS=Trichechus manat... [more]
A0A5K4FBY73.066e-14235.87Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Serine-protein kinase ATM vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atm9.010e-13737.79ATM serine/threonine kinase [Source:ZFIN;Acc:ZDB-G... [more]
atm2.047e-13637.79ATM serine/threonine kinase [Source:ZFIN;Acc:ZDB-G... [more]
atr4.430e-5226.15ATR serine/threonine kinase [Source:ZFIN;Acc:ZDB-G... [more]
mtor1.001e-3729.85mechanistic target of rapamycin kinase [Source:NCB... [more]
smg12.499e-3227.89SMG1 nonsense mediated mRNA decay associated PI3K ... [more]
back to top
BLAST of Serine-protein kinase ATM vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007186.12.454e-14736.15pep scaffold:Pmarinus_7.0:GL476459:175296:202639:-... [more]
ENSPMAT00000003429.14.662e-4624.33pep scaffold:Pmarinus_7.0:GL476508:503342:564700:-... [more]
ENSPMAT00000003412.15.365e-4624.33pep scaffold:Pmarinus_7.0:GL476508:503342:564700:-... [more]
ENSPMAT00000003421.16.548e-4624.33pep scaffold:Pmarinus_7.0:GL476508:503342:564700:-... [more]
ENSPMAT00000010422.12.142e-1024.42pep scaffold:Pmarinus_7.0:GL478779:2292:46075:1 ge... [more]
back to top
BLAST of Serine-protein kinase ATM vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TEL14.468e-7332.01Protein kinase primarily involved in telomere leng... [more]
TOR22.040e-3928.64PIK-related protein kinase and rapamycin target; s... [more]
MEC17.377e-3824.01Genome integrity checkpoint protein and PI kinase ... [more]
TOR11.222e-3729.88PIK-related protein kinase and rapamycin target; s... [more]
PIK12.000e-930.89Phosphatidylinositol 4-kinase; catalyzes first ste... [more]
back to top
BLAST of Serine-protein kinase ATM vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO364042.381e-13135.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449771.899e-3928.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO292176.301e-3934.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484372.035e-3028.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO342804.082e-3025.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine-protein kinase ATM vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atr8.628e-4524.71ATR serine/threonine kinase [Source:NCBI gene;Acc:... [more]
