Repressor of the inhibitor of the protein kinase

Overview
NameRepressor of the inhibitor of the protein kinase
Smed IDSMED30019641
Length (bp)2460
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Repressor of the inhibitor of the protein kinase (SMED30019641) t-SNE clustered cells

Violin plots show distribution of expression levels for Repressor of the inhibitor of the protein kinase (SMED30019641) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019641

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30019641SMESG000079542.1 SMESG000077227.1 SMESG000077225.1 SMESG000071441.1 SMESG000064845.1 SMESG000059570.1 SMESG000053255.1 SMESG000047025.1 SMESG000046893.1 SMESG000030741.1 SMESG000022456.1 SMESG000022362.1 SMESG000021111.1 SMESG000008969.1 SMESG000008086.1 SMESG000000957.1 SMESG000020914.1 Contig37318uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30019641SMESG000079542.1 SMESG000077227.1 SMESG000077225.1 SMESG000071441.1 SMESG000064845.1 SMESG000059570.1 SMESG000053255.1 SMESG000047025.1 SMESG000046893.1 SMESG000030741.1 SMESG000022456.1 SMESG000022362.1 SMESG000021111.1 SMESG000008969.1 SMESG000008086.1 SMESG000000957.1 SMESG000020914.1 Contig37318newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Human
Match: THAP12 (THAP domain containing 12 [Source:HGNC Symbol;Acc:HGNC:9440])

HSP 1 Score: 155.992 bits (393), Expect = 1.230e-38
Identity = 140/585 (23.93%), Postives = 277/585 (47.35%), Query Frame = 1
Query:  424 NRKKLLPIVKTVVFCAINNIPFRG-KTDKTAI-------FNNLLQFRIDAGDSILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYIS---ETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVINDLNDVCEIRNEVGTIKSIINFFRESSLRRKHIPNI--PLF-------------CETRWTAKYKSVRIFKENIIVIIEALHKLSLNGNIN----TTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQIT----SLVELIKNHQKFAKDNFHNLW-EKMEACLSEINIELIPPRTVKMQTCRTNIPSD-SPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAEL-FYPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNEL 2067
            N++ L  + + ++     NIP  G + D+          F  LL+ RI++G+ +L    ++   N  + S   Q +++ IC   +RE    + + S F SII D+  DI+G E L + +RF+++        R+EF+GF+P E  DA+ ++    T+I+   K+GL++    G+AY   S  + K+  V  R+ ++YP A +   SS  LN+ +     V  +   +GTI+ + +FF  S      + N+   LF             C ++WT ++ +  I  E +  ++  L  ++ + NI        R+  L  A +D  F + + ++    S       NLQG   ++      +T    SL E+++N +      +H  W E+     ++++I++  P   + +  + N+ S  + ESYY++++ +P ++ +I  L++ F E++  +    +L PS M +L  N  E     ++       +   AE   W   +K      E  S +++AL   ++ F+P+V+  L +  I+       +R  +   ++K +LR+T+ + R   L ++ I+ ++ ++L
Sbjct:  162 NKEYLKSLFEILILMGKQNIPLDGHEADEIPEGLFTPDNFQALLECRINSGEEVLRKRFETTAVNTLFCSKTQQRQMLEICESCIREETLREVRDSHFFSIITDDVVDIAGEEHLPVLVRFVDESHN----LREEFIGFLPYE-ADAEILAVKFHTMITE--KWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAIYTLCSSCALNMWLAKSVPVMGVSVALGTIEEVCSFFHRSPQLLLELDNVISVLFQNSKERGKELKEICHSQWTGRHDAFEILVELLQALVLCLDGINSDTNIRWNNYIAGRAFVLCSAVSDFDFIVTIVVLKNVLSFTRAFGKNLQGQTSDVFFAAGSLTAVLHSLNEVMENIEV-----YHEFWFEEATNLATKLDIQMKLPGKFR-RAHQGNLESQLTSESYYKETLSVPTVEHIIQELKDIFSEQHLKALKCLSLVPSVMGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDL 733          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 126.716 bits (317), Expect = 4.717e-29
Identity = 146/609 (23.97%), Postives = 278/609 (45.65%), Query Frame = 1
Query:  397 SVMEQTIEINRKKLLPIVKTVVFCAINNIPFRGKTDKTAIFNN-----LLQFRI-DAGDS---ILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNL-VINDLNDVCEIRNEVGTIKSIINFFRESSLRRKHIPNIPLFCETR----------WTAKYKSVRIFKENIIVIIEALHKL-SLNGNINTTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEI---NIELIPPRTVKMQTCRTNIP---SD------SPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAELFY------PSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRF 2106
            S+  + IE N+K L  I++ ++F     +P RG     +  N      LL+ R  D G+    ++++ +        Y S ++Q+++I I    + ++I  +   S   SII DE+ + +  EQLSI +R+  K S+     ++ FLGFV  E M   ++  TI + L + G+D+ K+ G+AYD  + +  K + +      + P A + H  +H L+L +I    +V E+R+ + T+ S+ N    S     +  NI    + +          WT   +++    +++  IIE L  + S + N +     S L    +   F  CL  +Y   S+   ++  LQ    ++ ++  +I +++E + + +      F  +W+  E    +I     ++  P   K +  + ++    SD      S E  Y+ +I+   LDT++ +L+  F E     Y         + K ++   E     +  ++    E+   E   + HY K      +S  N F +L    + +      P + + L I L    T+ +T+ SFSTL ++KT+L +TM + +L    +M + + LVN+L+E    +EI+++F
Sbjct:  541 SIHSKQIEGNKKYLKLIIENILFLGKQCLPLRGNDQSVSSVNKGNFLELLEMRAKDKGEETFRLMNSQVD------FYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYPQK-SSKAILIKERFLGFVDTEEMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTTNLKIKFNKIAAEFKKEEPRALYIHCYAHFLDLSIIRFCKEVKELRSALKTLSSLFNTICMSGEMLANFRNIYRLSQNKTCKKHISQSCWTVHDRTLLSVIDSLPEIIETLEVIASHSSNTSFADELSHLLTLVSKFEFVFCLKFLYRVLSVTGILSKELQNKTIDIFSLSSKIEAILECLSSERNDV--YFKTIWDGTEEICQKITCKGFKVEKPSLQKRRKIQKSVDLGNSDNMFFPTSTEEQYKINIYYQGLDTILQNLKLCFSE---FDYCKIKQISELLFKWNEPLNETTAKHV-QEFYKLDEDIIPELRFYRHYAKLNFVIDDSCIN-FVSLGCLFIQHGLHSNIPCLSKLLYIALSWPITSASTENSFSTLPRLKTYLCNTMGQEKLTGPALMAVEQELVNKLMEPERLNEIVEKF 1135          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 126.716 bits (317), Expect = 4.717e-29
Identity = 146/609 (23.97%), Postives = 278/609 (45.65%), Query Frame = 1
Query:  397 SVMEQTIEINRKKLLPIVKTVVFCAINNIPFRGKTDKTAIFNN-----LLQFRI-DAGDS---ILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNL-VINDLNDVCEIRNEVGTIKSIINFFRESSLRRKHIPNIPLFCETR----------WTAKYKSVRIFKENIIVIIEALHKL-SLNGNINTTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEI---NIELIPPRTVKMQTCRTNIP---SD------SPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAELFY------PSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRF 2106
            S+  + IE N+K L  I++ ++F     +P RG     +  N      LL+ R  D G+    ++++ +        Y S ++Q+++I I    + ++I  +   S   SII DE+ + +  EQLSI +R+  K S+     ++ FLGFV  E M   ++  TI + L + G+D+ K+ G+AYD  + +  K + +      + P A + H  +H L+L +I    +V E+R+ + T+ S+ N    S     +  NI    + +          WT   +++    +++  IIE L  + S + N +     S L    +   F  CL  +Y   S+   ++  LQ    ++ ++  +I +++E + + +      F  +W+  E    +I     ++  P   K +  + ++    SD      S E  Y+ +I+   LDT++ +L+  F E     Y         + K ++   E     +  ++    E+   E   + HY K      +S  N F +L    + +      P + + L I L    T+ +T+ SFSTL ++KT+L +TM + +L    +M + + LVN+L+E    +EI+++F
Sbjct:  541 SIHSKQIEGNKKYLKLIIENILFLGKQCLPLRGNDQSVSSVNKGNFLELLEMRAKDKGEETFRLMNSQVD------FYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYPQK-SSKAILIKERFLGFVDTEEMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTTNLKIKFNKIAAEFKKEEPRALYIHCYAHFLDLSIIRFCKEVKELRSALKTLSSLFNTICMSGEMLANFRNIYRLSQNKTCKKHISQSCWTVHDRTLLSVIDSLPEIIETLEVIASHSSNTSFADELSHLLTLVSKFEFVFCLKFLYRVLSVTGILSKELQNKTIDIFSLSSKIEAILECLSSERNDV--YFKTIWDGTEEICQKITCKGFKVEKPSLQKRRKIQKSVDLGNSDNMFFPTSTEEQYKINIYYQGLDTILQNLKLCFSE---FDYCKIKQISELLFKWNEPLNETTAKHV-QEFYKLDEDIIPELRFYRHYAKLNFVIDDSCIN-FVSLGCLFIQHGLHSNIPCLSKLLYIALSWPITSASTENSFSTLPRLKTYLCNTMGQEKLTGPALMAVEQELVNKLMEPERLNEIVEKF 1135          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 126.716 bits (317), Expect = 4.717e-29
Identity = 146/609 (23.97%), Postives = 278/609 (45.65%), Query Frame = 1
Query:  397 SVMEQTIEINRKKLLPIVKTVVFCAINNIPFRGKTDKTAIFNN-----LLQFRI-DAGDS---ILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNL-VINDLNDVCEIRNEVGTIKSIINFFRESSLRRKHIPNIPLFCETR----------WTAKYKSVRIFKENIIVIIEALHKL-SLNGNINTTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEI---NIELIPPRTVKMQTCRTNIP---SD------SPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAELFY------PSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRF 2106
            S+  + IE N+K L  I++ ++F     +P RG     +  N      LL+ R  D G+    ++++ +        Y S ++Q+++I I    + ++I  +   S   SII DE+ + +  EQLSI +R+  K S+     ++ FLGFV  E M   ++  TI + L + G+D+ K+ G+AYD  + +  K + +      + P A + H  +H L+L +I    +V E+R+ + T+ S+ N    S     +  NI    + +          WT   +++    +++  IIE L  + S + N +     S L    +   F  CL  +Y   S+   ++  LQ    ++ ++  +I +++E + + +      F  +W+  E    +I     ++  P   K +  + ++    SD      S E  Y+ +I+   LDT++ +L+  F E     Y         + K ++   E     +  ++    E+   E   + HY K      +S  N F +L    + +      P + + L I L    T+ +T+ SFSTL ++KT+L +TM + +L    +M + + LVN+L+E    +EI+++F
Sbjct:  541 SIHSKQIEGNKKYLKLIIENILFLGKQCLPLRGNDQSVSSVNKGNFLELLEMRAKDKGEETFRLMNSQVD------FYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYPQK-SSKAILIKERFLGFVDTEEMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTTNLKIKFNKIAAEFKKEEPRALYIHCYAHFLDLSIIRFCKEVKELRSALKTLSSLFNTICMSGEMLANFRNIYRLSQNKTCKKHISQSCWTVHDRTLLSVIDSLPEIIETLEVIASHSSNTSFADELSHLLTLVSKFEFVFCLKFLYRVLSVTGILSKELQNKTIDIFSLSSKIEAILECLSSERNDV--YFKTIWDGTEEICQKITCKGFKVEKPSLQKRRKIQKSVDLGNSDNMFFPTSTEEQYKINIYYQGLDTILQNLKLCFSE---FDYCKIKQISELLFKWNEPLNETTAKHV-QEFYKLDEDIIPELRFYRHYAKLNFVIDDSCIN-FVSLGCLFIQHGLHSNIPCLSKLLYIALSWPITSASTENSFSTLPRLKTYLCNTMGQEKLTGPALMAVEQELVNKLMEPERLNEIVEKF 1135          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 126.716 bits (317), Expect = 4.717e-29
Identity = 146/609 (23.97%), Postives = 278/609 (45.65%), Query Frame = 1
Query:  397 SVMEQTIEINRKKLLPIVKTVVFCAINNIPFRGKTDKTAIFNN-----LLQFRI-DAGDS---ILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNL-VINDLNDVCEIRNEVGTIKSIINFFRESSLRRKHIPNIPLFCETR----------WTAKYKSVRIFKENIIVIIEALHKL-SLNGNINTTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEI---NIELIPPRTVKMQTCRTNIP---SD------SPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAELFY------PSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRF 2106
            S+  + IE N+K L  I++ ++F     +P RG     +  N      LL+ R  D G+    ++++ +        Y S ++Q+++I I    + ++I  +   S   SII DE+ + +  EQLSI +R+  K S+     ++ FLGFV  E M   ++  TI + L + G+D+ K+ G+AYD  + +  K + +      + P A + H  +H L+L +I    +V E+R+ + T+ S+ N    S     +  NI    + +          WT   +++    +++  IIE L  + S + N +     S L    +   F  CL  +Y   S+   ++  LQ    ++ ++  +I +++E + + +      F  +W+  E    +I     ++  P   K +  + ++    SD      S E  Y+ +I+   LDT++ +L+  F E     Y         + K ++   E     +  ++    E+   E   + HY K      +S  N F +L    + +      P + + L I L    T+ +T+ SFSTL ++KT+L +TM + +L    +M + + LVN+L+E    +EI+++F
Sbjct:  541 SIHSKQIEGNKKYLKLIIENILFLGKQCLPLRGNDQSVSSVNKGNFLELLEMRAKDKGEETFRLMNSQVD------FYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYPQK-SSKAILIKERFLGFVDTEEMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTTNLKIKFNKIAAEFKKEEPRALYIHCYAHFLDLSIIRFCKEVKELRSALKTLSSLFNTICMSGEMLANFRNIYRLSQNKTCKKHISQSCWTVHDRTLLSVIDSLPEIIETLEVIASHSSNTSFADELSHLLTLVSKFEFVFCLKFLYRVLSVTGILSKELQNKTIDIFSLSSKIEAILECLSSERNDV--YFKTIWDGTEEICQKITCKGFKVEKPSLQKRRKIQKSVDLGNSDNMFFPTSTEEQYKINIYYQGLDTILQNLKLCFSE---FDYCKIKQISELLFKWNEPLNETTAKHV-QEFYKLDEDIIPELRFYRHYAKLNFVIDDSCIN-FVSLGCLFIQHGLHSNIPCLSKLLYIALSWPITSASTENSFSTLPRLKTYLCNTMGQEKLTGPALMAVEQELVNKLMEPERLNEIVEKF 1135          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Zebrafish
Match: thap12a (THAP domain containing 12a [Source:ZFIN;Acc:ZDB-GENE-040426-2045])

HSP 1 Score: 123.25 bits (308), Expect = 2.003e-28
Identity = 129/591 (21.83%), Postives = 256/591 (43.32%), Query Frame = 1
Query:  421 INRKKLLPIVKTVVFCAINNIPFRGKTDK--------TAIFNNLLQFRIDAGDSILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLV-KFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVINDLNDVCEIRNEVGTIKSIINFFRESSLRRKHIPN-IPLF--------------CETRWTAKYKSVRI---FKENIIVIIEALHKLSLNGNINTTQRSSQLYH-------ACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQIT----SLVELIKNHQKFAKDNFHNLW-EKMEACLSEINIELIPPRTV--KMQTCRTNIPSDSPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAEL-FYPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNEL 2067
            +N++ L  +   VV     NIP  G +DK         + F  LL++RI+AGD  L    +  P N  + S     +++ +    +RE +  +AK     S++ D   +I G   + + +RF++K +    C R+EF+ F+  E  D + I+E +++ L  K GLD+    G+AY      A K+  +  +I + +P A     SS  LN+ + +      +   + T+K +  FF +S L +  + + I ++              C ++WT ++ +  +     E++++ ++++H      +    + S ++ H       A  D  + + L ++    S       NLQG    +      +T    SL E+ +N +      +H  W E+     + + I +  PR    K  T    I    PE+YY+  + IP +  +I  L + F E +  +    +L P+ M +L  N  E  +  I+       + + AE   W   +K         S +++ L+ +++ F+P+V   L +   +     T  +  +   ++  +L+ T    R  ++ + YI+  + ++L
Sbjct:  148 LNKEYLKSLFDVVVMMGTQNIPLHGHSDKEPRSKSFTPSNFQALLEYRINAGDEFLRKKFEGSPVNLEHCSSTQLQQILEVIEKCIREELLAEAKEGRCFSLVVDNLVEIEGENYVPLFVRFVDKAN----CLREEFVDFLLFEG-DVEAITERLVTELTEKCGLDMKYCRGQAYLCSGVSAMKVKAMVAKIAELHPLAVLTPCSSCSLNICLANTMTFTGVHLVMSTLKKLDAFFSKSPLLQNQLESAISIYYQGNEEKANVLKEACGSKWTEQHDTFELAVDLLESLLLCMDSVH------DNEDHKWSDEVAHNAFVISEALADFEYVMTLVVLKNTLSFTRAFGKNLQGETNEVFFASGSLTAVLHSLNEVYENIEV-----YHEFWFEEAVNLAASLEIPVKVPRLYFRKRPTSGEEI---QPETYYKDQVTIPVVSHVIKELSDLFSENHLKALKSLSLVPAIMGQLKFNTTEETSVDIYKDDLLNPDTFPAELHCWKIKWKHGTKDVILPSTIYETLQLSDVKFFPNVCALLKVLYNLPLFALTNDKCSTAKQRLMAYLQDTPVNHRNKSMALFYINCAIKHDL 719          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Zebrafish
Match: CR762475.1 (pep chromosome:GRCz11:4:55494751:55498830:1 gene:ENSDARG00000098243.2 transcript:ENSDART00000172605.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR762475.1)