mtor8.050e-3829.37mechanistic target of rapamycin kinase [Source:ZFI... [more]
prkdc4.448e-2728.48protein kinase, DNA-activated, catalytic subunit [... [more]
pik3c2g1.294e-824.90phosphatidylinositol-4-phosphate 3-kinase catalyti... [more]
pik3c33.603e-822.56phosphatidylinositol 3-kinase catalytic subunit ty... [more]
back to top
BLAST of Serine-protein kinase ATM vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023629.10.000e+099.71SMESG000023629.1[more]
SMESG000023629.10.000e+099.71SMESG000023629.1[more]
SMESG000023630.19.913e-17199.61SMESG000023630.1[more]
SMESG000023628.11.561e-99100.00SMESG000023628.1[more]
SMESG000018015.13.503e-4330.59SMESG000018015.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019647 ID=SMED30019647|Name=Serine-protein kinase ATM|organism=Schmidtea mediterranea sexual|type=transcript|length=8400bp
TGAATTTCTAAAGCACGCTTTGTTTTTGAATTTGAATTAAAATGGAATCT
GGGAGAGATGTTATGACCATGTTTGACATTACCAATATTCCGAAAACTAA
GGAAAATATAGAAAAAAGATTAAGTTTAATTAAAGATTCTTTTCTTACAT
TTGATTCTCGTGGAAACGTTAATGATGAATACTTTAATTTGAAAACTCAC
TTTGATTGGTATCCATTTTGCCAATTTTTAATTAAAATTTCGATGAGCTT
TTTTGAATTAATTGTTAAAAAGAAATCAGCAACAACTGATTTGTATAAAA
CTCCAATGAATAAAAAAATTTTGGATGATATTGTTTATATCTATCATTTT
ACACTAAATAATATAGATCCCGAAAATATGAACATGGACATTAATGGCTT
GTTAAATAATGCTTTAAATTTAACACATCAAATGGTTTCAACGAATTTAG
ATATGGTTCAGCGGTTTGTTAACTTAATATTCACTGAAACTATTTTCGAT
GATAAATTTGCTATCGTGGGTGAGATCAATATCCAATTTTGGGAAAAAGC
CGAAAGGTTTTTGTGTACACTTATATTAAACATGCGTGAATCTGACTCTC
AGAAATCAACTCTTTTTTTAAAGAGTGTTTTTTTAATTTATAAGGCAATG
ACTCCGTTTAAATATCCTGATTTGGTCTTAATCATTCGTACTATCAATCA
TATCACTAGCTGGAATTTTTGTCAAAATGATAAATTGGCATTGGATATTC
ATGGATATATATCAGCAATAATAAATCAGTTGATTCTAACAGTTGGAACT
GATGCTATTAAATGTTTGGTCAACATTTGTGTAACGATTTCCAATAAGTA
TTCGTTAAAGATTTGGATGGATAATGGGAAGAGCCATTCTTTGATTCAAG
ATCCGAATGTAAATACCGGCATAAATAGTCGACTAGAAATCGTAAAAATG
TGGAATAATATCTATGGATTAATAGGAGAAATCGATGACGGTTTCAATGA
ACCGAGTATTTTACTGTGGTTGAAGGAAGTCACGAGTTGTATAAAAAGGG
AGATTGAATATACTGAATCCAGATCTAAGTTCATAAGATATGAACATTGT
GTTCCAGATTATATATTTTATGATTTGGCAATAAAGCTGATCAGTAGATC
TGAGAATGAGAATGATAATGACGAGGTTGGCAGGCAGGCACCGAAACATG