HSP 1 Score: 122.479 bits (306), Expect = 4.165e-28
Identity = 135/609 (22.17%), Postives = 253/609 (41.54%), Query Frame = 1
Query:  436 LLPIVKTVVFCAINNIPFRGKTDKTAIFN--NLLQF--RIDAGDSILSNHLQSCPS--------NATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLV-----------------INDLNDVCEIRNEVGTIKSIINFFR--ESSLRRKHIPNIPLFCETRWTAKYKSVRIFKENIIVIIEALHKLSLNGNINTTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEINIEL--IPPRTVKMQTCRT------NIPSDSP-----ESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLD------QNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALK--AAELFYPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRF 2106
            L  ++   ++ A     FRG  + ++  N  N ++    +   DS++  HL +             + +S+R QN++I      +R  I  + K +   SI+ DE+ D+S  EQ+S  +R++  M   E      FL    LE    K +   +IS L   GLDL  + G+ YDG + M+    G+Q RI      A + H  +H LNLV                 +  L   C      G+ K    F +  +S    + +  +    +TRW  + +S++   + +  +I+ L  L  +    T    +++Y    D  F +C  I      +    ++ LQ  D +L T       +++ +KN +  +++ F  +++K      ++ I++  +PP   + +   T          DS      E +YR  ++  +LDT+   L  RF  +  +       +  S+   D        E  +    + N Y   +E  Q        ++ T+K  S  + ++   LK  + +  +P++   L +   +  +T T +RSFS +  +K  LRS   E RL  L ++ I +++  +      +SE+I+ F
Sbjct:  307 LTRLIDISLYLARQGQAFRGDDESSSSANQGNFIELVKTLAQYDSVMKLHLDAIQEKQASMKKPQVSLLSNRSQNDIIMSLGTFIRSKIQNEIKEAQIFSILLDETTDVSHKEQVSFVVRYVRDMEVKE-----RFLQVCTLESTTGKELENVVISLLQDNGLDLKNIRGQGYDGAANMSGMYKGLQSRIRAHNEKALYVHCQAHCLNLVLVESAKSSIHFVTFFSLVEKLYVFC-----TGSTKRHTAFLKCQQSLYPGQRVVELQKLSDTRWACRERSLKALNKVLKALIKLLTDLCESDPPETAAGDAKMYLRAIDFEFLLCSEITTTVFQITGVASDALQKKDLDLSTAYTITDGVLDTVKNLR--SEEEFKTIFQKAVEKAEDVGIDIPTVPPGHGRKRKVPTRYLHSATAAQDSHTFQTVEEFYRAKVYFTFLDTITEELGRRFKVDGTMPTGKILQSFQSLTVHDNWVGTPNTEAVQAIQTLCNFYS--VEEEQQLKTELKVFHTTFK--SSGMKSMLSILKETSGQHVFPALVEMLKVYATLPVSTATVERSFSKMRLIKNQLRSLCSEERLSDLLLIAIEKDIPVD------HSEVINIF 893          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Zebrafish
Match: thap12b (THAP domain containing 12b [Source:ZFIN;Acc:ZDB-GENE-040718-429])

HSP 1 Score: 107.842 bits (268), Expect = 1.368e-23
Identity = 114/546 (20.88%), Postives = 230/546 (42.12%), Query Frame = 1
Query:  517 FNNLLQFRIDAGDSILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVK-FGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVINDLNDVCEIRNEVGTIKSIINFFRESSLRRKHIPN-IPLFCE--------------TRWTAKYKSVRI---FKENIIVIIEALHK-LSLNGNINTTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDN---FHNLWEKMEACLSEINIELIPPRTVKMQTCRTNIPSD---SPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAEL-FYPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIE 2073
            F  LL+ RI+AGD  L    +S   N  Y     Q +L+ +C   +RE I +  +   F SI+  E  D    E L I +RF+++ +T     R+EF+ F+  E  +   ++E + S L+K +GL +    G+AY G   +  K+  +  ++ ++YP A     S+  LN+ + +   +  ++  +  +K    FFR S L +  + N I + C+              + WT  +    +     E +++ ++++H    L  +   T  +  +  A  D  F + L I+    S       NLQG   ++      +T+++  +        DN   +H  W   E  ++      +P R  ++   +   P       ES++++ +  P ++ +   +++ F E +  +    +L P+ M ++  N  E     I+       +   AE   W   +K         S +++ L+ +++ F+P+V   L I   +           +   +++ +L  T    R   L ++ I+ ++  +L E
Sbjct:  196 FQALLENRINAGDEFLRRRFESAAVNEEYCPAVQQRQLLDVCEKCVREEILQQVRECRFFSIVTGELVDFPEGEHLPIFLRFVDQDNT----LREEFIEFLSFEGEEVT-VAERLESRLMKGWGLSMEHCRGQAYAGSGILGTKMKVITAQLKEKYPMAVITPTSTCALNVHLANGMSLTGVQVVMSVLKKSNAFFRASPLLQTELDNAISILCQGNLEKESILKEGSRSTWTDLHNLFEMAVDLLEPLLLCMDSIHDNEDLKWSDQVTSDAYAISEALADFEFIVTLVILKNALSFTRAFGKNLQGETIDVFFAANSLTAVLHSLHE----VSDNLEVYHEFW--FEEAVNMATAMEVPVRVPRLFLRKQQTPDTIEIQAESFFKEYLTQPVMEYITQEVKDIFSENHLKALKCLSLVPAVMGQMRFNTSEESHADIYRTDLPHPDTLPAELHCWRIKWKHRGKEVSLPSTIYETLQHSDVKFFPNVNAFLKILATLPVLKLDGSHGETAQRRLQAYLTDTAVSQRCKNLAVLNINYHIKTDLEE 730          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Zebrafish
Match: AL928808.1 (pep chromosome:GRCz11:20:17257101:17259573:-1 gene:ENSDARG00000101333.2 transcript:ENSDART00000166397.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL928808.1)

HSP 1 Score: 56.9954 bits (136), Expect = 7.708e-8
Identity = 53/203 (26.11%), Postives = 91/203 (44.83%), Query Frame = 1
Query:  610 HRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPL-EHMDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQK--RI*DQYPFANFYH*SSHRLNLVINDLNDVCEIRNEVGTIKSIINFFRESSLRRKH-----------IPNIPLF-CETRWTAK 1173
            H V+  +  I N V   ++  D +   + SI  DESCD+    Q +I +RF+++  T     R+E L  VPL +      + ET+++ + K  L LSK+     DG   M     G+    +  D++P    +H   H+ + V   LN    + + +  +  I+NF R  +L  +            +P+  LF C  RW ++
Sbjct:  158 HTVEQRISDIDNSV-ETHLLSDLQKCQYFSIALDESCDVQDKPQFAIFVRFVSEDCT----IREELLDIVPLKDRTRGIDLKETLMTVVEKANLQLSKLTAIVTDGAPAMLGSERGLVGLCKADDRFPAFWTFHCIIHQEHWVSKKLN----LDHIMKPVLEIVNFVRTHALNHRQFKNLIDELDEDLPSDLLFHCAVRWLSR 351          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Zebrafish
Match: si:ch211-240b21.2 (si:ch211-240b21.2 [Source:ZFIN;Acc:ZDB-GENE-060526-125])

HSP 1 Score: 50.8322 bits (120), Expect = 1.623e-6
Identity = 24/58 (41.38%), Postives = 40/58 (68.97%), Query Frame = 1
Query: 1936 TTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRFG 2109
            TT   +R FSTL ++KT+LR++M + RL+AL M+ I + LV E+ +  F  ++I++F 
Sbjct:  166 TTAEAERCFSTLKRIKTFLRNSMTQERLNALAMLSIEKRLVTEMTD--FNQKVIEKFA 221          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Xenopus
Match: tbx18 (T-box 18 [Source:Xenbase;Acc:XB-GENE-489907])

HSP 1 Score: 465.692 bits (1197), Expect = 5.122e-154
Identity = 240/590 (40.68%), Postives = 361/590 (61.19%), Query Frame = 1
Query:  346 FYQIIQNKRRNVAEMMNSVMEQTIEINRKKLLPIVKTVVFCAINNIPFRGKTDKTAIFNNLLQFRIDAGDSILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVINDLNDVCEIRNEVGTIKSIINFFRESSLRRKHIPNIPLFCETRWTAKYKSVRIFKENIIVIIEALHKLSLNGNINTTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEINIELIPPRTVKMQTCRTNIPSDSPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAELFYPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRFGRN 2115
            F  +  +  +++   +NS ++  +E NRKKL  ++ T+VFC  ++I  RGKT  +     L  FRI++GD IL NHL++ P NA             +C D+LRE I   A  S   S+IADES DISG EQLS+G+RF++ ++      R+EFLGF  L+  DA  I+  I+   +KFGL++ K+ G+ YDGCSTMA K  GVQ +I ++YP A F H +SH+LNLV+N+LN V EIRN +G++K+II FFRES  RR  IPN+PL CETRWTAKYKS+R+F EN   I + L  L    +   +Q + QL    + STF  CL IM  YS+ L P+   LQ V+ ++      +  L+++  NH++ A+++F ++   ++      +IEL  PR    Q   +N+P  + E YYR++I++PYLD++I SL+ RF   N  ++++F+L P  M K+ Q E++     I + Y   ++N  AE+ TW+  + + K+  +  + + D L   +L  P+V +A+ I L +  TTCT +RSFS++ +VKTWLRSTM   RL  LCMM +HR++VNE     F  E++D+F ++
Sbjct:   46 FINVRSHPEQSIVCQVNSAVKHQVEENRKKLYSVLSTIVFCGTHDIALRGKTSTSGNVQALYDFRIESGDEILKNHLKNAPVNAL------------LCEDILRERIISAANNSVGFSVIADESADISGHEQLSLGVRFVD-LTITPVKIREEFLGFATLKAFDATSIANVIMEQCIKFGLNIDKLYGQGYDGCSTMAGKEGGVQAKIKEKYPRAIFVHCASHKLNLVVNNLNAVPEIRNAIGSVKAIIKFFRESPKRRSLIPNVPLLCETRWTAKYKSIRVFSENFDRIFQQLRDLVSTASGKISQEAHQLLCCSSTSTFLFCLVIMATYSARLEPLTQALQAVEMDIAKAHSHVQELIQMFLNHRQQAEEHFKDILVNVQNIAERTDIELSLPRRCGRQKHHSNVPGSTVEEYYRRAIYVPYLDSVIASLKTRFDCHNITNFNLFSLHPHQMAKIKQQEFKEKIKQITSIYN--IDNLDAEALTWFDLW-SGKEKQDFQNGLLDLLPYTDLI-PAVRQAILIALTLPVTTCTVERSFSSMRRVKTWLRSTMTVNRLSGLCMMSLHRDIVNE-NRPQFIHEVVDKFAQD 617          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Xenopus
Match: slc10a6 (solute carrier family 10 (sodium/bile acid cotransporter), member 6 [Source:Xenbase;Acc:XB-GENE-988401])

HSP 1 Score: 304.294 bits (778), Expect = 1.839e-97
Identity = 156/364 (42.86%), Postives = 223/364 (61.26%), Query Frame = 1
Query:  346 FYQIIQNKRRNVAEMMNSVMEQTIEINRKKLLPIVKTVVFCAINNIPFRGKTDKTAIFNNLLQFRIDAGDSILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVINDLNDVCEIRNEVGTIKSIINFFRESSLRRKHIPNIPLFCETRWTAKYKSVRIFKENIIVIIEALHKLSLNGNINTTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIK 1437
            F  +  +  +++   +NS ++  +E NRKKL  ++ T+VFC  ++I  RGKT  +     L  F I++GD IL NHL++ P NA Y S RV+NELI +                   S+IADES DISG EQLS+G+RF++ ++      R+EFLGF  L+ +DA  I+  I+   +KFGL++ K+ G+ YDGCSTMA K  GVQ +I ++YP A F + +SH+LNLV+NDL  V +IRN +G+ K+II FFRES  RR  IPN+PL CETRWTAKYKS+R+F EN   I + L  L    +   +Q + QL    + STF  CL IM  YS+ L P+   LQ V+ ++      +  L+++I+
Sbjct:  100 FINVRSHPEQSIVCQVNSAVKHQVEENRKKLYSVLSTIVFCGTHDIALRGKTSTSGNVQALFDFCIESGDEILKNHLKNAPVNARYTSVRVENELIVLSG----------------FSVIADESADISGHEQLSLGVRFVD-LTITPVKIREEFLGFATLKAVDATSIANVIMEQCIKFGLNMDKLYGQGYDGCSTMAGKEGGVQAKIKEKYPRAIFVYCASHKLNLVVNDLKAVPDIRNAIGSGKAIIKFFRESPKRRSLIPNVPLLCETRWTAKYKSIRVFSENFDRIFQQLRDLVSTASGKISQEAHQLLCCSSTSTFLFCLVIMATYSARLEPLTQALQAVEMDIAKAHSHVQELIQIIQ 446          

HSP 2 Score: 74.3294 bits (181), Expect = 1.839e-97
Identity = 35/80 (43.75%), Postives = 47/80 (58.75%), Query Frame = 2
Query:  119 RTFRHTWLHDYPEMSYSAKLKGVVCRTCVLFKPHVDRGIQGAFILKEFTKYKKFHECAKLHI*SKWHRESINKANNFTRL 358
            R FRH WL  Y  + YS  LKG +C+ CV+F   V RG QGAFI   F KY+ FH  A+ H  +  H+++ + A NF  +
Sbjct:   24 RCFRHVWLKQYRWICYSPHLKGALCKYCVIFPQPVHRGFQGAFITAPFLKYRDFHNSARKHSLTTCHKQAYDDATNFINV 103          

HSP 3 Score: 87.8113 bits (216), Expect = 2.909e-17
Identity = 51/132 (38.64%), Postives = 82/132 (62.12%), Query Frame = 1
Query: 1720 QNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAELFYPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRFGRN 2115
            Q + ++IT+ I+N     ++N  AE+ TW+  + + K+  +  + + D L   +L  P+V +A+ I L +  TTCT +RSFS++ +VKTWLRSTM    L  LCMM +HR++VNE     F  E+ID+F ++
Sbjct:  446 QRKIKQITS-IYN-----IDNLAAEALTWFDVW-SGKEKQDFQNGLLDLLPYTDLI-PAVRQAILIALTLPVTTCTVERSFSSMRRVKTWLRSTMTVNCLSGLCMMSLHRDIVNE-NRPQFIHEVIDKFAQD 568          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Xenopus
Match: thap12 (THAP domain containing 12 [Source:NCBI gene;Acc:394650])

HSP 1 Score: 141.354 bits (355), Expect = 4.577e-34
Identity = 132/575 (22.96%), Postives = 263/575 (45.74%), Query Frame = 1
Query:  424 NRKKLLPIVKTVVFCAINNIPFRGKTDKTAI-------FNNLLQFRIDAGDSILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLV-KFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVINDLNDVCEIRNEVGTIKSIINFF-RESSLRRKHIPNIPLF--------------CETRWTAKYKSVRIFKENIIVIIEALHKL----SLNGNINTTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDN---FHNLWEKMEACLSE-INIEL-IPPRTVKMQTCRTNIPSD-SPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAEL-FYPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIH 2046
            N+  L  + + ++     NIP  G   +          F  LL++RI++GD +L    ++   N  Y S   Q  ++ IC   +R+ I  + + + F S++ +++  + G E + + +RFI++  TN    R+EFLGF+P E  DAK ++    +++  K+GL++    G+AY   S ++  +  V  ++ + YP       S+  LN+ +     V  +   +G +K + +FF ++  L+ +    I +                +T W +++ +  I    +   I  L K+    S   N   T R+  L  A +D  F +   I+    S       NLQG+  ++ +    +T+++  +       KDN   +H  W +    L+E +++++ +P R   +Q   TN+  D + ES+Y+ ++ +P +  +I  L++ F E++  +    +L PS M +L  +  E     ++       +   AE   W   +K      E  SN++++L  +++ F+P+VF  L +  I+       ++      ++K +L +T  E R   L M+ I+
Sbjct:  157 NKDYLKSLFEILILMGKQNIPLEGHNSEVPTGVFIPDSFQALLEYRINSGDDLLRKRFETTAVNLEYCSRTQQRHMLEICESCIRDEILREVRDANFFSVVMEDAVSLGGEEHMPVFVRFIDE--TNNL--REEFLGFLPCEG-DAKALALNFHTTMTEKWGLNMEFCRGQAYVTSSGLSANMKFVASQLLEMYPQVVHTLSSTCALNIWLAKAIPVAGVSIVLGAMKDLYSFFQKQPQLKVELERTIKVLFQGNEEKADDYKNVIQTEWISRHDTFEIIVGLLQAFILCLDKITSDNSFKCNTKVTSRAFILSSALSDFDFIVTNVILKNALSFTRAFGKNLQGLTSDIFSAANSLTAVLHSLNE----VKDNIEVYHEFWFEEATNLAEKLSVQVKLPSRFHTLQL--TNLQPDLTVESFYKDALSVPTIHHIIQGLKDIFSEQHLKALKCLSLVPSVMGQLKFSTSEEHNTDMYKCDLPNPDTLSAELHCWRVKWKHRGKDVELPSNIYESLHLSDIKFFPNVFALLKVLCILPVIKVDNEKFEVGRKRLKAYLGNTAVEHRSCQLAMLNIN 720          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Xenopus
Match: ENSXETT00000043220.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:36411169:36451375:1 gene:ENSXETG00000018966.1 transcript:ENSXETT00000043220.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.9005 bits (237), Expect = 9.065e-20
Identity = 139/599 (23.21%), Postives = 252/599 (42.07%), Query Frame = 1
Query:  409 QTIEINRKKLLPIVKTVVFCAINNIPFRGKTDKTAIFNN----LLQFRIDAGDSILSNHLQSCPSNAT----YISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVINDLNDVC-EIRNEVGTIKSIINFFRESSLR--------RKHIPNIPLFCETRWTAKYKSVRIFKENIIVIIEALHKLSLNGNINTTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFH----NLWEKMEACLSEINIELIPPRTVKMQTCRTNIPSDSPESYYRKSIFIPYL----DTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQ--AESATWYHYYKTYKDASESISNVFDALKAAELF-----YPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRFG 2109
            Q +E  R  L  +V  V   +   +PFRG  +K     N    +L   I   D  L+ H++   +  T    Y+S  V  E I I    + E I  +AK + + SI  D + D+S  +QL+  I ++     N+   ++ F+ F+P     A+ +   ++ +L ++ +D+    G++YD  S M+   SG+Q RI    P A +   S+H LNLV     + C E  +    ++ + +FF  SS R        ++    +     TRW+A  +S    +EN           S N +  +T +S  L     D  F   L++  +  S +      LQ    ++L   K +  L    +  +  + D  +    ++ EK+     EI       R  K++   +   +D   S      F   L    D LI+ L  +     D S     L+  ++   + ++ ++  + +  KY   L+  +  +E  ++ H  +     ++S +   D  +  + +     YP++  A  I L    T  + +RSFS L  +K +LRS+M + RL  L ++ I     +E+  K  + ++ID F 
Sbjct:  145 QEMEYWRNVLKRVVTAVKTLSSRGLPFRGTDEKFGSLTNGNYLMLLEAIAEHDPFLAEHIKKYGNTGTGSTSYLSKTVCFEFIDIVASSVLEVIINEAKQAKYYSISVDSTPDVSHTDQLAFIICYVK----NDGIPKERFIKFIPNVGHKAENLFSAVMDTLKEYHIDILDCRGQSYDNASNMSGPYSGLQARIKQVNPLAVYIPCSAHSLNLVGTSAAESCREAVSFFCILQQLYHFFSASSTRWEMLISHLKRKATVVKNLSTTRWSA--RSDAYIREN-----------SSNSDSVSTAQSLLLQ---VDFHFLCTLFVWNKILSQVDRDNQALQAKSISILDASKIVNGLRSTFQEMRVISVDEIYFYARDVCEKL-----EIPATFPQKRKRKVKARASYESADEGASLSAGDNFRISLNQIFDVLISDLTWKSKTLMDTSVDFEFLSCPALVTFELSQLQKAASDLALKYSKDLDASELCSEIESFRHQVEAILPDAKS-ATPLDLCQMIQDYSLADCYPNIDTAFRIFLTSPVTVASCKRSFSKLKLIKNYLRSSMEQERLSNLSILSIE----HEMARKIDFDDVIDHFA 713          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Mouse
Match: Thap12 (THAP domain containing 12 [Source:MGI Symbol;Acc:MGI:1920231])

HSP 1 Score: 154.066 bits (388), Expect = 3.431e-38
Identity = 144/593 (24.28%), Postives = 277/593 (46.71%), Query Frame = 1
Query:  424 NRKKLLPIVKTVVFCAINNIPFRG-KTDKTAI-------FNNLLQFRIDAGDSILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLV-KFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVINDLNDVCEIRNEVGTIKSIINFFRESSL------------------RRKHIPNIPLFCETRWTAKYKSVRIFKENIIVIIEALHKLSLNGNINT----------TQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQIT----SLVELIKNHQKFAKDNFHNLW-EKMEACLSEINIEL-IPPRTVKMQTCRTNIPSD-SPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAEL-FYPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNEL 2067
            N++ L  + + +V     NIP  G + D+          F  LL+ RI++G+ +L    ++   N  + S   Q  ++ IC   +RE    + + S F SII D+  DI+G E L + +RF++         R+EF+GF+P E  DA+ ++    +++  K+GL++    G+AY   S  + K+  V  R+ ++YP A +   SS  LN  +     V  +   +GTI+ + +FF  S                    R K +  I   C ++WT ++ +  I    ++ +++AL  L L+G IN+            R+  L  A TD  F + + ++    S       NLQG   ++      +T    SL E+++N +      +H  W E+     ++++I++ +P +  + Q  + N+ S  + ESYY+ ++ +P ++ +I  L++ F E++  +    +L PS M +L  N  E     ++       +   AE   W   +K      E  S +++AL   ++ F+P+V+  L +  I+       +R  +   ++K +LR+T+ + R   L ++ I+ ++ ++L
Sbjct:  158 NKEYLKSLFEILVLMGKQNIPLDGHEADEVPEGLFAPDNFQALLECRINSGEEVLRKRFEATAVNTLFCSKTQQRHMLEICESCIREETLREVRDSHFFSIITDDVVDIAGEEHLPVLVRFVDDAHN----LREEFVGFLPYE-ADAEILAVKFHTTITEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAVYTLCSSCALNAWLAKSVPVIGVSVALGTIEEVCSFFHRSPQLLLELDSVISVLFQNSEERAKELKEI---CHSQWTGRHDAFEI----LVDLLQAL-VLCLDGIINSDTNVRWNNYIAGRAFVLCSAVTDFDFIVTIVVLKNVLSFTRAFGKNLQGQTSDVFFAASSLTAVLHSLNEVMENIEV-----YHEFWFEEATNLATKLDIQMKLPGKFRRAQ--QGNLESQLTSESYYKDTLSVPTVEHIIQELKDIFSEQHLKALKCLSLVPSVMGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDL 730          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Mouse
Match: Zmym1 (zinc finger, MYM domain containing 1 [Source:MGI Symbol;Acc:MGI:1915560])

HSP 1 Score: 111.694 bits (278), Expect = 1.279e-24
Identity = 137/612 (22.39%), Postives = 260/612 (42.48%), Query Frame = 1
Query:  394 NSVMEQTIEINRKKLLPIVKTVVFCAINNIPFRGKTDKTAIFNN-----LLQFRI-DAGD--SILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNL-VINDLNDVCEIRNEVGTIKSIINFFRESSLRRKHIPNIPLFC-------------ETRWTAKYKSVRIFKENIIVIIEALHKLSLN-GNINTTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEINIELI----PPRTVKMQTCRTNIPSDSPESY--------YRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAELFY------PSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRF 2106
            +SV  + IE N+K L  I++ ++F     +  +G     +  N      LL+ R  D G+   ++S+H+        Y S  VQ E+I +  D + ++I  +   S   SII +E    +   QLS+ +R+  K + +    ++ FLGFV  E +   ++   I + L + G+D +K+ G+AYD  +    K++ V      + P A + H  +H L L VI+   +V E+R  + T+ S+ N    S    + + ++   C             ++ W A    +    + +  ++E L  +S              L    T   F  CL  +Y   S+   ++   Q    ++ ++  +I +++E + + +      F N+W+  +    +I  +      P    + +  RT  P +S   +        Y+ +I+   LDT++  L+  F E     Y         + K ++   E     I   Y   L+        +Y  Y  +   +E  S  F  L +  + +      P + + L I L    T+   ++SFSTL  +KT+L  TM + +L +L ++ + + LVN+L+E      I+++F
Sbjct:  284 SSVYSKQIEGNKKYLRLIIENILFLGKQCLLLKGNDQSVSPMNKGSFLELLELRARDRGEVFQLMSSHVD------FYSSTLVQEEIIEMIKDEMLQDIVSEINASSAFSIICEEIAGSAAERQLSVCVRYPQK-TPSAVLVKERFLGFVTAEEVTGVHVHGRIKAYLQQVGVDFNKICGQAYDSATNFTVKLNEVVAEFKKEEPRALYVHCHAHFLELAVISFCKEVKELREALHTLCSLFNTVHVS---EEMLASLQTMCKLSLNKTCKKHTSQSCWPAHDHLLLAVTDCLPEVVEVLASVSRRCAGTAVAAELEDLLAMVTKFEFIFCLKFLYRVLSITGILSREFQSETVDIFSLFSKIEAILECLSSERN--DTYFKNIWDGADEICKKITSKGFDVEKPSFQKRRKVQRTVDPGNSEHMFFPTSADEQYKFNIYYQGLDTVLKHLKLYFSE---FDYCKMKQISELLLKWNEPLNEATAKHIQEFYK--LDADIIPELRFYRQYAGFNFIAEDGSLSFIDLGSLFIQHALHNNIPCITKLLHIALSWPITSANNEKSFSTLSHLKTYLLRTMGQEKLSSLALIAVEQELVNKLMEPERLGGIVEKF 878          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Mouse
Match: Zmym1 (zinc finger, MYM domain containing 1 [Source:MGI Symbol;Acc:MGI:1915560])

HSP 1 Score: 110.923 bits (276), Expect = 2.149e-24
Identity = 137/612 (22.39%), Postives = 260/612 (42.48%), Query Frame = 1
Query:  394 NSVMEQTIEINRKKLLPIVKTVVFCAINNIPFRGKTDKTAIFNN-----LLQFRI-DAGD--SILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNL-VINDLNDVCEIRNEVGTIKSIINFFRESSLRRKHIPNIPLFC-------------ETRWTAKYKSVRIFKENIIVIIEALHKLSLN-GNINTTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEINIELI----PPRTVKMQTCRTNIPSDSPESY--------YRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAELFY------PSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRF 2106
            +SV  + IE N+K L  I++ ++F     +  +G     +  N      LL+ R  D G+   ++S+H+        Y S  VQ E+I +  D + ++I  +   S   SII +E    +   QLS+ +R+  K + +    ++ FLGFV  E +   ++   I + L + G+D +K+ G+AYD  +    K++ V      + P A + H  +H L L VI+   +V E+R  + T+ S+ N    S    + + ++   C             ++ W A    +    + +  ++E L  +S              L    T   F  CL  +Y   S+   ++   Q    ++ ++  +I +++E + + +      F N+W+  +    +I  +      P    + +  RT  P +S   +        Y+ +I+   LDT++  L+  F E     Y         + K ++   E     I   Y   L+        +Y  Y  +   +E  S  F  L +  + +      P + + L I L    T+   ++SFSTL  +KT+L  TM + +L +L ++ + + LVN+L+E      I+++F
Sbjct:  382 SSVYSKQIEGNKKYLRLIIENILFLGKQCLLLKGNDQSVSPMNKGSFLELLELRARDRGEVFQLMSSHVD------FYSSTLVQEEIIEMIKDEMLQDIVSEINASSAFSIICEEIAGSAAERQLSVCVRYPQK-TPSAVLVKERFLGFVTAEEVTGVHVHGRIKAYLQQVGVDFNKICGQAYDSATNFTVKLNEVVAEFKKEEPRALYVHCHAHFLELAVISFCKEVKELREALHTLCSLFNTVHVS---EEMLASLQTMCKLSLNKTCKKHTSQSCWPAHDHLLLAVTDCLPEVVEVLASVSRRCAGTAVAAELEDLLAMVTKFEFIFCLKFLYRVLSITGILSREFQSETVDIFSLFSKIEAILECLSSERN--DTYFKNIWDGADEICKKITSKGFDVEKPSFQKRRKVQRTVDPGNSEHMFFPTSADEQYKFNIYYQGLDTVLKHLKLYFSE---FDYCKMKQISELLLKWNEPLNEATAKHIQEFYK--LDADIIPELRFYRQYAGFNFIAEDGSLSFIDLGSLFIQHALHNNIPCITKLLHIALSWPITSANNEKSFSTLSHLKTYLLRTMGQEKLSSLALIAVEQELVNKLMEPERLGGIVEKF 976          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Mouse
Match: Zmym1 (zinc finger, MYM domain containing 1 [Source:MGI Symbol;Acc:MGI:1915560])

HSP 1 Score: 110.923 bits (276), Expect = 2.149e-24
Identity = 137/612 (22.39%), Postives = 260/612 (42.48%), Query Frame = 1
Query:  394 NSVMEQTIEINRKKLLPIVKTVVFCAINNIPFRGKTDKTAIFNN-----LLQFRI-DAGD--SILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNL-VINDLNDVCEIRNEVGTIKSIINFFRESSLRRKHIPNIPLFC-------------ETRWTAKYKSVRIFKENIIVIIEALHKLSLN-GNINTTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEINIELI----PPRTVKMQTCRTNIPSDSPESY--------YRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAELFY------PSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRF 2106
            +SV  + IE N+K L  I++ ++F     +  +G     +  N      LL+ R  D G+   ++S+H+        Y S  VQ E+I +  D + ++I  +   S   SII +E    +   QLS+ +R+  K + +    ++ FLGFV  E +   ++   I + L + G+D +K+ G+AYD  +    K++ V      + P A + H  +H L L VI+   +V E+R  + T+ S+ N    S    + + ++   C             ++ W A    +    + +  ++E L  +S              L    T   F  CL  +Y   S+   ++   Q    ++ ++  +I +++E + + +      F N+W+  +    +I  +      P    + +  RT  P +S   +        Y+ +I+   LDT++  L+  F E     Y         + K ++   E     I   Y   L+        +Y  Y  +   +E  S  F  L +  + +      P + + L I L    T+   ++SFSTL  +KT+L  TM + +L +L ++ + + LVN+L+E      I+++F
Sbjct:  382 SSVYSKQIEGNKKYLRLIIENILFLGKQCLLLKGNDQSVSPMNKGSFLELLELRARDRGEVFQLMSSHVD------FYSSTLVQEEIIEMIKDEMLQDIVSEINASSAFSIICEEIAGSAAERQLSVCVRYPQK-TPSAVLVKERFLGFVTAEEVTGVHVHGRIKAYLQQVGVDFNKICGQAYDSATNFTVKLNEVVAEFKKEEPRALYVHCHAHFLELAVISFCKEVKELREALHTLCSLFNTVHVS---EEMLASLQTMCKLSLNKTCKKHTSQSCWPAHDHLLLAVTDCLPEVVEVLASVSRRCAGTAVAAELEDLLAMVTKFEFIFCLKFLYRVLSITGILSREFQSETVDIFSLFSKIEAILECLSSERN--DTYFKNIWDGADEICKKITSKGFDVEKPSFQKRRKVQRTVDPGNSEHMFFPTSADEQYKFNIYYQGLDTVLKHLKLYFSE---FDYCKMKQISELLLKWNEPLNEATAKHIQEFYK--LDADIIPELRFYRQYAGFNFIAEDGSLSFIDLGSLFIQHALHNNIPCITKLLHIALSWPITSANNEKSFSTLSHLKTYLLRTMGQEKLSSLALIAVEQELVNKLMEPERLGGIVEKF 976          
BLAST of Repressor of the inhibitor of the protein kinase vs. UniProt/SwissProt
Match: sp|O43422|P52K_HUMAN (52 kDa repressor of the inhibitor of the protein kinase OS=Homo sapiens OX=9606 GN=THAP12 PE=1 SV=2)