TAAAATCGATTACTCTCATTGATAAAATCGTTGATAATCTGAATTCCGAT
TTGAGTTGTCGACAAATTTTCTGGATGCGAATGTTGGAAGTCGGATTAAA
TAACAGTAATTTCGTTGTTCGCTGCCAATCGCAAATAGCCCAGATCGTTT
CTGCTATAAATGTTTGCTTAAACATTACAAATCTCAGTGCTTCAGTTTAC
AGTCACTTACTGAAAATTGTTCCAAAATTGATGGACAAAAATTTGAGCTC
AGACAATTTTTGTTGTCTCTTTGAAAGCGTTTTCAGGTGTTTATTAAGTG
AATCTCAAGCGTTAGAGTCCCTGGTAACTGATACAGTATCTGTGCTCATC
TCTATCGTCAAGACCGGTCTGCTAACAACTTTACCAGAAGGGTTTTGGAG
TAAATTAATGTCCCTGCTCCCGAATGAATCGCTATTCTCTTTCGTTTCTC
ACGTAATCTTGCATTTCAACACAAATCAGCCTTACAGAGTGCTGATAAGT
GTTGAAATCTCTGTCCAATTATTAAACTGGCTCCTTTCGTTTGTCTGTCT
TCCAACAACATCGTTTTCTGATTTATCCCTACTGATAACTGTCCTAGTAA
ATCGTAAGTCTCAGAAAGCCGATTGTTATACAAAACAGCAATGTTTTCCA
AATCAACATAGGTTTCCATCGGTCTCCTACGAGAATGCAATTAAATCTTG
CCTTCTTAAGCAATGTCCCGATTTCTATCCACGAACACCAATCACTGAAG
TGCTGCAGCTATCAATTAATTCTCTCGACCAATCGGGAATGAATATTTTG
CTAAAAACTTTCGAAATCGTTTCATTAACCGATTCAACGGACTGGCTCAT
AGTGATTTTTCGTTTTTTCCGTTGCCTTGATCAAATCGATAATCCAACGA
AATTCCGTGAAAACATTCCTGTATTGAGAAAAGCTATTTTACACTTGAAA
AGTATTGCCACGCTTAATCAAGATTTATCGCCATTCCTCGTGGAAGGATT
GCATAGTATCGATTGGAAACATTTGAGTGCACTCGGGACTAAAATCCCGG
AATTATCGCAACATATTTCAATAATGACTGCAGCTGTAAAGGCTTGCCTT
GTGACAAGTGTATTTTCCCATTTCAACCTGACAAACCTACAGCAGTTCCG
CAATCAATCTCATTGTTATTTATCGATTTTCCCAGATAATTTAAATGGGT
TTATCGAAAGATTTTTCACCTCATTTAAGCTTTACAACACCAATCACATC
GATCTTTTGAGGGTGTTCATAGAATCGATCGCTAGCTTTAAAATCCGAAT
AAAACCCGAAATAATATCGAATCTATTGATGATTATTAAAGAATCGTTTA
AGATGTTCAAAAGAAATTACCGAGTTTATGGGAATCTGATTGAAATTTGC
TTGAATATTATCAGCATTCTTTCTGATTCATTTGAGATGGATAATCAGAA
AGATTTTATCAATTGTTTCCACGATCTCAGCGGCACAATCAATAAGATCT
ATATGAGCTATTTCCCCGAATGTCATTCAATAGGAAGGCTGTTGGCAAAA
TTACTGGCTTTACTGTTCGGATATTACTGGAATAATAATAGCCGCATCGA
TCCCGCCGGATTACTCCAGGCGCGATTATCCGGTATTTGTGAGGCAGTTT
TCTCCAATTTCTCCAATGGCAAATCATTTTCTGCCCGGCTTTCCGCAAGT
GTCTTTATGGAGGAGGTTTTCAGAATTGCTCACCCTGTCGTCGATTTGTT
GGAGTTTTTCATGAAGAATTTCCCCGAGAATCCCCTGCTGATTACGGAAC
TCTGGAACTCTGCTGGAACCGATGATGAGTTATTGTACAGCGATCAAAAT
CGAGCGAGAATTTCTTCCTTTCTACTGATGTGGACTTACTCATTGAGCTC
CGAATATAGTCGTCGCGATATCTCCAAATTCGGTTCATCGGTACTGCCTT
TCATTACCGGCCGCATTCCCGACATTTCCTGCCAGAAGCCGAAATCCTTA
TCGGATTTCCTGTCGATCTTGTACAGTAAACGTTTCACTAGCACAATGGA
TATTACCGATTTCATTACGGCGATCATGTTTCCATTTATCGATAATTGGA