HSP 1 Score: 155.992 bits (393), Expect = 5.906e-38
Identity = 140/585 (23.93%), Postives = 277/585 (47.35%), Query Frame = 1
Query:  424 NRKKLLPIVKTVVFCAINNIPFRG-KTDKTAI-------FNNLLQFRIDAGDSILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYIS---ETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVINDLNDVCEIRNEVGTIKSIINFFRESSLRRKHIPNI--PLF-------------CETRWTAKYKSVRIFKENIIVIIEALHKLSLNGNIN----TTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQIT----SLVELIKNHQKFAKDNFHNLW-EKMEACLSEINIELIPPRTVKMQTCRTNIPSD-SPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAEL-FYPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNEL 2067
            N++ L  + + ++     NIP  G + D+          F  LL+ RI++G+ +L    ++   N  + S   Q +++ IC   +RE    + + S F SII D+  DI+G E L + +RF+++        R+EF+GF+P E  DA+ ++    T+I+   K+GL++    G+AY   S  + K+  V  R+ ++YP A +   SS  LN+ +     V  +   +GTI+ + +FF  S      + N+   LF             C ++WT ++ +  I  E +  ++  L  ++ + NI        R+  L  A +D  F + + ++    S       NLQG   ++      +T    SL E+++N +      +H  W E+     ++++I++  P   + +  + N+ S  + ESYY++++ +P ++ +I  L++ F E++  +    +L PS M +L  N  E     ++       +   AE   W   +K      E  S +++AL   ++ F+P+V+  L +  I+       +R  +   ++K +LR+T+ + R   L ++ I+ ++ ++L
Sbjct:  162 NKEYLKSLFEILILMGKQNIPLDGHEADEIPEGLFTPDNFQALLECRINSGEEVLRKRFETTAVNTLFCSKTQQRQMLEICESCIREETLREVRDSHFFSIITDDVVDIAGEEHLPVLVRFVDESHN----LREEFIGFLPYE-ADAEILAVKFHTMITE--KWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAIYTLCSSCALNMWLAKSVPVMGVSVALGTIEEVCSFFHRSPQLLLELDNVISVLFQNSKERGKELKEICHSQWTGRHDAFEILVELLQALVLCLDGINSDTNIRWNNYIAGRAFVLCSAVSDFDFIVTIVVLKNVLSFTRAFGKNLQGQTSDVFFAAGSLTAVLHSLNEVMENIEV-----YHEFWFEEATNLATKLDIQMKLPGKFR-RAHQGNLESQLTSESYYKETLSVPTVEHIIQELKDIFSEQHLKALKCLSLVPSVMGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDL 733          
BLAST of Repressor of the inhibitor of the protein kinase vs. UniProt/SwissProt
Match: sp|Q9CUX1|P52K_MOUSE (52 kDa repressor of the inhibitor of the protein kinase OS=Mus musculus OX=10090 GN=Thap12 PE=2 SV=2)

HSP 1 Score: 154.066 bits (388), Expect = 2.400e-37
Identity = 144/593 (24.28%), Postives = 277/593 (46.71%), Query Frame = 1
Query:  424 NRKKLLPIVKTVVFCAINNIPFRG-KTDKTAI-------FNNLLQFRIDAGDSILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLV-KFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVINDLNDVCEIRNEVGTIKSIINFFRESSL------------------RRKHIPNIPLFCETRWTAKYKSVRIFKENIIVIIEALHKLSLNGNINT----------TQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQIT----SLVELIKNHQKFAKDNFHNLW-EKMEACLSEINIEL-IPPRTVKMQTCRTNIPSD-SPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAEL-FYPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNEL 2067
            N++ L  + + +V     NIP  G + D+          F  LL+ RI++G+ +L    ++   N  + S   Q  ++ IC   +RE    + + S F SII D+  DI+G E L + +RF++         R+EF+GF+P E  DA+ ++    +++  K+GL++    G+AY   S  + K+  V  R+ ++YP A +   SS  LN  +     V  +   +GTI+ + +FF  S                    R K +  I   C ++WT ++ +  I    ++ +++AL  L L+G IN+            R+  L  A TD  F + + ++    S       NLQG   ++      +T    SL E+++N +      +H  W E+     ++++I++ +P +  + Q  + N+ S  + ESYY+ ++ +P ++ +I  L++ F E++  +    +L PS M +L  N  E     ++       +   AE   W   +K      E  S +++AL   ++ F+P+V+  L +  I+       +R  +   ++K +LR+T+ + R   L ++ I+ ++ ++L
Sbjct:  158 NKEYLKSLFEILVLMGKQNIPLDGHEADEVPEGLFAPDNFQALLECRINSGEEVLRKRFEATAVNTLFCSKTQQRHMLEICESCIREETLREVRDSHFFSIITDDVVDIAGEEHLPVLVRFVDDAHN----LREEFVGFLPYE-ADAEILAVKFHTTITEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAVYTLCSSCALNAWLAKSVPVIGVSVALGTIEEVCSFFHRSPQLLLELDSVISVLFQNSEERAKELKEI---CHSQWTGRHDAFEI----LVDLLQAL-VLCLDGIINSDTNVRWNNYIAGRAFVLCSAVTDFDFIVTIVVLKNVLSFTRAFGKNLQGQTSDVFFAASSLTAVLHSLNEVMENIEV-----YHEFWFEEATNLATKLDIQMKLPGKFRRAQ--QGNLESQLTSESYYKDTLSVPTVEHIIQELKDIFSEQHLKALKCLSLVPSVMGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDL 730          
BLAST of Repressor of the inhibitor of the protein kinase vs. UniProt/SwissProt
Match: sp|Q5SVZ6|ZMYM1_HUMAN (Zinc finger MYM-type protein 1 OS=Homo sapiens OX=9606 GN=ZMYM1 PE=1 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 2.265e-28
Identity = 146/609 (23.97%), Postives = 278/609 (45.65%), Query Frame = 1
Query:  397 SVMEQTIEINRKKLLPIVKTVVFCAINNIPFRGKTDKTAIFNN-----LLQFRI-DAGDS---ILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNL-VINDLNDVCEIRNEVGTIKSIINFFRESSLRRKHIPNIPLFCETR----------WTAKYKSVRIFKENIIVIIEALHKL-SLNGNINTTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEI---NIELIPPRTVKMQTCRTNIP---SD------SPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAELFY------PSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRF 2106
            S+  + IE N+K L  I++ ++F     +P RG     +  N      LL+ R  D G+    ++++ +        Y S ++Q+++I I    + ++I  +   S   SII DE+ + +  EQLSI +R+  K S+     ++ FLGFV  E M   ++  TI + L + G+D+ K+ G+AYD  + +  K + +      + P A + H  +H L+L +I    +V E+R+ + T+ S+ N    S     +  NI    + +          WT   +++    +++  IIE L  + S + N +     S L    +   F  CL  +Y   S+   ++  LQ    ++ ++  +I +++E + + +      F  +W+  E    +I     ++  P   K +  + ++    SD      S E  Y+ +I+   LDT++ +L+  F E     Y         + K ++   E     +  ++    E+   E   + HY K      +S  N F +L    + +      P + + L I L    T+ +T+ SFSTL ++KT+L +TM + +L    +M + + LVN+L+E    +EI+++F
Sbjct:  541 SIHSKQIEGNKKYLKLIIENILFLGKQCLPLRGNDQSVSSVNKGNFLELLEMRAKDKGEETFRLMNSQVD------FYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYPQK-SSKAILIKERFLGFVDTEEMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTTNLKIKFNKIAAEFKKEEPRALYIHCYAHFLDLSIIRFCKEVKELRSALKTLSSLFNTICMSGEMLANFRNIYRLSQNKTCKKHISQSCWTVHDRTLLSVIDSLPEIIETLEVIASHSSNTSFADELSHLLTLVSKFEFVFCLKFLYRVLSVTGILSKELQNKTIDIFSLSSKIEAILECLSSERNDV--YFKTIWDGTEEICQKITCKGFKVEKPSLQKRRKIQKSVDLGNSDNMFFPTSTEEQYKINIYYQGLDTILQNLKLCFSE---FDYCKIKQISELLFKWNEPLNETTAKHV-QEFYKLDEDIIPELRFYRHYAKLNFVIDDSCIN-FVSLGCLFIQHGLHSNIPCLSKLLYIALSWPITSASTENSFSTLPRLKTYLCNTMGQEKLTGPALMAVEQELVNKLMEPERLNEIVEKF 1135          
BLAST of Repressor of the inhibitor of the protein kinase vs. TrEMBL
Match: A0A0J7NNB2 (52 kDa repressor of the inhibitor of the protein kinase-like protein OS=Lasius niger OX=67767 GN=RF55_5874 PE=4 SV=1)

HSP 1 Score: 533.102 bits (1372), Expect = 2.095e-175
Identity = 272/595 (45.71%), Postives = 392/595 (65.88%), Query Frame = 1
Query:  337 SQ*FYQIIQNKRRNVAEMMNSVMEQTIEINRKKLLPIVKTVVFCAINNIPFRGKTDKTAIFNNLLQFRIDAGDSILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFI--NKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVINDLNDVCEIRNEVGTIKSIINFFRESSLRRKHIPNIPLFCETRWTAKYKSVRIFKENIIVIIEALHKLSLNG-NINTTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEINIELIPPRTVKMQTCRTNIPSDSPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAELFYPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRFGR 2112
            S+ F +I+  ++ +V E ++S   + +E NR KL  I+ T++FC  +++P RGK+D+ ++F +LL FRI++GD +L NHL+S   N+ YISH++QN+LI   +DVL+  I E+ K +   S++ADE+ DISG EQLSIG+R++  ++ +     C +EFLGFVPL+ +++K ISETII  L    LDL+++VG+ YDGC+ MA  ISGVQK I D+YP A F+H +SH LNLVINDLNDV E+RN  GT K IINFFRES+LRR  IPNIPLFCETRW+AKYKS+RIF EN   I+ AL +LS N  N  T   + QLY   T  T+ + L ++  YS+ L PV N LQ V+ N+  +   +  L  + ++H+  A   F  ++EK +    E++IE   PR    QT R+N PS++ E ++R+SIFIPYLD++I+SL +RF   ++ ++S+  L P ++KKLD+  +  +   I + YG  L N+ AE+ TWY  +K     +ES+    D +  A  FYP+V  A+ IGL + ATTC+ +RSFSTL ++KTW RSTM + RL  LCM+ +HR  V E  E  F   + + FG+
Sbjct:  162 SKNFEKIMDRQQLSVHEALDSAYHKEVEENRVKLRSIISTILFCGQHDLPVRGKSDEGSVFRDLLHFRIESGDKVLKNHLESGAKNSLYISHQIQNDLIQTYSDVLKGKIIEEVKRASVFSVLADETADISGTEQLSIGVRYLRCDQKNKKPIIC-EEFLGFVPLQELNSKSISETIIRFLENCDLDLNRLVGQGYDGCAAMAGHISGVQKLINDKYPMALFFHCASHILNLVINDLNDVNEVRNTAGTTKEIINFFRESTLRRNMIPNIPLFCETRWSAKYKSIRIFSENFSTIVRALKELSENAPNSKTKVNAHQLYTTATTPTYIVTLLVIAIYSAKLEPVCNQLQQVNMNIKAINDHVAKLTNVPQSHRNNALIQFTAIFEKAQKICEELDIEFKRPRVAARQTQRSNQPSENVEDFFRRSIFIPYLDSIISSLRDRFSSTHEKAFSLMQLHPDALKKLDKVSFLAVAEDINSLYGDILSNFIAEATTWYEMWKNEATPNESLEYA-DLICQATPFYPAVAEAIKIGLTLPATTCSIERSFSTLRRIKTWNRSTMGDKRLSGLCMLSVHRKRVQEDTE--FIDNVTNEFGK 752          

HSP 2 Score: 89.3521 bits (220), Expect = 1.858e-14
Identity = 39/80 (48.75%), Postives = 52/80 (65.00%), Query Frame = 2
Query:  119 RTFRHTWLHDYPEMSYSAKLKGVVCRTCVLFKPHVDRGIQGAFILKEFTKYKKFHECAKLHI*SKWHRESINKANNFTRL 358
            R FR  WL  YP ++YSA  KG +CR CVLF+P   RG+QG FI+    KY KFHE A+ H  ++WHR +I  + NF ++
Sbjct:   89 RAFRSEWLTTYPWLTYSAIAKGPLCRVCVLFRPPAQRGLQGQFIVSPCLKYHKFHEAAQSHATTQWHRNAIVSSKNFEKI 168          
BLAST of Repressor of the inhibitor of the protein kinase vs. TrEMBL
Match: A0A1Y1MTC6 (Uncharacterized protein (Fragment) OS=Photinus pyralis OX=7054 PE=4 SV=1)

HSP 1 Score: 507.679 bits (1306), Expect = 5.972e-168
Identity = 257/566 (45.41%), Postives = 366/566 (64.66%), Query Frame = 1
Query:  436 LLPIVKTVVFCAINNIPFRGKTDKTAIFNNLLQFRIDAGDSILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEH-MDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVINDLNDVCEIRNEVGTIKSIINFFRESSLRRKHIPNIPLFCETRWTAKYKSVRIFKENIIVIIEALHKLSLNGNINTTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEINIELIPPRTVKMQTCRTNIPSDSPE----SYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNV--FDALKAAELFY-PSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRFG 2109
            L  I+ TVVFCA +N+P RGKTD+ AIFN+LL FR ++GD+IL  HL+S P NA YISH VQNE+I  C  +LR ++  + K +   SI+ADES DI+GIEQLS+G+RF +K    +   ++EFLGF PL H +DA+ I+  I ++L  +GL+L   VG+ YDGCSTMA KI+GV KRI + +P ANF+H +SHRLNLVINDLN V +IRN V T+K +  FFRE+S RR  + ++   CETRW+ KYKS+R F    + I+E LH LS  GN +T Q++ QLY A T + F +CL I+ +YS+ L  VA  LQGV+ +L+ V K I  LVE++   ++  ++ F  L + +     ++ + L  PR  K Q  R+N+PS S       YYR+S+FIPYLD+LI +L ERF + N  ++ +FNL P +MK L + EYE     I   YG+ L+N+  E   WY  +     ++ES++ +   + L     F+ P+V +A+ I + +  TTCT +RSFSTL +VKTW+RS+M   RL  LC+M +H++L+ +  +  F  + ID F 
Sbjct:    1 LKSIISTVVFCATHNLPLRGKTDEHAIFNDLLHFREESGDAILEEHLRSAPKNAKYISHEVQNEIIDTCAAILRTDLVNNIKSNEIYSIMADESMDIAGIEQLSLGVRFYDK---KDKVIKEEFLGFTPLHHGLDAETIANAITNTLTNWGLNLQYAVGQGYDGCSTMAGKITGVHKRISESFPMANFFHCASHRLNLVINDLNAVPQIRNTVATVKEVTKFFRENSQRRAVVGSLQKLCETRWSEKYKSIRKFHAKFVNIVEGLHLLSNEGNKDTKQKAFQLYSAVTSTVFIVCLEIVAKYSAQLEIVAQMLQGVEVDLMRVSKHIERLVEVLGADRQNDENEFTALMKNVAKTAEDLGLTLTTPRVTKKQCHRSNVPSSSGSMNIADYYRRSVFIPYLDSLIQALRERFSDRNQEAFELFNLHPKNMKALTRKEYEHSLEVILRSYGSLLDNFMTEGLLWYDLWTRDNASAESVNKICLVELLDHNHAFFLPNVSKAIQIAITLPPTTCTIERSFSTLKQVKTWIRSSMANSRLSGLCLMSVHKDLIQQ-SKDAFIEKSIDLFA 562          
BLAST of Repressor of the inhibitor of the protein kinase vs. TrEMBL
Match: A0A151K1Z3 (52 kDa repressor of the inhibitor of the protein kinase OS=Cyphomyrmex costatus OX=456900 GN=ALC62_00168 PE=4 SV=1)

HSP 1 Score: 478.404 bits (1230), Expect = 4.077e-156
Identity = 255/601 (42.43%), Postives = 385/601 (64.06%), Query Frame = 1
Query:  334 QSQ*FYQIIQNKRRNVAEMMNSVMEQTIEINRKKLLPIVKTVVFCAINNIPFRGKTDKTAIFNNLLQFRIDAGDSILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINE--DAK*SPFLSIIADESCDISGIEQLSIGIRFI--NKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVINDLNDVCEIRNEVGTIKSIINFFRESSLRRKHIPNIPLFCETRWTAKYKSVRIFKENIIVIIEALHKLSLNGNIN--TTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDN-FHNLWEKMEACLSEINIELIPPRTVKMQTCRTNIPSDSPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAELFYPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRFGRN 2115
            +S+ F  +I NK++++   +N    + I  NR KL  I+ ++VFC  +++  RGK   +  F +LL+FRI+AGDS+L  H ++C     Y SHRVQNEL+ IC  V+R+NI E  + + +   S++ADE+ DISGIEQLSIG+RF+  N  S +   C +EFLGFVPLE ++A++I+  I+S   +  +++SK+VG  +DGCSTMA    GVQ+ I D++  A F+H +SHRLNLV+NDLN V  ++N VGTIK +I FFRES+LRR  I NIP+ CETRW+AKYKS+R+F EN I I + L  L  N  +N  T  R+ QL  A ++++F +C+ I+ +YS+ML PV N LQG+  ++++V+K +  L++  + H++   D+ F  +++   A      ++   PR V  QT R N  + S   YY+KSIFIPYLD+L++SL  RF  +N+ ++ ++NL P  ++K +Q E+      I + Y   +EN+ AE+  WY+Y+          + + D L+  + F+ ++ +A+ I + +  TTCT +RSFSTL +VKTWLRSTM E RLD+LCM+ IHR  V    E  F   ++D F +N
Sbjct:    2 KSKLFSDVITNKKKSIDLQLNDANNELIVKNRDKLRSIISSIVFCGTHDLALRGKQSDSGNFQDLLKFRIEAGDSVLEEHFKTCTVRTKYTSHRVQNELLNICGLVIRKNIIEKINNENTIAFSLLADETADISGIEQLSIGVRFVEKNNDSVSTRIC-EEFLGFVPLEKLNAEHIALEILSFCKRNDINMSKLVGLGFDGCSTMAGTEGGVQRLIRDKHNKALFFHCASHRLNLVVNDLNIVRGVQNTVGTIKDVIKFFRESTLRRNLICNIPMLCETRWSAKYKSIRVFSENFIEIKKVLDSLPTNAEVNRATRARAQQLSSATSETSFIVCMQIIAKYSAMLEPVTNALQGISVDMISVQKHVNILLDTFRRHRESDLDSTFDIIFKTATAVAQHFEVKFKIPRIVGKQTYRANYDAKSVMDYYKKSIFIPYLDSLLSSLNNRFSSQNNAAFLLYNLHPYYLRKKNQKEFMDTIKIINDFYH--IENFNAEAEIWYNYWNNNDIVITDETLILDLLQHCQ-FFKAIAQAIEILICLPPTTCTIERSFSTLRRVKTWLRSTMSEDRLDSLCMLSIHRAFVFNNKE-SFVESVLDVFSKN 597          
BLAST of Repressor of the inhibitor of the protein kinase vs. TrEMBL
Match: A0A5G3KNV0 (T-box 18 OS=Xenopus tropicalis OX=8364 GN=tbx18 PE=4 SV=1)

HSP 1 Score: 465.692 bits (1197), Expect = 8.043e-151
Identity = 240/590 (40.68%), Postives = 361/590 (61.19%), Query Frame = 1
Query:  346 FYQIIQNKRRNVAEMMNSVMEQTIEINRKKLLPIVKTVVFCAINNIPFRGKTDKTAIFNNLLQFRIDAGDSILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVINDLNDVCEIRNEVGTIKSIINFFRESSLRRKHIPNIPLFCETRWTAKYKSVRIFKENIIVIIEALHKLSLNGNINTTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEINIELIPPRTVKMQTCRTNIPSDSPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAELFYPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRFGRN 2115
            F  +  +  +++   +NS ++  +E NRKKL  ++ T+VFC  ++I  RGKT  +     L  FRI++GD IL NHL++ P NA             +C D+LRE I   A  S   S+IADES DISG EQLS+G+RF++ ++      R+EFLGF  L+  DA  I+  I+   +KFGL++ K+ G+ YDGCSTMA K  GVQ +I ++YP A F H +SH+LNLV+N+LN V EIRN +G++K+II FFRES  RR  IPN+PL CETRWTAKYKS+R+F EN   I + L  L    +   +Q + QL    + STF  CL IM  YS+ L P+   LQ V+ ++      +  L+++  NH++ A+++F ++   ++      +IEL  PR    Q   +N+P  + E YYR++I++PYLD++I SL+ RF   N  ++++F+L P  M K+ Q E++     I + Y   ++N  AE+ TW+  + + K+  +  + + D L   +L  P+V +A+ I L +  TTCT +RSFS++ +VKTWLRSTM   RL  LCMM +HR++VNE     F  E++D+F ++
Sbjct:   46 FINVRSHPEQSIVCQVNSAVKHQVEENRKKLYSVLSTIVFCGTHDIALRGKTSTSGNVQALYDFRIESGDEILKNHLKNAPVNAL------------LCEDILRERIISAANNSVGFSVIADESADISGHEQLSLGVRFVD-LTITPVKIREEFLGFATLKAFDATSIANVIMEQCIKFGLNIDKLYGQGYDGCSTMAGKEGGVQAKIKEKYPRAIFVHCASHKLNLVVNNLNAVPEIRNAIGSVKAIIKFFRESPKRRSLIPNVPLLCETRWTAKYKSIRVFSENFDRIFQQLRDLVSTASGKISQEAHQLLCCSSTSTFLFCLVIMATYSARLEPLTQALQAVEMDIAKAHSHVQELIQMFLNHRQQAEEHFKDILVNVQNIAERTDIELSLPRRCGRQKHHSNVPGSTVEEYYRRAIYVPYLDSVIASLKTRFDCHNITNFNLFSLHPHQMAKIKQQEFKEKIKQITSIYN--IDNLDAEALTWFDLW-SGKEKQDFQNGLLDLLPYTDLI-PAVRQAILIALTLPVTTCTVERSFSSMRRVKTWLRSTMTVNRLSGLCMMSLHRDIVNE-NRPQFIHEVVDKFAQD 617          
BLAST of Repressor of the inhibitor of the protein kinase vs. TrEMBL
Match: X1WYT3 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=1)

HSP 1 Score: 467.233 bits (1201), Expect = 1.374e-149
Identity = 252/596 (42.28%), Postives = 366/596 (61.41%), Query Frame = 1
Query:  337 SQ*FYQIIQNKRRNVAEMMNSVMEQTIEINRKKLLPIVKTVVFCAINNIPFRGKTDKTAIFNNLLQFRIDAGDSILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFI---NKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVINDLNDVCEIRNEVGTIKSIINFFRESSLRRKHIPNIPLFCETRWTAKYKSVRIFKENIIVIIEALHKLSLNGNINTTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEINIELIPPRTVKMQTCRTNIPSDSPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFL-ENYQAESATWYHYYKTYKDASESISNVFDALKAAELFYPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRFGR 2112
            SQ F    + K+ +V E ++S   + IE NR KL  I+ +++FCA +++P RGK D+ ++F +LLQFR+++GD +L+ HL+S   NA YISH VQNELI  C +VLR+NI E+ K S   S++ADE+ DISG EQLSIG+R++    K   ++ C  +EFLG+ PL  +D+K I++TII  L    LDL+++VG+ YDGC+TMA  ISGVQK I + YP A F+H +SH LNLV NDLN+V E+RN  G IK IINFFRES+LRR+ IPNIPL CETRW+AKYK                                          F + L ++  YS+   PV N LQ V+ NL TV   IT LV+ ++ ++  A   F  L+ K +    E+++E+ PPR    Q+ R+N PS + E ++R SIF+PYLD++I+SL++RF + ++ S+ + +L P +MK + + ++   +N I   YG  L  N+  E+ TWY  +   +   +SI    D ++ ++ FYP+V  A+ IG  +  TTC+ +RSFSTL +VKTW R+TM + RL  LCMM +HR  + E  +  F    I+ FG+
Sbjct:  208 SQHFLNSKERKQLSVHEQIDSAFNREIEENRVKLRSIISSILFCAKHDLPLRGKNDEGSVFTDLLQFRVESGDEVLNKHLKSGAKNALYISHEVQNELIKTCANVLRQNIIEEVKLSSVFSVLADETADISGTEQLSIGVRYLFYDVKFQKHKIC--EEFLGYSPLTKLDSKSIAKTIIEFLESCNLDLNRLVGQGYDGCATMAGHISGVQKLINEAYPMALFFHCASHVLNLVFNDLNNVSEVRNTTGIIKEIINFFRESTLRRQIIPNIPLLCETRWSAKYK-----------------------------------------IFIVTLQVIAVYSAKFEPVCNLLQQVNINLKTVNNHITKLVDTLQLYRNCASTEFTVLFAKSKEIAEELDVEIRPPRVAARQSQRSNHPSTNYEEFFRISIFVPYLDSIISSLKDRFSKIHNQSFFLMDLHPYAMKNMSKEQFICTSNDIVKLYGNILSSNFVTEATTWYEMWNNGEKPLDSIE-YLDLIEMSKDFYPAVADAIKIGATLPTTTCSIERSFSTLRRVKTWNRATMCDNRLSGLCMMSVHRKRLGE--DTKFIENSIEEFGK 757          