TCGATTTGCTAGCCGATTCTCAACAGCCAATCGAATTGCCGGGAAGAGTC
ACGATTTCACAAATCGTTCAAAATAATCTCAAAGAATTTCTTTGGATAAT
TTCCTCGTGTTCCGATAATGATAACCGCAGATCAATGATATCGAGTTATT
TCCCGTCGGTATTTGATGAGTCTCAAACGGTTATCGATAATCTCCCGAAT
CTCGTTGCCCGCATTGTGATATCATTGGACAATTCATCATCGAGATGTGC
TGCTGCTGCATTGGATTATCTTTTATCGATATTATCGATTTATGAGATTC
GCAAACTCCTCAACGAGAATATCCTAGAAACAATCTGGGAGATTCTTTCA
CATTTATGGGAAATATCACGGAGTTTCGAAAGATTCGATAGAATATCGAT
TGTGTTGTTCTCGGAGTATTTGAATTTACCGATGAGTCTATCAGAGTGGC
TGCTATCGAAATCTGGGCGATTGATCGATCTAGTGATGTTCATAGTCGGG
AAATACAGCACTGACGACATCCAGGATAGCTACCCGAGCATTTGGTGCTT
AATTATCGATATCATTCTATCATCCTGTGATAATTGGCACCACAATACCA
ATATTAATCCAATCAATGATCAATTTATCGGTTTCCTCATAATTAGGCAC
ATCAGACTGCTGGAAATCTCCTCGAAAAACCACGATAATAACGATTTGCA
ATTATTGACGCTATTGATTAGATTGGTTTCCTTTTCCCATCGGAACATTG
AAGCCCCCAATCTCGATGTTAATATATTCTGGTATCAAAAGGCCTTTTAT
TTCATTGCCGAATGCTCAGAAAAATACATCAATCACAAATCGATAATCGA
TGATATAATATCTGAGCTGTTGTCGTCTCCGGTAACGAAATACGGTGGTA
ACCTCGATGGGTTTATTTACAGGATTTCCGGATTCAACAGTTTCCCGTCG
ATAATTCTCCTCCGCCCGGAAATCGATGGGATTTCCTCAATCAGAAATAT
TCTCATTTCCTTCGATAAGTTCGGATTGATAATTCTCGAAAAAAAAACCA
AATCATTCGTGTTATTGTCGGAGTTTTTGTACGGCCTCCTACAAACAGAA
CGAATTGATCCATCGATCGGGGATCTGTTACAGAAACTGCAGGATATTCT
CCATTTGTTTCTCGTATCGAAAATGGAAATATTTCCCTCGCTGAAATCCC
CCGAAACATCGGATGCGATTATATCGTGCTTGATGTATTTGAAATTGCTT
CTGCCACAGTATCACATTTCCCCCAATCAGCAGCTGGCTATTGTCGGGAA
ATTCGATCAAGATCCCGTGATTTCCGATCAAATCGATTTACTCTATCATC
TTTCAATCATTTGTCTTCAGGATTTCGGTAATCGTTCCTGGTGTTCCTAT
TTATCTTTATGTTCGCTATATCAATCAATAAACACGTCGAAAAACCGATT
TCTCACTGATATTCTATCTCTATTTCATCTGGATAAAAACAACAAAAAAA
TCAATATTATCTATGAGAAAAATCTCGATTTTCCAGCAATATTGAAATTT
CTCGAAAACTCGATTCCATTCTGCTCTCATACCCAGTGGAGATGTGAATT
GACGAAAATGCTAGCAGTTCGCAGCTCGAAACCCGTTTACAATCGTTGCC
ATCCCGAACTTGTCAGTTCAGTAGGGTCGATCTCGTTTTATTGTCTTCCT
CGAATATTTGCCACTGTCGAATTCTCCACAGAGGAAACTCGGATTTTGTC
TCAGGTGATAAATAGAATTCTCCACGAGCAACATTATTGCGAAAGTCGAA
AAATTGTTTTGGTTGATTGCGTTGTGAAGAAATTGGAGTATATTATTATT
GAAGAGGGAAATTGTCGCAATAACTGGGAGGATATCGATTTCTTTAAGGC
GGCTGAAGTGGCTTATTGTGGCAAAATGTATACGGCAACTCTGATGCTAT
TGGATAAATTGTGGTTGAAAGAAAGCAACGCTGAAATGAATGCTGGGATT
GTCAACTTGTATTACAAAACATTCAAATCTCTCGCAAGTCAAGAGGATTT
AACTGCAGATAGATTCCTAATCGGTTCGTCTTCTCAATACAATGACTATG