HSP 2 Score: 88.1965 bits (217), Expect = 4.566e-14
Identity = 40/78 (51.28%), Postives = 54/78 (69.23%), Query Frame = 2
Query:  116 SRTFRHTWLHDYPEMSYSAKLKGVVCRTCVLFKPHVDRGIQGAFILKEFTKYKKFHECAKLHI*SKWHRESINKANNF 349
            +R FR  W   YP +SYSA  KG +CR CVLF+P V RG+QGAFI+    KY+KF+E +K H  S WH+++IN + +F
Sbjct:  134 TRVFRIEWFALYPWLSYSAVSKGPLCRVCVLFRPRVHRGVQGAFIVSPCIKYQKFNEVSKAHEISIWHKDAINASQHF 211          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Cavefish
Match: ENSAMXT00000042930.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:25471427:25473738:-1 gene:ENSAMXG00000037442.1 transcript:ENSAMXT00000042930.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.214 bits (378), Expect = 2.011e-37
Identity = 163/595 (27.39%), Postives = 265/595 (44.54%), Query Frame = 1
Query:  436 LLPIVKTVVFCAINNIPFRGKTDKTAIFN--NLLQFRID---AGDSILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFI--------NKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKF-GLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVINDL-NDVCEIRNEVGTIKSIINFFRES----SLRRKHI---PNIPLFCETRWTAKYKSVRIFKENIIVIIEALHKLSLNGNINTTQRSSQ-LYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEINIE--LIPPRTVKMQTCRTNIPSD----SPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQ---NEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAELFYPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYI--HRNLVNELIE--KGFYSEIIDRFGR 2112
            L+ I    +  A  N+ FRG  +K    N  N L   ID     D +L   L    SN  Y+S  +QNELI + +  + + I  + K + F S+I D + D+S ++QLS   R++        N ++ +     + FLGF  +    A+ + ET I+ L++  GL L K  G+ YDG STM+   SGVQKRI D+ P A + H ++H LNLV+ND    + EI+     ++ +  FF +S     L   H+   P +   C TRW ++  ++   +     I++AL K++L    +  +  +  L  A     F +   I  +    +  V+  LQ  D +LL    Q  SL+          +D F NL    +   S   I       RT +++     +  D    +PE  ++ ++F   +DT+++ +  RF   + ++     L P+ + +      NE  +    I+N                       +D S   S+   + + A L    V  AL + L I  T  + +RSFS L  +K +LRSTM + RL  L M+ I   R+   +L E  K F  + + R GR
Sbjct:   76 LMRITDVTLTLASCNLAFRGHREKVGELNSGNFLSV-IDLLARYDPVLRELLDK-KSNVNYLSPSIQNELIALLSQRVHDEIVSEIKEAEFYSVIMDTTQDLSKVDQLSQVFRYVTVRKDEADNAIAVD---INESFLGFQNISDQTAQGL-ETKITELIQSNGLLLHKCRGQGYDGASTMSGIYSGVQKRILDKEPNAVYVHCAAHNLNLVLNDACQHITEIKEYYDILQRLYVFFSQSIKRWELLENHLKSKPTLKRLCPTRWASRRDALYALRFRYADILQALTKITLRSKKSDERTEAMGLLKAMEAFEFVMMTVIQEKILETINIVSQVLQKKDVDLL----QAASLLGNATCTLAQLRDQFDNLKCTAQGLASSWGIRCNFRHKRTRRIKRHFDELTEDQCLTNPEEIFKVNVFYMCIDTVVSQVRTRFHGMDSVTRKFQFLCPTELLRASDEALNESAQTLAAIYN-----------------------EDLSSEFSSQLLSFRNA-LGVTDVATALKLFLTIPVTVASAERSFSKLKMIKNYLRSTMSQDRLSGLAMLSIESQRSRRMDLTEIVKEFAQKNVRRRGR 636          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Cavefish
Match: ENSAMXT00000032220.1 (pep primary_assembly:Astyanax_mexicanus-2.0:24:13450075:13452201:1 gene:ENSAMXG00000029800.1 transcript:ENSAMXT00000032220.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.976 bits (367), Expect = 5.082e-36
Identity = 161/651 (24.73%), Postives = 283/651 (43.47%), Query Frame = 1
Query:  301 YIIKVASRINKQSQ*FYQIIQNKRRNVAEMMNSVMEQ---TIEINRKKLLPIVKTVVFCAINNIPFRG-----KTDKTAIFNNLLQFRIDAGDSILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKFGLDL-SKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVIND-LNDVCEIRNEVGTIKSIINFFRESSLRRKHIP-----------NIPLFCETRWTAKYKSVRIFKENIIVIIEALHKLSLNGNINTTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEINIELIP--PRTVKMQT-----------CRTNIPSDSPESYYRKSIFIPYLDTLITSLEERFPEEN-DISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASE-----SISNVFDALKAAELFYP------SVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRFGRN 2115
            + I   S  +KQ+   ++  Q   +N A ++N++ ++    I  NR  +  I + ++  A  NI  RG      +D    F  +L+  I   D  +   L S   NA Y S  +QNE++    D++R  I E+ K S   SI+ DE+ D+   EQ+S+ +R+    + +E      FL F   + +DA  +++ II  L   GL+    +VG+AYDG S M+ K +GVQ RI +Q   A + H S+H LNLV+ D +  V E       ++ +  F   S + +K +             +    +TRW  +Y S+R   + +  I   L +++   + + +  +  L  A  D  F + L    +       +++ LQ    +L      + +L++ + +++   +  F +LW ++     + +  + P   R  K+ +            +    S+  +  +R   F P LD ++T L  RF   N D+   I  L P S   L +       + +F    +F + Y++      H    ++   E          F  ++ A    P       +++   + + I  TT + +RSFSTL  VKT+LRSTM + RL  L ++ I       L       E +D F RN
Sbjct:   19 FAIHARSERHKQAMIAWRDYQKAVKNDATLLNALNKEHNKQITENRDYIKTIAEVLLLTATQNIAQRGHNESADSDNKGNFMAILE-TIAKHDKTVKKRLTSI-HNAKYTSKVIQNEVLSCLADMVRTKIIEEVKDSEVFSIMVDETKDVKKKEQISLVVRYYFSGAVHE-----SFLHFESADRLDAAGLTDKIIHILQSHGLEYRDNLVGQAYDGASVMSGKYTGVQARIKEQAKHAFYVHCSAHCLNLVLVDTVKTVPEADQFFSLLERLYVFTSGSYVHQKWLSVQKEMYEGAPRELQRLSDTRWACRYMSLRNIIDRLPAIKRVLQEIAHEHHGDRSVEARGLL-AQIDLQFIVYLVTFCKVFGETKLLSDMLQSPSLDLSKAVDLVEALIQTLNDYRN--ESFFDSLWNEVLTTAEQCDTAVQPTAKRQKKLSSKLGGHCVLSTVGQKRSDSELEKESFRTGFFYPVLDHILTELNRRFSSRNCDLMNGIQALNPKSDGFLKE-------DTLF----SFAKMYESNIEDLGHELHQFRRILERKIQTGTPRPFSVVELASFMEPYKEVFFELYKLCKVAVSIPVTTASCERSFSTLKLVKTYLRSTMTDERLSNLGVLSIESRRAKTL----NLEEFVDLFARN 644          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Cavefish
Match: ENSAMXT00000035789.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000101.1:2843018:2852765:1 gene:ENSAMXG00000037827.1 transcript:ENSAMXT00000035789.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.591 bits (366), Expect = 5.984e-36
Identity = 140/517 (27.08%), Postives = 237/517 (45.84%), Query Frame = 1
Query:  589 SNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFI---NKMSTNEFCC--RKEFLGFVPLEHMDAKYISETIISSLVKF-GLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVINDL-NDVCEIRNEVGTIKSIINFFRES----SLRRKHI---PNIPLFCETRWTAKYKSVRIFKENIIVIIEALHKLSLNGNINTTQRSSQ-LYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEINIE--LIPPRTVKMQTCRTNIPSD----SPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQ---NEYERITNGIFNKYGTFLENYQAE-SATWYHYYKTYKDASESISNVFDALKAAELFYPSVFR-------ALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYI 2043
            SN  Y+S  +QNELI + +  + + I  + K + F S+I D + D+S ++QLS   R++      + N       + FLGF  +    A+ + ET I+ L++  GL L K  G+ YDG STM+   SGVQKRI D+ P A + H ++H LNLV+ND    + EI+     ++ +  FF +S     L   H+   P +   C TRW ++  ++   +     I++AL K++L    +  +  +  L  A     F +   I  +    +  V+  LQ  D +LL    Q  SL+          +D F NL    +   S   I       RT +++     +  D    +PE  ++ ++F   +DT+++ +  RF   + ++     L P+ + +      NE  +    I+N      E+  +E S+    +        +++S V    +   L + S+         AL + L I  T  + +RSFS L  +K +LRSTM + RL  L M+ I
Sbjct:   88 SNVNYLSPSIQNELIALLSQRVHDEIVSEIKEAEFYSVIMDTTQDLSKVDQLSQVFRYVTVRKDEADNAIAVDINESFLGFQNISDQTAQGL-ETKITELIQSKGLPLHKCRGQGYDGASTMSGIYSGVQKRILDKEPNAVYVHCAAHNLNLVLNDACQHITEIKEYYDILQRLYVFFSQSIKRWELLENHLKSKPTLKRLCPTRWASRRDALYALRFRYADILQALTKITLRSKKSDERTEAMGLLKAMEAFEFVMMTVIQEKILETINIVSQVLQKKDVDLL----QAASLLGNATCTLAQLRDQFDNLKCTAQGLASSWGIRCNFRHKRTRRIKRHFDELTEDQRLTNPEEIFKVNVFYMCIDTVVSQVRTRFHGMDSVTRKFQFLCPTELLRASDEALNESAQTLAAIYN------EDLSSEFSSQLLSFRNALGSEIKTVSTVKGLFELLLLRHSSILSSVTDVATALKLFLTIPVTVASAERSFSKLKMIKNYLRSTMSQDRLSGLAMLSI 593          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Cavefish
Match: ENSAMXT00000025204.2 (pep primary_assembly:Astyanax_mexicanus-2.0:12:7364240:7371214:-1 gene:ENSAMXG00000024490.2 transcript:ENSAMXT00000025204.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.043 bits (349), Expect = 1.383e-33
Identity = 159/603 (26.37%), Postives = 261/603 (43.28%), Query Frame = 1
Query:  358 IQNKRRNVAEMMNSVMEQTIEINRKKLLPIVKTVVFCAINNIPFRGKTDKTAIFNN---LLQFRIDAG-DSILSNHL---QSCPSNATYISHRVQNELIG-ICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVINDLNDVCEIRNEV-GTIKSIINFFRESSLR----RKHIPNIPL--FCETRWTAKYKSVRIFKENIIVIIEALHKLSLNGNINTTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNH--------QKFAKDNFHNLWEKMEACLSEINIELIPPRTVKMQTCRTNIPSDSPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFN----KYGTFLENYQAESATWYHYYKTYKDASESISNVFDAL------KAAELFYPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNEL 2067
            +QNK   + +   ++M+  IE  +  +  ++  +   A  N   RG T      +N   L Q  + A  D +++ H+   Q+  +   Y+S  +QNE+I  I N VL E I +        S+I D + DIS  EQLS+ +R +N          + F GF+ +E    K ++E ++  L K  L +S   G++YD  S M  +  GV+ RI      A     SSH+LNLV+ D      +     G ++ + N F  S  R    RKH+  + L     TRW A+  SV++ +  +  I+EAL  L   G       +         S+F +C  I Y     +  V+  LQ  + ++ T+R +   + E +++         Q  AKD   NL   ME  L E           + Q   T     +P+  +R+  F+P +DT + SL +R      + Y +++   S       N  + I NG  +    K    L +  A+   +      +       +  FD L      K  +L Y ++  AL + L +  +  + +RSFS L  +KT++RSTM + RL  L +M I R +   L
Sbjct:  139 LQNKT-TIDQRQQTLMQIEIEHWKAVIRRVIAIICHLAERNQALRGTTSVLYDPHNGNFLAQVELMAKFDPVMNEHIRRRQNQEAKVHYLSGTIQNEIIALIGNKVLEEIITQRD-----YSVIMDCTPDISHKEQLSVVLRLVN--CDPSVSIAEHFFGFIDVEDTSGKGLTEVLLDHLQKHNLSISDCRGQSYDNGSNMMGQKQGVRARILQLNNKALCIPCSSHKLNLVVADAAKSSVLSTSFFGVLQRLYNLFSSSVQRWAVLRKHVKQLTLKPLSATRWEARIDSVKVVRYQLPEILEALSALQTFGIEKGDSET-------MSSSFLLCTIIWYNVLYQVNHVSKLLQSPNVSMGTLRAETEGVREYLEDFRENRLASCQTDAKDIAENL--DMEMNLPEKKQRKK---KRQFQYEGTEETQSTPDETFRRDFFLPLVDTALRSLGDRLSRLKGV-YDLYDFLFSK-----DNMKQTIKNGKLHERCKKLEQTLHDIDADDLAFEINSSLHTFPDHVATCPFDMLNYIYSEKLLDL-YSTLSIALRLLLTLPVSVASGERSFSALKLIKTYMRSTMGQERLTGLALMSIEREVCRSL 714          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Cavefish
Match: ENSAMXT00000040801.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000046.1:3031619:3038346:1 gene:ENSAMXG00000043357.1 transcript:ENSAMXT00000040801.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 133.265 bits (334), Expect = 1.006e-31
Identity = 144/604 (23.84%), Postives = 257/604 (42.55%), Query Frame = 1
Query:  370 RRNVAEMMNSVMEQTIEINRKKLLPIVKTVVFCAINNIPFRG-----KTDKTAIFNNLLQFRIDAGDSILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVI-NDLNDVCEIRNEVGTIKSIINFFRESSLRRKHI------------PNIPLFCETRWTAKYKSVRIFKENIIVIIEALHKLSLNGNINTTQRSSQLYHACTDSTFSICLYIMYE-YSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEINIELIPPRTVKMQTCRTNIPSDSPESY----YRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAEL-FYPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRFG 2109
            + +V + + S     ++  R+ L  IV          IPFRG     ++    +F    +  +   D  L ++  + P N TY+S   QNE++  C + +   I ++ + +   +I+ADE+ D    EQLS+ +R++      E      FL    L   DA+ I+ T    L   G+   K V + YDG + M+  + GVQ     ++P A + H  +H LNLV+ +    + E R     ++S+ +FF  SSL   H               +     TRW  + +SV    +N   IIE L        INT          C  S  S+ L +M+    S+ A +   LQ  + +L    +   ++ + +K  +K +      L  +  A      + ++    V   TC     S++  S      ++ +  P LD ++  LE+RF   +D+S  +     +   K +Q     + + +   Y   L+   AE     +++K   +    + ++    K  +   +P++   +   L I  ++C+ +RSFS L ++ TWLR TM + RL  L +M I + L++ +        +IDRF 
Sbjct:  138 KGSVVQQIESATSTEVQERREYLKRIVAVTSLLGKQGIPFRGHDESCESHDKGMFAECFKL-LQKFDPFLKSY--TPPLNTTYLSSCSQNEMVQCCAEEVTATIVKEMREAQMFAIMADEARD-GKREQLSLCVRYVTGGMIKE-----RFLALTELMGFDAESIANTTEQQLALNGIGDLKCVAQTYDGAAVMSGAVGGVQAHFRKKHPEAVYVHCYAHELNLVLCHTCRAISEAREFFEILESVYSFF-SSSLVNHHKFVETQTRLGLQQTELVQLSSTRWACQLRSVNCVLDNFPAIIECLL------GINTPLAVGLRVKLCKFS--SVYLLVMFHTLLSLCAGLHLYLQKENIDLARAMEYKNAVTDSLK--EKRSDSTAGELHARALAICDANKLRMVD--YVVESTCGAGAGSEATSSSNADDLKQRLLFPCLDRMLAELEKRF---SDVSEELLCGIQACSPKSEQFLSVPLLSALALHYNIDLK--PAEVMVASNFFKRKNETGGDVEDMLAVYKQLDADMFPTLKATVQAALTIPVSSCSCERSFSALRRLHTWLRRTMGQNRLHHLAVMSIEKELLDSISP----DIVIDRFA 710          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Nematostella
Match: EDO44081 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWS8])

HSP 1 Score: 85.1149 bits (209), Expect = 1.514e-19
Identity = 41/109 (37.61%), Postives = 65/109 (59.63%), Query Frame = 1
Query:  391 MNSVMEQTIEINRKKLLPIVKTVVFCAINNIPFRGKTDKTAI-------FNNLLQFRIDAGDSILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFL 696
            +N++++Q I  NR+ L  + KT++FC  NNIP RG  D           F  LL+FR+D+GD IL  HL++ P NATYIS  +QN++I      +  N++++ + S + 
Sbjct:   22 LNNIVQQQIARNREILRSLFKTIIFCGKNNIPLRGLRDSDPTNAALAGNFQALLEFRVDSGDQILEQHLENAPRNATYISKTIQNQMISTVGAHILNNLSQEMRDSKYF 130          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Nematostella
Match: EDO40662 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6J7])

HSP 1 Score: 71.633 bits (174), Expect = 8.364e-13
Identity = 68/266 (25.56%), Postives = 125/266 (46.99%), Query Frame = 1
Query: 1267 RSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEINIELIPPRTVKMQTCRTNIPSDSPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLEN---YQAESATWYHYYKTYKDASESISNVFDALKAAEL-FYPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRN 2052
            R++ L    +   F+I +  + +  S++ P++  LQ    ++     Q++S+ + ++  ++     F   +E       + +I    PR  ++Q  R N PS SP  YY++S  IP +D L T +++ F  +      + +L P  +   +  + E         Y   LE+      E   W   +   ++ S   S V DALK  +  FYP+V   L I   +  T+  ++RSFST+ ++KT+LR+TM   R  +L ++ +H N
Sbjct:   23 RANGLLSTMSKFEFTITMITVMKCLSVVKPLSIQLQKRASDIYRAYSQVSSVKKDLQAPRRDIDVLFVKWYESSVDLGKDFDIVPSMPRIARIQQHRQNTPSSSPCEYYKRSQGIPLVDHLSTEMDKFFSADQMNVSKLISLVPEVLVATNGCDLEEAVK----FYTDDLESPDVLDVELVRWRSKWTRVEEESIPRSAV-DALKNCDAEFYPNVHVLLRILCTLPVTSAESERSFSTMKRLKTYLRNTMSTEREPSLALISVHYN 283          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Nematostella
Match: EDO43308 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYY5])

HSP 1 Score: 62.003 bits (149), Expect = 1.469e-10
Identity = 51/228 (22.37%), Postives = 102/228 (44.74%), Query Frame = 1
Query: 1213 IIEALH-------KLSLN--GNINTTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEINIELIPPRTVKMQTCRTNIPSDSPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENY---QAESATWYHYYKTYKDASESISNVF 1860
            I+E LH        +S+N   + NT   +  L +A   S F + + I+    ++  P+   LQ    ++L  ++++  L+ ++           H L++       +++++   PR  + QT R + P+ +PE YY+ ++   +LD ++  L+ RF ++  I Y   ++ PS +   D  +++       N Y   + NY   QAE   W   +K   +  E I +  
Sbjct:    4 IVELLHPVTATLEDISMNRHKHENTNWNAQSLLNAINFS-FIVAIVIVRHILALTKPLTVKLQSKAMDILKAKEELALLISVLTEMSNDIDATHHELYQDAVTIARQVDVQPDKPRVAQRQTHRPSAPASNPEDYYKINLTRVFLDHVLEQLDSRFKDDVFICYKGISIIPSVLIATD--DWKPNVLEFCNYYRQDISNYIGLQAELLLWERLWKGRDNRGEVIPDTL 228          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Nematostella
Match: EDO38954 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBI9])

HSP 1 Score: 58.151 bits (139), Expect = 9.772e-10
Identity = 33/148 (22.30%), Postives = 71/148 (47.97%), Query Frame = 1
Query: 1243 NGNINTTQRS-SQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEINIELIPPRTVKMQTCRTNIPSDSPESYYRKSIFIPYLDTLITSLEERFPEENDISYSI 1683
            N N N T R  +Q      + +F + + I+    ++  P+   LQ    ++L  ++++  L+ ++           H L++       +++++   PR  + QT R N P+ +PE YY+ ++   +LD ++  L+ RF ++  I Y +
Sbjct:   27 NTNWNPTSRQDAQSLLNAINFSFIVAIVIVRHILALTKPLTVKLQSKAMDILKAKEELALLISVLTEMSNDIDATHHELYQDAVTIARQVDVQPDMPRVAQRQTHRPNAPASNPEDYYKINLTRVFLDHVLEQLDSRFKDDVFICYKV 174          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Nematostella
Match: EDO42389 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1N0])

HSP 1 Score: 61.2326 bits (147), Expect = 1.149e-9
Identity = 44/188 (23.40%), Postives = 88/188 (46.81%), Query Frame = 1
Query: 1150 CETRWTAKYKSVRIFKENIIVIIEALHKLSLNG----NINTTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEINIELIPPRTVKMQTCRTNIPSDSPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPS 1701
            C TRW  + + +    E +  + E    ++LN     N N+   +  L +A + S F I + ++     +  P+   LQ  + +LL  + ++  L   +++ Q    + ++ +  +      +I +E   PR V+ Q  R N P+ +PE YY+ ++   +LD  +  L++RF +E  + Y   +  PS
Sbjct:  472 CRTRWIDRIEGMHRVIELLQPVAETFKDIALNQGKDWNPNSRIDAQALVNALSFS-FIITVVVVSYILDLTKPITVKLQAKEIDLLKAKDELRILKSSLRDMQNNIDERYNVVHRQAVEPGRKIGVEPSMPRIVQRQVHRDNSPAQNPEQYYKINLTTKFLDHALQQLDKRFQDEVFVCYKGLSRIPS 658          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Medaka
Match: ENSORLT00000028133.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948955])

HSP 1 Score: 148.673 bits (374), Expect = 1.985e-36
Identity = 149/587 (25.38%), Postives = 275/587 (46.85%), Query Frame = 1
Query:  433 KLLPIVKTVVFCAINNIPFRGKTDKTAIFNN---LLQFRIDAG-DSILSNHL----QSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVIND-LNDVCEIRNEVGTIKSIINFFRESSLR---RKHIPNIPL--FCETRWTAKYKSVRIFKENIIVIIEALHKLSLNGNINTTQRSSQ-LYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEINIE-LIPPRTVKMQTCRTNIPS-DSPESYYRKSIFIPY----LDTLITSLEERFPEENDIS--YSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDAL-----KAAELFYPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRFG 2109
            +L+ IV+++   A+ N+  RG T+     +N   L +  + A  D I+ +HL    +   S+ +YI H VQNELI + +  +   I +D K + + SII D + DIS  EQLS+ IR ++ M   +   R+ F+GF+  E    ++++  I++ L + G+      G++YD  + M  K  GVQ R+ ++ P A F    +H LNLV+ D      +  +  G ++ +   F  S+ R    K   +I L  + ETRW +K KS+   +     + EAL ++         +  +Q L        F+IC  + ++  S +  V+  +Q  +   + V   ++ L +  ++ Q +  + F N     +    E+N+E ++  + ++   C+ +  S D P S   K + + +    +D  ++++ ERF     +   + +    PS   +    + E + N +      F +N+  +S       K   +   +  ++ + +     K     YP+ + AL I L +  T    +RSFS L  +K++LRSTM + RL  L ++ I+ + V E I    Y ++ID F 
Sbjct:  273 RLIAIVQSL---AVRNLALRGHTETLFTSSNGNFLKEVELMARFDPIMKDHLNRVLRGTASHNSYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSLMEKPQI--REHFMGFLEAEESTGQHLASMILNRLEELGISFEDCRGQSYDNGANMKGKNKGVQARLLEKNPRALFLPCGAHTLNLVVCDAAKRSVDAMSYFGVLQKLYTLFSASAQRWAILKSQVSITLKSWTETRWESKIKSIEPMRYQGAAVREALIEVRDKTKDPVIKAEAQSLSEEVGSYRFNICTVVWHDILSTIKHVSKLMQSPN---MHVDLAVSLLKKTEQSLQSYRANGFVNAQMAAKEMCKEMNVEAILKQKRIRSTKCQFSYESHDEPFSDALKKLEVEFFNVVVDEALSAIAERFSTLEVVQNRFGVLTNFPSLGDEELTEQCEALGNILH-----FEKNWDLDSRELVQEIKNLPNLPSTTPSLLELISFMSDKDLSEIYPNFWTALRIALTLPVTVAQAERSFSKLKLIKSYLRSTMSQERLTNLAVVSINHS-VGEQIS---YDDVIDEFA 842          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Medaka
Match: ENSORLT00000042294.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:110016639])

HSP 1 Score: 148.673 bits (374), Expect = 1.985e-36
Identity = 149/587 (25.38%), Postives = 275/587 (46.85%), Query Frame = 1
Query:  433 KLLPIVKTVVFCAINNIPFRGKTDKTAIFNN---LLQFRIDAG-DSILSNHL----QSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVIND-LNDVCEIRNEVGTIKSIINFFRESSLR---RKHIPNIPL--FCETRWTAKYKSVRIFKENIIVIIEALHKLSLNGNINTTQRSSQ-LYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEINIE-LIPPRTVKMQTCRTNIPS-DSPESYYRKSIFIPY----LDTLITSLEERFPEENDIS--YSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDAL-----KAAELFYPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRFG 2109
            +L+ IV+++   A+ N+  RG T+     +N   L +  + A  D I+ +HL    +   S+ +YI H VQNELI + +  +   I +D K + + SII D + DIS  EQLS+ IR ++ M   +   R+ F+GF+  E    ++++  I++ L + G+      G++YD  + M  K  GVQ R+ ++ P A F    +H LNLV+ D      +  +  G ++ +   F  S+ R    K   +I L  + ETRW +K KS+   +     + EAL ++         +  +Q L        F+IC  + ++  S +  V+  +Q  +   + V   ++ L +  ++ Q +  + F N     +    E+N+E ++  + ++   C+ +  S D P S   K + + +    +D  ++++ ERF     +   + +    PS   +    + E + N +      F +N+  +S       K   +   +  ++ + +     K     YP+ + AL I L +  T    +RSFS L  +K++LRSTM + RL  L ++ I+ + V E I    Y ++ID F 
Sbjct:  273 RLIAIVQSL---AVRNLALRGHTETLFTSSNGNFLKEVELMARFDPIMKDHLNRVLRGTASHNSYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSLMEKPQI--REHFMGFLEAEESTGQHLASMILNRLEELGISFEDCRGQSYDNGANMKGKNKGVQARLLEKNPRALFLPCGAHTLNLVVCDAAKRSVDAMSYFGVLQKLYTLFSASAQRWAILKSQVSITLKSWTETRWESKIKSIEPMRYQGAAVREALIEVRDKTKDPVIKAEAQSLSEEVGSYRFNICTVVWHDILSTIKHVSKLMQSPN---MHVDLAVSLLKKTEQSLQSYRANGFVNAQMAAKEMCKEMNVEAILKQKRIRSTKCQFSYESHDEPFSDALKKLEVEFFNVVVDEALSAIAERFSTLEVVQNRFGVLTNFPSLGDEELTEQCEALGNILH-----FEKNWDLDSRELVQEIKNLPNLPSTTPSLLELISFMSDKDLSEIYPNFWTALRIALTLPVTVAQAERSFSKLKLIKSYLRSTMSQERLTNLAVVSINHS-VGEQIS---YDDVIDEFA 842          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Medaka
Match: ENSORLT00000045044.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948193])

HSP 1 Score: 148.673 bits (374), Expect = 1.985e-36
Identity = 149/587 (25.38%), Postives = 275/587 (46.85%), Query Frame = 1
Query:  433 KLLPIVKTVVFCAINNIPFRGKTDKTAIFNN---LLQFRIDAG-DSILSNHL----QSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVIND-LNDVCEIRNEVGTIKSIINFFRESSLR---RKHIPNIPL--FCETRWTAKYKSVRIFKENIIVIIEALHKLSLNGNINTTQRSSQ-LYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEINIE-LIPPRTVKMQTCRTNIPS-DSPESYYRKSIFIPY----LDTLITSLEERFPEENDIS--YSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDAL-----KAAELFYPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRFG 2109
            +L+ IV+++   A+ N+  RG T+     +N   L +  + A  D I+ +HL    +   S+ +YI H VQNELI + +  +   I +D K + + SII D + DIS  EQLS+ IR ++ M   +   R+ F+GF+  E    ++++  I++ L + G+      G++YD  + M  K  GVQ R+ ++ P A F    +H LNLV+ D      +  +  G ++ +   F  S+ R    K   +I L  + ETRW +K KS+   +     + EAL ++         +  +Q L        F+IC  + ++  S +  V+  +Q  +   + V   ++ L +  ++ Q +  + F N     +    E+N+E ++  + ++   C+ +  S D P S   K + + +    +D  ++++ ERF     +   + +    PS   +    + E + N +      F +N+  +S       K   +   +  ++ + +     K     YP+ + AL I L +  T    +RSFS L  +K++LRSTM + RL  L ++ I+ + V E I    Y ++ID F 
Sbjct:  273 RLIAIVQSL---AVRNLALRGHTETLFTSSNGNFLKEVELMARFDPIMKDHLNRVLRGTASHNSYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSLMEKPQI--REHFMGFLEAEESTGQHLASMILNRLEELGISFEDCRGQSYDNGANMKGKNKGVQARLLEKNPRALFLPCGAHTLNLVVCDAAKRSVDAMSYFGVLQKLYTLFSASAQRWAILKSQVSITLKSWTETRWESKIKSIEPMRYQGAAVREALIEVRDKTKDPVIKAEAQSLSEEVGSYRFNICTVVWHDILSTIKHVSKLMQSPN---MHVDLAVSLLKKTEQSLQSYRANGFVNAQMAAKEMCKEMNVEAILKQKRIRSTKCQFSYESHDEPFSDALKKLEVEFFNVVVDEALSAIAERFSTLEVVQNRFGVLTNFPSLGDEELTEQCEALGNILH-----FEKNWDLDSRELVQEIKNLPNLPSTTPSLLELISFMSDKDLSEIYPNFWTALRIALTLPVTVAQAERSFSKLKLIKSYLRSTMSQERLTNLAVVSINHS-VGEQIS---YDDVIDEFA 842          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Medaka
Match: ENSORLT00000041223.1 (zinc finger MYM-type protein 1 [Source:NCBI gene;Acc:101155882])

HSP 1 Score: 119.013 bits (297), Expect = 2.940e-27
Identity = 135/624 (21.63%), Postives = 268/624 (42.95%), Query Frame = 1
Query:  313 VASRINKQSQ*FYQIIQNKRRNVAEMMNSVMEQTIEINRKKLLPIVKTVVFCAINNIPFRGKTDKTAIFN-----NLLQFRIDAGDSILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKFGLD---LSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVIND-LNDVCEIRNEVGTIKSIINFFRESSLRRKHIPNI-----PLFCETRWTAKYKSVRIFKENIIVIIEALHKLSLNGN--INTTQRSSQLYHACTDSTFSICLYI-----MYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEINIELIPPRTVKMQTCRTNIPSDSPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQ--AESATWYHYYKTYKDASESISNVFDALKAAELFYPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRFGRN 2115
            V S+   +S+   Q+ ++ RR   E+ N    + ++ NR+ L  ++  V+F     + FRG+ +     N      LL   I   ++ L  HL S     +  S ++Q++LI   ++V+R+ I  + K +PF+S++ +E+ D S   QL++ +R++ +    E         FV  E + +   ++ I   ++KF L+   L K+V + ++G +  +  ++GVQ ++ +  P A F H  +H+L+LV++   + + E +     +  ++ FF  S  R + +  I     P    T W +  + V    E    + E    +  N +     + R +  + A  D  F  C  +     ++ YS ML  +  + +   Q  L   K+    VE         +  +  ++E  E             R     + R     D P  +YR+ +    LD +I   + RF +   + +    L P    +  ++      + +   +G   +  Q   E    Y     Y  +   I +       +E+    ++R +C+ L I A+  + +R+FS L +++T  ++T  + RL AL +M I ++ + EL     +  +I++F R 
Sbjct:  119 VLSKTFGESRVELQLNEHARRET-ELHN----EKVKKNREILKRLIDCVLFLGKQELSFRGRDESGGSSNRGNYCELLSV-IAESNTDLHYHL-STNEAFSGTSGKIQDDLISAIDEVIRDEIRREVKNAPFVSVMVEETTDASNAAQLALALRYVTRSGVKE--------RFVRFEDVTSGKRADDIAGLVIKFLLENECLDKVVAQCFEGATVTSSGLNGVQAKVKESAPLALFIHCYAHQLSLVLSQGASKLKECKIFFAHLNGLVAFFSRSPWRTQLLDEICQRRLPGVTPTPWQSTSRVVNTVFEKREALKELFGHILENHSEYDEDSVRCADGFKALLD-CFEFCFLLHTFNGIFHYSDMLFSILQDKKSDVQFCLDRVKEFCDTVER-------ERSRYEGVYEATE-------------RAAGAPSARKCHAVD-PREHYRQ-LHGSILDNIICQTQTRFQDHEKMMFVTL-LDPLRFLEYRRSFPHAGLSSLARSHGALFDFSQLKTELTVMYTMDDFYGKSPSDILHFIHQNNLSEVM-KQLYRFVCLALTIPASPASVKRTFSALERIQTHAKNTTGQTRLSALALMAIEKDFLMELKCVNLHERVIEQFLRK 702          
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Medaka
Match: ENSORLT00000027735.1 (pep primary_assembly:ASM223467v1:9:30712608:30715295:1 gene:ENSORLG00000030268.1 transcript:ENSORLT00000027735.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.293 bits (251), Expect = 9.652e-22
Identity = 71/219 (32.42%), Postives = 119/219 (54.34%), Query Frame = 1
Query:  391 MNSVMEQTIEINRKKLLPIVKTVVFCAINNIPFRG--KTDKTAIFNNLLQFRIDAGDSILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKFGLDL-SKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVIND 1038
            +++   + ++ NR+ +  + +T++  A  NI  RG  +++  +  N L    + A ++ +     +   NAT + H  QNE+I    +++R +I  +   S   SI+ DE+ D+S  EQ+S  IR+    S  E  C   FL F   + ++A  +S+ II  L K GLD  + +VG+AYDG S M+ K +GVQ RI  + P A + H ++H LNLV+ D
Sbjct:  210 LDAEYSKLVKENREYIKVVGETLLLTATQNIAQRGHKESEVDSKGNFLAIMELLAKNNPIVKRKMAGQRNATCLGHDTQNEMIDCLAEMVRSSITGEVAESEAFSILVDETKDMSKKEQMSFVIRYYYNGSVCE--C---FLAFEAAQRLNAAALSQKIIEILQKHGLDYKNHLVGQAYDGASVMSGKNTGVQARIKSEAPLAFYVHCNAHCLNLVLVD 423          
BLAST of Repressor of the inhibitor of the protein kinase vs. Planmine SMEST
Match: SMESG000008969.1 (SMESG000008969.1)

HSP 1 Score: 651.358 bits (1679), Expect = 0.000e+0
Identity = 322/353 (91.22%), Postives = 334/353 (94.62%), Query Frame = 1
Query:  325 INKQSQ*FYQIIQNKRRNVAEMMNSVMEQTIEINRKKLLPIVKTVVFCAINNIPFRGKTDKTAIFNNLLQFRIDAGDSILSNHLQSCPSNATYISHRVQNELIGICNDVLRENINEDAK*SPFLSIIADESCDISGIEQLSIGIRFINKMSTNEFCCRKEFLGFVPLEHMDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVINDLNDVCEIRNEVGTIKSIINFFRESSLRRKHIPNIPLFCETRWTAKYKSVRIFKENIIVIIEALHKLSLNGNINTTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVD 1383
            INK +  F QIIQNKRRNVAEMMNSV+EQTI+ NRK LLPIVKT+VFCAINNIPFRGKTDKTAIFNNLLQFRID GD ILSNHLQSCPSNATYISHRVQNELIGICNDVLRENI EDAK SPFLSIIADESCDI GIEQLSIGIRFINKMSTNEFCCR+EFLGFVPLE MDA+YISETIISSLVKFGLDLSKMVG+AY GCSTMA KISGV+KRI DQYPFANFYH SSHRLNLVINDLNDVCEIRN VGTIKSIINFFRESSLRRKHIPNIPLFCETRWTAKYKSVRIFKENIIVI+EALHKLSLNGNINTTQRSSQLY+ACTDSTF++CLYIM EYSSML PVANNLQGVD
Sbjct:  121 INKANN-FSQIIQNKRRNVAEMMNSVLEQTIKNNRKNLLPIVKTIVFCAINNIPFRGKTDKTAIFNNLLQFRIDTGDLILSNHLQSCPSNATYISHRVQNELIGICNDVLRENIIEDAKKSPFLSIIADESCDIYGIEQLSIGIRFINKMSTNEFCCREEFLGFVPLERMDAEYISETIISSLVKFGLDLSKMVGQAYYGCSTMAGKISGVKKRIQDQYPFANFYHCSSHRLNLVINDLNDVCEIRNAVGTIKSIINFFRESSLRRKHIPNIPLFCETRWTAKYKSVRIFKENIIVILEALHKLSLNGNINTTQRSSQLYNACTDSTFTVCLYIMCEYSSMLEPVANNLQGVD 472          

HSP 2 Score: 169.088 bits (427), Expect = 5.281e-45
Identity = 76/83 (91.57%), Postives = 81/83 (97.59%), Query Frame = 2
Query:  116 SRTFRHTWLHDYPEMSYSAKLKGVVCRTCVLFKPHVDRGIQGAFILKEFTKYKKFHECAKLHI*SKWHRESINKANNFTRLYK 364
            SRTFRHTWLHDYPEMSYSAKLKGVVCRTCVLFKPHVDRGIQGAFILKEFTKYKKFHECAKLH+ SKWHRESINKANNF+++ +
Sbjct:   50 SRTFRHTWLHDYPEMSYSAKLKGVVCRTCVLFKPHVDRGIQGAFILKEFTKYKKFHECAKLHLQSKWHRESINKANNFSQIIQ 132          
BLAST of Repressor of the inhibitor of the protein kinase vs. Planmine SMEST
Match: SMESG000000957.1 (SMESG000000957.1)