GTGATGGTGATGGTGATAGTAATGATTTGCTGTGGCTAATAAAGAATGGG
AAATTTAAAGTTTTGCATCGATTATTAAAAGCTGAGAAAAATAGCGATAT
TTTTTCATTTAAACCCGAGGCAAAAATCGATATTCTATGGAAATTAACCA
GATGGGGAGATGAGGAGAAATTGGAAATCAATAATCTCAGTCAAGAAAAC
GTTTGCTCATTGGCAATGTATGATTTCCTATACAGTCGATCGGAACACGT
GTCGGAATTCTATCGGAATCACGTGGTAGATAGCTGCAAAATATCCTGGG
ATCAAGAAGCGTGTTTTAGACCGTTGATTGAGCGTGCAACGCTTTTCGGC
AATGAAACGTCTCTGCCAACTATCCTGGAATCACTGATCCGTATTGCTAA
TAAATCCAATATCGATCAATTAGACTCGAGCATTGTCTGGGCGTTGATAC
GGTCTAATCGGTTTGCGAGAAATCTAGAAATAGTCAATCAACAGTTACTG
GGAATATCAGATTTGGCAAAGCGCTGCAAGAGGCATGAATATATTGATTT
TATTCGAGACATGTTAAATTTACACGAAGTTGATAACAGTATTTTGAAGT
GCAGTGGTGAATCCTCTTTATTTCGTACTATTGATATTTTCAGCCAAAAA
ACCGAAACGGAGGAAACGAAAAAATCATTTTTACAACTCGAGCAGTTTAT
ATATGATTCACAAAAGCATATTCTGACCTGTCAGCAAATTAAGAGGAATC
ATGATTTATTTTTTAAACTTTATTTTAAAGCAGTGTCTAAGATTTGTGCT
TGGAATCAAGAGTATCCAGTGCACAGTGTGTCACATATTAGAACAAAGAT
TTTAGAGCCAGCCATGGGGGTATTTGGAAAAAGTCTAAAGCAAGAATCTG
ATATGTTAAGTACAATGTCAACCTTTTCATACCAGCAGTACACTCATATT
AATCAATACATGCGCTCGTCAGAATATGAAAATAGAGTGAAAATTTTGAC
AGAATCTAAAAGAGATGTCAGCTACCTTGTGGATCTTCGAGGCAAATGCC
CGTTGCGAAAGATCTTGGAAAAGCAGTCAGAGGTAGATTGGGATGAATTG
AATAATTTATCCCAGGATAGAGAAAGATTTCTTCTTTCTGCAGCAATTAG
TTGTTCAGAATGCCTGCAAAATGAAGATGGCAATGATTTCAAAATATTCC
ATTTGATGTCAATGTGGTTAAGTAATGAATCCAATGAGAAATTGAATAAC
ATCATTTCTGATGTCATCGGTAAAATCGAAACGCATAAATTTCTTGTTCT
TATGCCTCAATTATGTGCTCGTCTTAATTCCGAAAATAATAAATCTTTTG
AAATTAATTTGGAAAAATTAATCAAAAGAATTATTCTTGATCATCCGTTT
CATTCTATTTATAATTTACTTGCCATTCGAAATGCTAACAGAGATTCTGA
ATTAGAAAAATCAAAAAGTTTAAAATCTATTAAAGAGGCAAACGACAAGA
TGAATAGTAGAATATCCGTTGCATATACAATGGTCGAACAATTGGTGAAA
GAATCTCAGTCTGACATTATAAGAGATGCAGATATTTTAACAACAGCTTA
TATTCACTGGGCCAACGTTGACATGTCAGCATTTAAACAAGACATTCATA
AAAAGTTAAAATTTCCATTGAACTGTTCTTTGTTGAGAATAGCTAAACAA
GTTAAGCTTCCCGTTCCTACTTTGTCGATACCCATTGATAGGTCCCTTAA
ATATTCACTTGATAGGCTTCCGTTAATTGTTGGATTTGATGATGTATATT
CTTTGCAAGGAGGAATTAATCTCCCTAAAATTGTTTGGTGCCAGTCATCA
GATGGTTTGAAGCGACGGCAGTTAGTCAAAAGTAATGACGATTTGAGACA
GGATTCCGTAATGCAGCAAGTGTTTTCTGTCGTTAATTCTCTTCTTGGCA
ATAAAGGCTCAATTACATATAAAGCTAATTCTATAAAGAGTTCTGATTGG
TCGGCTTTCATTTATAATAGAATGATCAGTATTCGTACATATAAAGTCAT
ACCAATGACTCAGACAAGTGGTATAATTGAGTGGTGCGAAGATACAGTTC
CTTTGGGGGATTGGTTAGCTAATGATAAAACTGGTGCTCATCAAAGATAT
AGACCTCAAGATTCTACTCCACTGCAATGTCGAAAACGTCTCCAAATTTC
CGCTGAAGAAAACATCAAAAAAAGAATTGAAACCTTCAAAGATATTTTAA
CAAAAATCCAGCCGGTTTTGGGTTATTTTCACTTTGAAAAATTTCCCGAA
TCTCAGCGATGGTTCAAGGCTAGGAAATCCTATGCTAATTCCCTAGCAAT
TAATTCGATTGTGGGATTTATTCTTGGGTTAGGAGATCGGCACGTTCAAA
ATATCCTTCTAGACGTGAATACCGCAGAATTGATTCATATTGATTTTGGA
ATCGCGTTCGATTTAGGTAAACTGATGCCGACTCAAGAACGTGTTCCTTT
TCGTCTTACTCGAGATCTTGTACATGGACTCGGCCCGTTTGGTGTCGAGG
GAAGATTTAAGACCACGTGCTGTGATGTTTTGAATTTGTTACGAAGTCAG
AAAGATATTATTCTCACATTGATAGAGGTTTTGCTTCACGATCCATTGCA
TTCATGGAAACTTAATCCCCAACATGCTCGAGTGTTACACACAAAACGCG
AGGCGGATAATGATTGTAATAATACATCAAATACTAGTTCGAAAACAATA
GAGGGATTTGATAATAAGAGTCGCCCTGGTTCTAGTCAAAATCAGATGGC
AGAAAGGGTTATTCTGGAAATGTCTCGTAAATTTGCTGGAGCCGTTGATA
GCAGTTATTTGAATTGTGAAGGCCATGTGAATTATCTCATCCAAACGGCT
AGCAATGTTGAAAATTTAGCCCGTATGTTTCACGGATGGCAAGCGTATTT
GTAAATTTTCTATTGGTCAATTTTCTAGTTTGAATTCATTTTGGGAGATC
back to top

protein sequence of SMED30019647-orf-1

>SMED30019647-orf-1 ID=SMED30019647-orf-1|Name=SMED30019647-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2771bp
MESGRDVMTMFDITNIPKTKENIEKRLSLIKDSFLTFDSRGNVNDEYFNL
KTHFDWYPFCQFLIKISMSFFELIVKKKSATTDLYKTPMNKKILDDIVYI
YHFTLNNIDPENMNMDINGLLNNALNLTHQMVSTNLDMVQRFVNLIFTET
IFDDKFAIVGEINIQFWEKAERFLCTLILNMRESDSQKSTLFLKSVFLIY
KAMTPFKYPDLVLIIRTINHITSWNFCQNDKLALDIHGYISAIINQLILT
VGTDAIKCLVNICVTISNKYSLKIWMDNGKSHSLIQDPNVNTGINSRLEI
VKMWNNIYGLIGEIDDGFNEPSILLWLKEVTSCIKREIEYTESRSKFIRY
EHCVPDYIFYDLAIKLISRSENENDNDEVGRQAPKHVKSITLIDKIVDNL
NSDLSCRQIFWMRMLEVGLNNSNFVVRCQSQIAQIVSAINVCLNITNLSA
SVYSHLLKIVPKLMDKNLSSDNFCCLFESVFRCLLSESQALESLVTDTVS
VLISIVKTGLLTTLPEGFWSKLMSLLPNESLFSFVSHVILHFNTNQPYRV
LISVEISVQLLNWLLSFVCLPTTSFSDLSLLITVLVNRKSQKADCYTKQQ
CFPNQHRFPSVSYENAIKSCLLKQCPDFYPRTPITEVLQLSINSLDQSGM
NILLKTFEIVSLTDSTDWLIVIFRFFRCLDQIDNPTKFRENIPVLRKAIL
HLKSIATLNQDLSPFLVEGLHSIDWKHLSALGTKIPELSQHISIMTAAVK
ACLVTSVFSHFNLTNLQQFRNQSHCYLSIFPDNLNGFIERFFTSFKLYNT
NHIDLLRVFIESIASFKIRIKPEIISNLLMIIKESFKMFKRNYRVYGNLI
EICLNIISILSDSFEMDNQKDFINCFHDLSGTINKIYMSYFPECHSIGRL
LAKLLALLFGYYWNNNSRIDPAGLLQARLSGICEAVFSNFSNGKSFSARL
SASVFMEEVFRIAHPVVDLLEFFMKNFPENPLLITELWNSAGTDDELLYS
DQNRARISSFLLMWTYSLSSEYSRRDISKFGSSVLPFITGRIPDISCQKP
KSLSDFLSILYSKRFTSTMDITDFITAIMFPFIDNWIDLLADSQQPIELP
GRVTISQIVQNNLKEFLWIISSCSDNDNRRSMISSYFPSVFDESQTVIDN
LPNLVARIVISLDNSSSRCAAAALDYLLSILSIYEIRKLLNENILETIWE
ILSHLWEISRSFERFDRISIVLFSEYLNLPMSLSEWLLSKSGRLIDLVMF
IVGKYSTDDIQDSYPSIWCLIIDIILSSCDNWHHNTNINPINDQFIGFLI
IRHIRLLEISSKNHDNNDLQLLTLLIRLVSFSHRNIEAPNLDVNIFWYQK
AFYFIAECSEKYINHKSIIDDIISELLSSPVTKYGGNLDGFIYRISGFNS
FPSIILLRPEIDGISSIRNILISFDKFGLIILEKKTKSFVLLSEFLYGLL
QTERIDPSIGDLLQKLQDILHLFLVSKMEIFPSLKSPETSDAIISCLMYL
KLLLPQYHISPNQQLAIVGKFDQDPVISDQIDLLYHLSIICLQDFGNRSW
CSYLSLCSLYQSINTSKNRFLTDILSLFHLDKNNKKINIIYEKNLDFPAI
LKFLENSIPFCSHTQWRCELTKMLAVRSSKPVYNRCHPELVSSVGSISFY
CLPRIFATVEFSTEETRILSQVINRILHEQHYCESRKIVLVDCVVKKLEY
IIIEEGNCRNNWEDIDFFKAAEVAYCGKMYTATLMLLDKLWLKESNAEMN
AGIVNLYYKTFKSLASQEDLTADRFLIGSSSQYNDYGDGDGDSNDLLWLI
KNGKFKVLHRLLKAEKNSDIFSFKPEAKIDILWKLTRWGDEEKLEINNLS
QENVCSLAMYDFLYSRSEHVSEFYRNHVVDSCKISWDQEACFRPLIERAT
LFGNETSLPTILESLIRIANKSNIDQLDSSIVWALIRSNRFARNLEIVNQ
QLLGISDLAKRCKRHEYIDFIRDMLNLHEVDNSILKCSGESSLFRTIDIF
SQKTETEETKKSFLQLEQFIYDSQKHILTCQQIKRNHDLFFKLYFKAVSK
ICAWNQEYPVHSVSHIRTKILEPAMGVFGKSLKQESDMLSTMSTFSYQQY
THINQYMRSSEYENRVKILTESKRDVSYLVDLRGKCPLRKILEKQSEVDW
DELNNLSQDRERFLLSAAISCSECLQNEDGNDFKIFHLMSMWLSNESNEK
LNNIISDVIGKIETHKFLVLMPQLCARLNSENNKSFEINLEKLIKRIILD
HPFHSIYNLLAIRNANRDSELEKSKSLKSIKEANDKMNSRISVAYTMVEQ
LVKESQSDIIRDADILTTAYIHWANVDMSAFKQDIHKKLKFPLNCSLLRI
AKQVKLPVPTLSIPIDRSLKYSLDRLPLIVGFDDVYSLQGGINLPKIVWC
QSSDGLKRRQLVKSNDDLRQDSVMQQVFSVVNSLLGNKGSITYKANSIKS
SDWSAFIYNRMISIRTYKVIPMTQTSGIIEWCEDTVPLGDWLANDKTGAH
QRYRPQDSTPLQCRKRLQISAEENIKKRIETFKDILTKIQPVLGYFHFEK
FPESQRWFKARKSYANSLAINSIVGFILGLGDRHVQNILLDVNTAELIHI
DFGIAFDLGKLMPTQERVPFRLTRDLVHGLGPFGVEGRFKTTCCDVLNLL
RSQKDIILTLIEVLLHDPLHSWKLNPQHARVLHTKREADNDCNNTSNTSS
KTIEGFDNKSRPGSSQNQMAERVILEMSRKFAGAVDSSYLNCEGHVNYLI
QTASNVENLARMFHGWQAYL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000077DNA damage checkpoint
GO:0000723telomere maintenance
GO:0006281DNA repair
GO:0010212response to ionizing radiation
GO:0016572histone phosphorylation
GO:0006468protein phosphorylation
GO:0006974cellular response to DNA damage stimulus
GO:0007049cell cycle
GO:0016310phosphorylation
GO:0051321meiotic cell cycle
Vocabulary: cellular component
TermDefinition
GO:0031410cytoplasmic vesicle
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036940PI3/4_kinase_cat_sf
IPR015519ATM/Tel1
IPR014009PIK_FAT
IPR011528NERD
IPR000403PI3/4_kinase_cat_dom
IPR003152FATC_dom
IPR018936PI3/4_kinase_CS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0016301kinase activity
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0003677DNA binding
GO:0004674protein serine/threonine kinase activity
GO:0005524ATP binding
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003152FATC domainSMARTSM01343FATC_2coord: 2738..2770
e-value: 8.3E-12
score: 55.2
IPR003152FATC domainPFAMPF02260FATCcoord: 2740..2770
e-value: 9.7E-11
score: 41.3
IPR003152FATC domainPROSITEPS51190FATCcoord: 2738..2770
score: 14.102
IPR000403Phosphatidylinositol 3-/4-kinase, catalytic domainSMARTSM00146pi3k_hr1_6coord: 2409..2726
e-value: 1.7E-60
score: 216.9
IPR000403Phosphatidylinositol 3-/4-kinase, catalytic domainPFAMPF00454PI3_PI4_kinasecoord: 2412..2673
e-value: 4.4E-44
score: 151.2
IPR000403Phosphatidylinositol 3-/4-kinase, catalytic domainPROSITEPS50290PI3_4_KINASE_3coord: 2408..2770
score: 44.739
NoneNo IPR availableGENE3DG3DSA:3.30.1010.10coord: 2369..2483
e-value: 3.3E-7
score: 32.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2690..2718
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2691..2718
NoneNo IPR availablePANTHERPTHR11139ATAXIA TELANGIECTASIA MUTATED ATM -RELATEDcoord: 2075..2770
NoneNo IPR availableCDDcd05171PIKKc_ATMcoord: 2379..2674
e-value: 7.76645E-140
score: 435.815
IPR036940Phosphatidylinositol 3-/4-kinase, catalytic domain superfamilyGENE3DG3DSA:1.10.1070.11coord: 2530..2714
e-value: 6.3E-35
score: 122.6
IPR015519Serine/threonine-protein kinase ATM/Tel1PANTHERPTHR11139:SF72SERINE-PROTEIN KINASE ATMcoord: 2075..2770
IPR018936Phosphatidylinositol 3/4-kinase, conserved sitePROSITEPS00915PI3_4_KINASE_1coord: 2412..2426
IPR018936Phosphatidylinositol 3/4-kinase, conserved sitePROSITEPS00916PI3_4_KINASE_2coord: 2567..2587
IPR014009PIK-related kinasePROSITEPS51189FATcoord: 1719..2265
score: 9.828
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 2320..2686