HSP 1 Score: 494.197 bits (1271), Expect = 8.006e-171
Identity = 237/263 (90.11%), Postives = 249/263 (94.68%), Query Frame = 1
Query: 1327 MYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEINIELIPPRTVKMQTCRTNIPSDSPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAELFYPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRFGRN 2115
            M EYSSML PVANNLQ VDQNLLTVRKQITSLVELIKNH+KFAKDNFHNLWEKME CLSE+NIELIP +T+K QTCRTNIPSDSPESYYR+S FIPYLD+LITSLEERFPEEND+SYSIFNLAPSSMKKLDQ+EYER+TNG FNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAELFYPSVF ALCIGLII ATTCT ++SFSTL KVKTWLRSTM EGRLD LCMMYIHRNLVNELIEKGFYSEIIDRFGR+
Sbjct:    1 MSEYSSMLEPVANNLQEVDQNLLTVRKQITSLVELIKNHRKFAKDNFHNLWEKMETCLSELNIELIPLKTLKRQTCRTNIPSDSPESYYRRSNFIPYLDSLITSLEERFPEENDVSYSIFNLAPSSMKKLDQDEYERMTNGNFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAELFYPSVFSALCIGLIIPATTCTAEQSFSTLRKVKTWLRSTMSEGRLDDLCMMYIHRNLVNELIEKGFYSEIIDRFGRD 263          
BLAST of Repressor of the inhibitor of the protein kinase vs. Planmine SMEST
Match: SMESG000064845.1 (SMESG000064845.1)

HSP 1 Score: 491.115 bits (1263), Expect = 1.242e-169
Identity = 235/263 (89.35%), Postives = 248/263 (94.30%), Query Frame = 1
Query: 1327 MYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEKMEACLSEINIELIPPRTVKMQTCRTNIPSDSPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAELFYPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRFGRN 2115
            M EYSSML PV NNLQGVDQNLLTVRKQITSLVELIK H+KFAKDNF NLWEKME  LSE+NIELIPPRTVK QTCRTNIPSDSPESYYR+SIFIPYLD+LITSLEERFP+EN +SYSIFNLAPSSMKKLDQ+EYER+TNGIFNKYG F+ENYQAESATWYH+YKTYKDASESISNVFDALKAAELFYPSVFRALCIGLII ATTCT +RSFSTL KVKTWLRSTM +GRLDA CMMYIHRNLVNELIEKGFYSEIIDRFGR+
Sbjct:    1 MSEYSSMLEPVDNNLQGVDQNLLTVRKQITSLVELIKIHRKFAKDNFDNLWEKMETFLSELNIELIPPRTVKRQTCRTNIPSDSPESYYRRSIFIPYLDSLITSLEERFPKENHVSYSIFNLAPSSMKKLDQDEYERMTNGIFNKYGMFVENYQAESATWYHHYKTYKDASESISNVFDALKAAELFYPSVFRALCIGLIIPATTCTAERSFSTLCKVKTWLRSTMSKGRLDAFCMMYIHRNLVNELIEKGFYSEIIDRFGRD 263          
BLAST of Repressor of the inhibitor of the protein kinase vs. Planmine SMEST
Match: SMESG000011006.1 (SMESG000011006.1)

HSP 1 Score: 411.379 bits (1056), Expect = 2.134e-139
Identity = 201/218 (92.20%), Postives = 207/218 (94.95%), Query Frame = 1
Query:  832 MDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAEKISGVQKRI*DQYPFANFYH*SSHRLNLVINDLNDVCEIRNEVGTIKSIINFFRESSLRRKHIPNIPLFCETRWTAKYKSVRIFKENIIVIIEALHKLSLNGNINTTQRSSQLYHACTDSTFSICLYIMYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNLWEK 1485
            MDA+YISETIISSL KFGLDLSKMVG++YDGCSTMA KISGVQKRI DQYP ANFYH SSHRLNLVINDLNDVC IRN VGTIKSIINFFRESSLRRKHIPNIPLFCETRWTAK KSVRIFKENIIVIIEALHKLSLNGNINTTQRSSQLYHACTDSTFS+C YI+ EYSSML PVANNLQGVDQNLLTVRKQITSLVELIKNH+KFAKDNFHNLWEK
Sbjct:    1 MDAEYISETIISSLEKFGLDLSKMVGQSYDGCSTMAGKISGVQKRIQDQYPCANFYHCSSHRLNLVINDLNDVCGIRNAVGTIKSIINFFRESSLRRKHIPNIPLFCETRWTAKCKSVRIFKENIIVIIEALHKLSLNGNINTTQRSSQLYHACTDSTFSVCSYILCEYSSMLEPVANNLQGVDQNLLTVRKQITSLVELIKNHRKFAKDNFHNLWEK 218          
BLAST of Repressor of the inhibitor of the protein kinase vs. Planmine SMEST
Match: SMESG000030741.1 (SMESG000030741.1)

HSP 1 Score: 388.652 bits (997), Expect = 1.757e-130
Identity = 186/210 (88.57%), Postives = 198/210 (94.29%), Query Frame = 1
Query: 1486 MEACLSEINIELIPPRTVKMQTCRTNIPSDSPESYYRKSIFIPYLDTLITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFLENYQAESATWYHYYKTYKDASESISNVFDALKAAELFYPSVFRALCIGLIIQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEKGFYSEIIDRFGRN 2115
            ME CLSE+NIELIP RTVK QTC+TNI SDSPESYYR+SIFIPYLD+ ITSLEERFPEEND+ YSIFNLAPSSMKKLDQ+EYERITNGI+NKYG FLENYQAESATWYHYYKTYK+ASESISNVFDALKAAELFYPSVFRALCIGLII ATTCTT+RSFSTL KVKTWLRSTM EGRLD LCMMYIHRNLV++LIEKGFYSEIID FGR+
Sbjct:    1 METCLSELNIELIPLRTVKRQTCQTNISSDSPESYYRRSIFIPYLDSFITSLEERFPEENDVLYSIFNLAPSSMKKLDQDEYERITNGIYNKYGKFLENYQAESATWYHYYKTYKNASESISNVFDALKAAELFYPSVFRALCIGLIIPATTCTTERSFSTLRKVKTWLRSTMSEGRLDDLCMMYIHRNLVSKLIEKGFYSEIIDCFGRD 210          
The following BLAST results are available for this feature:
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
THAP121.230e-3823.93THAP domain containing 12 [Source:HGNC Symbol;Acc:... [more]
ZMYM14.717e-2923.97zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
ZMYM14.717e-2923.97zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
ZMYM14.717e-2923.97zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
ZMYM14.717e-2923.97zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
back to top
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
thap12a2.003e-2821.83THAP domain containing 12a [Source:ZFIN;Acc:ZDB-GE... [more]
CR762475.14.165e-2822.17pep chromosome:GRCz11:4:55494751:55498830:1 gene:E... [more]
thap12b1.368e-2320.88THAP domain containing 12b [Source:ZFIN;Acc:ZDB-GE... [more]
AL928808.17.708e-826.11pep chromosome:GRCz11:20:17257101:17259573:-1 gene... [more]
si:ch211-240b21.21.623e-641.38si:ch211-240b21.2 [Source:ZFIN;Acc:ZDB-GENE-060526... [more]
back to top
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tbx185.122e-15440.68T-box 18 [Source:Xenbase;Acc:XB-GENE-489907][more]
slc10a61.839e-9742.86solute carrier family 10 (sodium/bile acid cotrans... [more]
thap124.577e-3422.96THAP domain containing 12 [Source:NCBI gene;Acc:39... [more]
ENSXETT00000043220.19.065e-2023.21pep primary_assembly:Xenopus_tropicalis_v9.1:7:364... [more]
back to top
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Thap123.431e-3824.28THAP domain containing 12 [Source:MGI Symbol;Acc:M... [more]
Zmym11.279e-2422.39zinc finger, MYM domain containing 1 [Source:MGI S... [more]
Zmym12.149e-2422.39zinc finger, MYM domain containing 1 [Source:MGI S... [more]
Zmym12.149e-2422.39zinc finger, MYM domain containing 1 [Source:MGI S... [more]
back to top
BLAST of Repressor of the inhibitor of the protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|O43422|P52K_HUMAN5.906e-3823.9352 kDa repressor of the inhibitor of the protein k... [more]
sp|Q9CUX1|P52K_MOUSE2.400e-3724.2852 kDa repressor of the inhibitor of the protein k... [more]
sp|Q5SVZ6|ZMYM1_HUMAN2.265e-2823.97Zinc finger MYM-type protein 1 OS=Homo sapiens OX=... [more]
back to top
BLAST of Repressor of the inhibitor of the protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0J7NNB22.095e-17545.7152 kDa repressor of the inhibitor of the protein k... [more]
A0A1Y1MTC65.972e-16845.41Uncharacterized protein (Fragment) OS=Photinus pyr... [more]
A0A151K1Z34.077e-15642.4352 kDa repressor of the inhibitor of the protein k... [more]
A0A5G3KNV08.043e-15140.68T-box 18 OS=Xenopus tropicalis OX=8364 GN=tbx18 PE... [more]
X1WYT31.374e-14942.28Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
back to top
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000042930.12.011e-3727.39pep primary_assembly:Astyanax_mexicanus-2.0:12:254... [more]
ENSAMXT00000032220.15.082e-3624.73pep primary_assembly:Astyanax_mexicanus-2.0:24:134... [more]
ENSAMXT00000035789.15.984e-3627.08pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000025204.21.383e-3326.37pep primary_assembly:Astyanax_mexicanus-2.0:12:736... [more]
ENSAMXT00000040801.11.006e-3123.84pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO440811.514e-1937.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406628.364e-1325.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433081.469e-1022.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389549.772e-1022.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO423891.149e-923.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Repressor of the inhibitor of the protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000028133.11.985e-3625.38zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000042294.11.985e-3625.38zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000045044.11.985e-3625.38zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000041223.12.940e-2721.63zinc finger MYM-type protein 1 [Source:NCBI gene;A... [more]
ENSORLT00000027735.19.652e-2232.42pep primary_assembly:ASM223467v1:9:30712608:307152... [more]
back to top
BLAST of Repressor of the inhibitor of the protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008969.15.281e-4591.22SMESG000008969.1[more]
SMESG000000957.18.006e-17190.11SMESG000000957.1[more]
SMESG000064845.11.242e-16989.35SMESG000064845.1[more]
SMESG000011006.12.134e-13992.20SMESG000011006.1[more]
SMESG000030741.11.757e-13088.57SMESG000030741.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019641 ID=SMED30019641|Name=Repressor of the inhibitor of the protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2460bp
TATATATACTGATGTGTTTTGACAAATTTTCCGTCTTATTTTGGGGTCTT
ATTTTCTCAACAAAAATTTCACTCTAATTTGAATTAGTGTGCATAACTAA
CTGAGAGCCGTACATTCTCGAACCTTTCGACACACCTGGTTGCATGATTA
TCCAGAAATGTCATATTCTGCAAAATTGAAAGGTGTTGTTTGTCGCACTT
GTGTCTTATTTAAACCTCATGTTGATAGAGGAATTCAAGGTGCTTTTATA
TTAAAAGAATTTACAAAATATAAAAAATTTCATGAGTGTGCGAAACTACA
TATATAATCAAAGTGGCATCGCGAATCAATAAACAAAGCCAATAATTTTA
CCAGATTATACAAAATAAGCGCAGGAATGTTGCTGAAATGATGAATTCGG
TGATGGAGCAGACCATAGAAATTAATAGGAAAAAATTGTTGCCAATTGTA
AAAACAGTTGTATTTTGTGCAATAAACAATATTCCTTTTCGGGGAAAGAC
AGATAAAACTGCAATATTCAATAACCTACTGCAGTTTAGAATAGACGCAG
GAGATTCAATTTTGAGTAATCATTTACAAAGTTGTCCTTCAAACGCTACT
TACATTTCACATCGCGTACAAAATGAATTAATAGGAATTTGTAATGATGT
TTTAAGAGAAAATATTAATGAAGATGCAAAGTAAAGCCCATTTCTTTCAA
TCATTGCAGATGAATCGTGTGATATATCTGGAATAGAGCAATTATCTATT
GGAATAAGATTTATAAATAAAATGTCCACTAATGAATTTTGCTGCCGGAA
AGAATTTCTAGGATTTGTTCCATTAGAACATATGGACGCCAAATATATAT
CAGAAACTATTATCTCGTCTCTTGTAAAATTTGGCCTTGATCTATCAAAA
ATGGTTGGTCGAGCCTACGACGGTTGCTCGACAATGGCGGAAAAAATTAG
TGGCGTGCAAAAGCGTATCTAGGATCAATACCCTTTTGCAAATTTTTACC
ATTGAAGTTCACATAGATTGAATCTTGTGATAAACGACCTAAATGATGTA
TGTGAAATTAGAAATGAGGTTGGGACTATTAAATCGATTATTAACTTCTT
TCGAGAGAGCTCTTTAAGAAGAAAACATATTCCAAATATTCCTCTATTTT
GTGAAACACGTTGGACTGCTAAATACAAGAGCGTTCGAATTTTTAAAGAA
AATATTATTGTCATAATAGAAGCATTACATAAATTATCCTTAAATGGTAA
TATTAATACAACACAGAGATCTAGTCAGCTATATCACGCATGCACAGATT
CAACTTTTTCAATTTGTTTATATATAATGTATGAGTATTCGTCTATGCTA
GCACCTGTAGCTAATAATCTCCAAGGAGTTGATCAAAATCTATTAACTGT
GAGGAAACAAATTACTTCTCTTGTTGAACTAATAAAAAACCATCAAAAGT
TTGCAAAAGACAATTTCCATAATCTCTGGGAAAAAATGGAGGCATGTTTG
TCTGAAATAAATATTGAGCTGATACCACCAAGAACTGTGAAAATGCAAAC
TTGCCGAACAAATATTCCTTCCGATTCTCCTGAAAGTTACTATAGAAAGT
CAATTTTTATTCCATACCTGGATACATTAATAACATCTCTGGAAGAACGT
TTTCCTGAAGAAAATGATATTTCATATTCGATATTTAATTTAGCACCTAG
CTCTATGAAAAAGCTAGATCAAAATGAATATGAAAGAATAACGAATGGTA
TTTTTAACAAATATGGTACGTTTTTAGAAAATTACCAAGCAGAATCTGCA
ACATGGTATCATTATTATAAGACTTATAAAGATGCTAGCGAATCAATTTC
AAATGTATTCGATGCTTTAAAGGCAGCAGAATTATTTTATCCGTCAGTAT
TCAGGGCACTTTGCATTGGTCTTATTATTCAGGCCACTACTTGTACTACA
CAACGATCATTTAGCACACTTCTCAAAGTTAAAACTTGGCTGCGCTCGAC
AATGTGGGAAGGCAGACTTGATGCCCTCTGTATGATGTACATACATCGCA
ATTTAGTCAATGAGTTAATTGAAAAAGGATTTTACTCAGAAATCATAGAT
CGCTTCGGACGAAATCGGAGAAGGCTACAATTACTACAATAGGGCAAAGT
TGCGAAAAACAAATTAGTTGGGTAATATTAATATCTCCAGAATCTCCAGG
GATTCATATTTATTGTCATTAAACAAAAGATTTTTTATAGAATAAGTTAT
TTGTATAACAAAGCTGTGTATTTTCTTATCTGTATAAGTCATCTATGTAC
ATATATATGGCTCATTATATATTTGGTATGAATACAAATAAATGTTGAAA
CAGTCCAATTTTTACTATTTTAATTTTAACTATAAAAGAACACAACTTTT
TACTACAAAACAAGTATAAAGCTTTATGTGTATATCTCTGTTTTGGTTTT
GCCTCTCCCA
back to top

protein sequence of SMED30019641-orf-1

>SMED30019641-orf-1 ID=SMED30019641-orf-1|Name=SMED30019641-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=272bp
MYEYSSMLAPVANNLQGVDQNLLTVRKQITSLVELIKNHQKFAKDNFHNL
WEKMEACLSEINIELIPPRTVKMQTCRTNIPSDSPESYYRKSIFIPYLDT
LITSLEERFPEENDISYSIFNLAPSSMKKLDQNEYERITNGIFNKYGTFL
ENYQAESATWYHYYKTYKDASESISNVFDALKAAELFYPSVFRALCIGLI
IQATTCTTQRSFSTLLKVKTWLRSTMWEGRLDALCMMYIHRNLVNELIEK
GFYSEIIDRFGRNRRRLQLLQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR011989ARM-like
IPR008906HATC_C_dom
IPR012337RNaseH-like_sf
IPR025398DUF4371
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0003676nucleic acid binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation