Tumor necrosis factor alpha-induced protein 8-like protein

Overview
NameTumor necrosis factor alpha-induced protein 8-like protein
Smed IDSMED30019632
Length (bp)847
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tumor necrosis factor alpha-induced protein 8-like protein (SMED30019632) t-SNE clustered cells

Violin plots show distribution of expression levels for Tumor necrosis factor alpha-induced protein 8-like protein (SMED30019632) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tumor necrosis factor alpha-induced protein 8-like protein (SMED30019632) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tumor necrosis factor alpha-induced protein 8-like protein (SMED30019632) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019632

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30019632SMESG000055619.1 SmedASXL_006846SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30019632SMESG000055619.1 dd_Smed_v4_11459_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30019632SMESG000055619.1 dd_Smed_v6_11459_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30019632SMESG000055619.1 OX_Smed_1.0.01652ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Human
Match: TNFAIP8L3 (TNF alpha induced protein 8 like 3 [Source:HGNC Symbol;Acc:HGNC:20620])

HSP 1 Score: 81.6481 bits (200), Expect = 6.058e-18
Identity = 55/185 (29.73%), Postives = 103/185 (55.68%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCR---NHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            ++++ L+ QKK+ SK +SK +   L+++ ++ IFD ++++   +T++++ A+K MKD+IK+ IKI +L+ N+ FS EE+     FR    +    I+         + +VL +LL E     K ++  LV RHLT ++  +I +        EFL+   S+D   +  + RIC  +  ++D  +L
Sbjct:   24 SKSLALQAQKKILSKIASKTVANMLIDDTSSEIFDELYKVTKEHTHNKKEAHKIMKDLIKVAIKIGILYRNNQFSQEELVIVEKFRKKLNQTAMTIVSFYEVEYTFDRNVLSNLLHE----CKDLVHELVQRHLTPRTHGRINHVFNHFADVEFLSTLYSLDGDCRPNLKRICEGINKLLDEKVL 204          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Human
Match: TNFAIP8L1 (TNF alpha induced protein 8 like 1 [Source:HGNC Symbol;Acc:HGNC:28279])

HSP 1 Score: 80.1073 bits (196), Expect = 1.234e-17
Identity = 54/191 (28.27%), Postives = 93/191 (48.69%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRD---------VFFKICELIIKSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            T+++ L+ QKKL SK +SK +V  L+++ ++ + D ++R    +T SR+ A K +K+++K+ +K+ LL   D    EE+     FR          V F   +     R          +L   L++ + +L   V  HLT KS  +I +    L   +FL       EP+++ + RIC  L  ++D G L
Sbjct:    6 TKSLALQAQKKLLSKMASKAVVAVLVDDTSSEVLDELYRATREFTRSRKEAQKMLKNLVKVALKLGLLLRGDQLGGEELALLRRFRHRARCLAMTAVSFHQVDFTFDRR----------VLAAGLLECRDLLHQAVGPHLTAKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL 186          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Human
Match: TNFAIP8L1 (TNF alpha induced protein 8 like 1 [Source:HGNC Symbol;Acc:HGNC:28279])

HSP 1 Score: 80.1073 bits (196), Expect = 1.234e-17
Identity = 54/191 (28.27%), Postives = 93/191 (48.69%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRD---------VFFKICELIIKSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            T+++ L+ QKKL SK +SK +V  L+++ ++ + D ++R    +T SR+ A K +K+++K+ +K+ LL   D    EE+     FR          V F   +     R          +L   L++ + +L   V  HLT KS  +I +    L   +FL       EP+++ + RIC  L  ++D G L
Sbjct:    6 TKSLALQAQKKLLSKMASKAVVAVLVDDTSSEVLDELYRATREFTRSRKEAQKMLKNLVKVALKLGLLLRGDQLGGEELALLRRFRHRARCLAMTAVSFHQVDFTFDRR----------VLAAGLLECRDLLHQAVGPHLTAKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL 186          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Human
Match: TNFAIP8L3 (TNF alpha induced protein 8 like 3 [Source:HGNC Symbol;Acc:HGNC:20620])

HSP 1 Score: 81.2629 bits (199), Expect = 2.930e-17
Identity = 55/185 (29.73%), Postives = 103/185 (55.68%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCR---NHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            ++++ L+ QKK+ SK +SK +   L+++ ++ IFD ++++   +T++++ A+K MKD+IK+ IKI +L+ N+ FS EE+     FR    +    I+         + +VL +LL E     K ++  LV RHLT ++  +I +        EFL+   S+D   +  + RIC  +  ++D  +L
Sbjct:  112 SKSLALQAQKKILSKIASKTVANMLIDDTSSEIFDELYKVTKEHTHNKKEAHKIMKDLIKVAIKIGILYRNNQFSQEELVIVEKFRKKLNQTAMTIVSFYEVEYTFDRNVLSNLLHE----CKDLVHELVQRHLTPRTHGRINHVFNHFADVEFLSTLYSLDGDCRPNLKRICEGINKLLDEKVL 292          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Human
Match: TNFAIP8L2 (TNF alpha induced protein 8 like 2 [Source:HGNC Symbol;Acc:HGNC:26277])

HSP 1 Score: 72.7886 bits (177), Expect = 5.918e-15
Identity = 51/185 (27.57%), Postives = 90/185 (48.65%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCR---NHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            ++++ L+ +KKL SK + + +    ++E ++ + D ++R+   YT+SR  A + +KD+IK+ IK+ +L  N  F   E+  +  FR    +     +           +VL  LL E     + +LL LV  HLT KS  +I +  +       LT     D  F   + +IC  L+ ++D G L
Sbjct:    6 SKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTE----CRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPD--FTQHLGKICDGLRKLLDEGKL 184          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Fly
Match: sigmar (gene:FBgn0034894 transcript:FBtr0072096)

HSP 1 Score: 65.0846 bits (157), Expect = 1.659e-12
Identity = 52/175 (29.71%), Postives = 97/175 (55.43%), Query Frame = 2
Query:  197 LRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRG 721
            LR QKK+ S+ ++K + K  ++     + DN++RL   +T ++  A K +K++IK+ IKI +L  N+ FSDEE++K+  F+   F+  +L I S    + +  +  L +++ +++  L  +V  HLT+KS  +I    +F      L  +   D P++ +M +I  D+   M+ G
Sbjct:   13 LRAQKKILSRMATKNIAKTFIDGTTASLLDNLYRLCKMHTGNKAKAEKLIKNIIKIVIKIGVLHRNNQFSDEELQKAELFKRK-FQNTQLSIISFYEVDFTFDLPYLQKSIAESQVALKSIVQPHLTEKSLGRIDEVFDFFGEEALLETAFRPDSPYREVMGKIVADINAAMETG 186          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Fly
Match: sigmar (gene:FBgn0034894 transcript:FBtr0072098)

HSP 1 Score: 65.0846 bits (157), Expect = 1.659e-12
Identity = 52/175 (29.71%), Postives = 97/175 (55.43%), Query Frame = 2
Query:  197 LRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRG 721
            LR QKK+ S+ ++K + K  ++     + DN++RL   +T ++  A K +K++IK+ IKI +L  N+ FSDEE++K+  F+   F+  +L I S    + +  +  L +++ +++  L  +V  HLT+KS  +I    +F      L  +   D P++ +M +I  D+   M+ G
Sbjct:   13 LRAQKKILSRMATKNIAKTFIDGTTASLLDNLYRLCKMHTGNKAKAEKLIKNIIKIVIKIGVLHRNNQFSDEELQKAELFKRK-FQNTQLSIISFYEVDFTFDLPYLQKSIAESQVALKSIVQPHLTEKSLGRIDEVFDFFGEEALLETAFRPDSPYREVMGKIVADINAAMETG 186          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Fly
Match: sigmar (gene:FBgn0034894 transcript:FBtr0072097)

HSP 1 Score: 65.4698 bits (158), Expect = 2.167e-12
Identity = 52/175 (29.71%), Postives = 97/175 (55.43%), Query Frame = 2
Query:  197 LRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRG 721
            LR QKK+ S+ ++K + K  ++     + DN++RL   +T ++  A K +K++IK+ IKI +L  N+ FSDEE++K+  F+   F+  +L I S    + +  +  L +++ +++  L  +V  HLT+KS  +I    +F      L  +   D P++ +M +I  D+   M+ G
Sbjct:   35 LRAQKKILSRMATKNIAKTFIDGTTASLLDNLYRLCKMHTGNKAKAEKLIKNIIKIVIKIGVLHRNNQFSDEELQKAELFKRK-FQNTQLSIISFYEVDFTFDLPYLQKSIAESQVALKSIVQPHLTEKSLGRIDEVFDFFGEEALLETAFRPDSPYREVMGKIVADINAAMETG 208          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Zebrafish
Match: tnfaip8l2b (tumor necrosis factor, alpha-induced protein 8-like 2b [Source:NCBI gene;Acc:393345])

HSP 1 Score: 86.6557 bits (213), Expect = 3.695e-20
Identity = 54/185 (29.19%), Postives = 105/185 (56.76%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCR---NHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            ++ M L+ QKK+ SK ++K +V+ ++++ ++ I D ++R+   YT +R  A K +KD+IK+ +KI +LF ++ F++EE++ + +F+    +     I         + +V+ D+L E    ++ +LL LV+ HLT KS  +I +        E LT+  +   P K  +++IC  L  +++ G L
Sbjct:    6 SKDMALKAQKKILSKMATKSMVQMIIDDTSSEILDELYRVSKEYTGNRSEAQKVVKDLIKVVVKIGVLFRHNRFNEEELKLAQNFQKKLRQGAMTAISFHEVDFTFDKTVMSDILTE----SRDMLLKLVNTHLTTKSHGRINHVFNHYADPELLTQLYNSSGPLKPHLNKICNGLNKLLENGTL 186          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Zebrafish
Match: tnfaip8l2b (tumor necrosis factor, alpha-induced protein 8-like 2b [Source:NCBI gene;Acc:393345])

HSP 1 Score: 86.6557 bits (213), Expect = 3.695e-20
Identity = 54/185 (29.19%), Postives = 105/185 (56.76%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCR---NHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            ++ M L+ QKK+ SK ++K +V+ ++++ ++ I D ++R+   YT +R  A K +KD+IK+ +KI +LF ++ F++EE++ + +F+    +     I         + +V+ D+L E    ++ +LL LV+ HLT KS  +I +        E LT+  +   P K  +++IC  L  +++ G L
Sbjct:    6 SKDMALKAQKKILSKMATKSMVQMIIDDTSSEILDELYRVSKEYTGNRSEAQKVVKDLIKVVVKIGVLFRHNRFNEEELKLAQNFQKKLRQGAMTAISFHEVDFTFDKTVMSDILTE----SRDMLLKLVNTHLTTKSHGRINHVFNHYADPELLTQLYNSSGPLKPHLNKICNGLNKLLENGTL 186          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Zebrafish
Match: tnfaip8l3 (tumor necrosis factor, alpha-induced protein 8-like 3 [Source:NCBI gene;Acc:393322])

HSP 1 Score: 75.485 bits (184), Expect = 6.007e-16
Identity = 50/185 (27.03%), Postives = 97/185 (52.43%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCR---NHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            ++++ L+ QKK+ SK ++  +   L ++ ++ I D +++    YT S++ A+K +KD+IK+ +KI +L+ N  FS EE+E    F+    +    ++         +  +L +LLLE     + +L  LV  HLT +S  +I +        +FLT+     E ++  + +IC  +  ++D G L
Sbjct:   22 SKSLALQAQKKILSKMATMAVANLLTDDTSSEILDELYKASREYTKSKKEAHKIIKDVIKIALKIGILYRNHQFSPEEMETVERFKKKMNQAAMTVVSFYEVEYTFDRGILSELLLE----CRDLLHELVEHHLTMRSHGRIDHVFNHFADVDFLTELYGPSEDYRLNLRKICDGINKLLDEGTL 202          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Zebrafish
Match: CR407586.1 (pep chromosome:GRCz11:CHR_ALT_CTG18_1_44:39521878:39524417:-1 gene:ENSDARG00000111865.1 transcript:ENSDART00000187129.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR407586.1)

HSP 1 Score: 75.0998 bits (183), Expect = 7.421e-16
Identity = 50/185 (27.03%), Postives = 97/185 (52.43%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCR---NHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            ++++ L+ QKK+ SK ++  +   L ++ ++ I D +++    YT S++ A+K +KD+IK+ +KI +L+ N  FS EE+E    F+    +    ++         +  +L +LLLE     + +L  LV  HLT +S  +I +        +FLT+     E ++  + +IC  +  ++D G L
Sbjct:   14 SKSLALQAQKKILSKMATMAVANLLTDDTSSEILDELYKASREYTKSKKEAHKIIKDVIKIALKIGILYRNHQFSPEEMETVERFKKKMNQAAMTVVSFYEVEYTFDRGILSELLLE----CRDLLHELVEHHLTMRSHGRIDHVFNHFADVDFLTELYGPSEDYRLNLRKICDGINKLLDEGTL 194          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Zebrafish
Match: tnfaip8l2a (tumor necrosis factor, alpha-induced protein 8-like 2a [Source:NCBI gene;Acc:723996])

HSP 1 Score: 71.2478 bits (173), Expect = 1.496e-14
Identity = 49/185 (26.49%), Postives = 97/185 (52.43%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCR---NHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            ++ M ++ QKK+ S+ +SK + +  +++ ++ + D ++R+   ++ +R  A K +K+MIK+ +K+ +LF ++ FS EE+  + +FR          I  +      + SV+I+LL +     + +LL LV +HLT KS  +I +        E LT          + + +IC  L  +++ G L
Sbjct:    6 SKDMAMQAQKKILSRMASKSVAQMFIDDNSSEVLDELYRVSKEHSGNRAEAQKVVKNMIKIAVKVGVLFRHEKFSAEELSIAQEFRKKLHHGAMTAISFQEVEFTFDKSVMINLLSD----CRDLLLKLVEKHLTPKSLDRIRHVFNHYSNPELLTHLYDPQGNLWSNLSKICSGLNRMIEEGKL 186          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Xenopus
Match: TNFAIP8L3 (TNF alpha induced protein 8 like 3 [Source:NCBI gene;Acc:100494749])

HSP 1 Score: 83.1889 bits (204), Expect = 1.080e-18
Identity = 53/185 (28.65%), Postives = 100/185 (54.05%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCR---NHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            +++  ++ QKK+ SK ++K +   L+++ ++ IFD + ++   Y  +++ A+K +KD++K+ +K+ +L+ N+ FS EE++    FR    + C   I         + +VL  LL E     K++L  LV RHLT KS  +I          EFLT   S++  ++  + RIC  +  ++D  +L
Sbjct:   22 SKSFAVQAQKKILSKMATKTMANMLIDDTSSEIFDELFKVTKEYVKNKKEAHKVLKDLVKVAVKVGILYRNNQFSAEELKIVEKFRKKLNQACMTAISFYEVEYTFDKNVLSGLLHE----CKTLLHELVQRHLTPKSHSRIDRVFNHFADVEFLTALYSLEGNYRPYLKRICGGVNKLLDERVL 202          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Xenopus
Match: tnfaip8l2 (TNF alpha induced protein 8 like 2 [Source:NCBI gene;Acc:595002])

HSP 1 Score: 77.7962 bits (190), Expect = 8.367e-17
Identity = 52/182 (28.57%), Postives = 95/182 (52.20%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            ++ + L+ QKK+ S+ +SK +V   ++E ++ I D ++R+   YT ++  + K +K++IK+ +KI +LF ++ FS EE+  + DF+          I        +   D+L + LM+ K++LL LV +HLT KS  +I +        E L +           + +IC  L  ++D G L
Sbjct:    6 SKDLALQAQKKILSRMASKSMVNMFIDETSSEILDELYRVSKEYTKNKSESQKVIKNLIKIAVKIGVLFRHNRFSPEELVLAQDFKSKLHNGAMTAISFYEVE-FTFEKDVLPDILMECKNLLLRLVEKHLTPKSHGRIQHVFNHFADPEMLCQLYDPKGSLWPHLQKICHGLNKLIDEGKL 186          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Xenopus
Match: tnfaip8l2 (TNF alpha induced protein 8 like 2 [Source:NCBI gene;Acc:595002])

HSP 1 Score: 78.5666 bits (192), Expect = 1.329e-16
Identity = 56/192 (29.17%), Postives = 96/192 (50.00%), Query Frame = 2
Query:  176 IPTQTM--------VLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            IP  TM         L+ QKK+ S+ +SK +V   ++E ++ I D ++R+   YT ++  + K +K++IK+ +KI +LF ++ FS EE+  + DF+          I        +   D+L + LM+ K++LL LV +HLT KS  +I +        E L +           + +IC  L  ++D G L
Sbjct:   54 IPGTTMETFSSKDLALQAQKKILSRMASKSMVNMFIDETSSEILDELYRVSKEYTKNKSESQKVIKNLIKIAVKIGVLFRHNRFSPEELVLAQDFKSKLHNGAMTAISFYEV-EFTFEKDVLPDILMECKNLLLRLVEKHLTPKSHGRIQHVFNHFADPEMLCQLYDPKGSLWPHLQKICHGLNKLIDEGKL 244          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Xenopus
Match: tnfaip8 (TNF alpha induced protein 8 [Source:NCBI gene;Acc:549938])

HSP 1 Score: 72.4034 bits (176), Expect = 8.764e-15
Identity = 49/185 (26.49%), Postives = 98/185 (52.97%), Query Frame = 2
Query:  173 LIPTQTMVLRCQKKLASKF-SSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCR---NHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMD 715
            +  ++ + ++ QKK+  K  SSKY+   L+++ +  + D +++L   YT S++ + K +K++IK  IK+ +L+ N+ F++EEI     F+    ++   ++   +     + +VL  LL E     + +L  ++ RHLT KS  ++ N  +     EFL    +   PFK  + R+C  +  ++D
Sbjct:    5 VFSSKNLAVQAQKKILGKMASSKYIATSLIDDTSGEVLDELYQLTREYTQSKKESEKVIKNLIKTVIKLAVLYRNNQFNEEEIALMEKFKRKVHQLAMTVVSFYQVEYTFDRNVLSKLLNE----CRELLHQVIQRHLTAKSHGRVNNVFDHFSNCEFLAALYNPFGPFKQHLQRLCEGVNKMLD 185          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Xenopus
Match: tnfaip8 (TNF alpha induced protein 8 [Source:NCBI gene;Acc:549938])

HSP 1 Score: 72.4034 bits (176), Expect = 1.089e-14
Identity = 49/185 (26.49%), Postives = 98/185 (52.97%), Query Frame = 2
Query:  173 LIPTQTMVLRCQKKLASKF-SSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCR---NHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMD 715
            +  ++ + ++ QKK+  K  SSKY+   L+++ +  + D +++L   YT S++ + K +K++IK  IK+ +L+ N+ F++EEI     F+    ++   ++   +     + +VL  LL E     + +L  ++ RHLT KS  ++ N  +     EFL    +   PFK  + R+C  +  ++D
Sbjct:   15 VFSSKNLAVQAQKKILGKMASSKYIATSLIDDTSGEVLDELYQLTREYTQSKKESEKVIKNLIKTVIKLAVLYRNNQFNEEEIALMEKFKRKVHQLAMTVVSFYQVEYTFDRNVLSKLLNE----CRELLHQVIQRHLTAKSHGRVNNVFDHFSNCEFLAALYNPFGPFKQHLQRLCEGVNKMLD 195          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Mouse
Match: Tnfaip8l1 (tumor necrosis factor, alpha-induced protein 8-like 1 [Source:MGI Symbol;Acc:MGI:1913693])

HSP 1 Score: 70.4774 bits (171), Expect = 3.012e-14
Identity = 45/182 (24.73%), Postives = 92/182 (50.55%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCRNHSVLID--LLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRG 721
            T+++ L+ QKK+ SK +SK +V   ++  ++ + D +++    +T SR+ A + +K+++K+ +K+ +L   D     E+ +   FR    ++  L + +          D  +L   L++ + +L   +  HLT KS  +I +        +FL    S  EP+++ + RIC  L  ++D G
Sbjct:    6 TKSLALQAQKKVLSKMASKAMVAVFVDNTSSEVLDELYQATKEFTRSRKEAQRVVKNLVKVAVKLAVLLRADQLDSNELAQLQRFRG---RVRSLAMTALSFHQVDFTFDRRVLATGLLECRDLLHQAIGPHLTAKSHGRINHIFSHFANGDFLAALYSPAEPYRSHLCRICDGLGRMLDEG 184          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Mouse
Match: Tnfaip8l2 (tumor necrosis factor, alpha-induced protein 8-like 2 [Source:MGI Symbol;Acc:MGI:1917019])

HSP 1 Score: 68.5514 bits (166), Expect = 1.487e-13
Identity = 49/185 (26.49%), Postives = 91/185 (49.19%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCR---NHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            ++++ L+ +KKL SK + + +    ++E ++ + D ++R+   YT+SR  A + +KD+IK+ +K+ +L  +  F   E+  +  FR    +     +           +VL  LL+E     + ILL LV  HLT KS  +I +  +     + L      D  F   + +IC  L+ ++D G L
Sbjct:    6 SKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPKAQRVIKDLIKVAVKVAVLHRSGCFGPGELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLVE----CRDILLELVEHHLTPKSHDRIRHVFDHYSDPDLLAALYGPD--FTQHLGKICDGLRKLLDEGKL 184          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Mouse
Match: Tnfaip8l3 (tumor necrosis factor, alpha-induced protein 8-like 3 [Source:MGI Symbol;Acc:MGI:2685363])

HSP 1 Score: 67.781 bits (164), Expect = 4.282e-13
Identity = 48/182 (26.37%), Postives = 96/182 (52.75%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            ++ + L+ QKK+ SK +SK +   L+++ ++ IFD ++++   +T++++ A+K MKD IK+ IKI +L+ N  FS EE+      R    +    ++       ++   ++L + L + K ++  LV RHLT ++  +I +        EFL+         +  + RIC  +  ++D  +L
Sbjct:   24 SKNLALQAQKKILSKIASKTVANMLIDDTSSEIFDELYKVTEIHTHNKKEAHKIMKDAIKVAIKIGILYRNKQFSQEEVIIVEKLRKKLNQTAMTMVSFYEVE-YTFDTNVLSKLLHECKDLVHELVQRHLTPRTHGRINHVFNHFADVEFLSTLYGPHGNCRPNLKRICEGINKLLDDKIL 204          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Mouse
Match: Tnfaip8 (tumor necrosis factor, alpha-induced protein 8 [Source:MGI Symbol;Acc:MGI:2147191])

HSP 1 Score: 58.151 bits (139), Expect = 9.721e-10
Identity = 46/203 (22.66%), Postives = 98/203 (48.28%), Query Frame = 2
Query:  131 PFQQSMCXXXXXXXLIPT-----QTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCR---NHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMD 715
             FQ   C S      + T     + + ++ QKK+  K  SK +   L+++ ++ + D ++R+   YT +++ A + +K++IK  IK+ +L  N+ F+ +E+     F+    ++   ++   +     + +VL  LL E     + +L  ++ RHLT KS  ++ N  +     +FL    +    FK  + ++C  +  ++D
Sbjct:   10 SFQSRACTSHGEVTSVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTKEYTQNKKEAERVIKNLIKTVIKLAVLHRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVEYTFDRNVLSRLLNE----CRELLHEIIQRHLTAKSHGRVNNVFDHFSDCDFLAALYNPFGKFKPHLQKLCDGINKMLD 208          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Mouse
Match: Tnfaip8 (tumor necrosis factor, alpha-induced protein 8 [Source:MGI Symbol;Acc:MGI:2147191])

HSP 1 Score: 57.3806 bits (137), Expect = 1.406e-9
Identity = 41/181 (22.65%), Postives = 93/181 (51.38%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCR---NHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMD 715
            ++ + ++ QKK+  K  SK +   L+++ ++ + D ++R+   YT +++ A + +K++IK  IK+ +L  N+ F+ +E+     F+    ++   ++   +     + +VL  LL E     + +L  ++ RHLT KS  ++ N  +     +FL    +    FK  + ++C  +  ++D
Sbjct:    8 SKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTKEYTQNKKEAERVIKNLIKTVIKLAVLHRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVEYTFDRNVLSRLLNE----CRELLHEIIQRHLTAKSHGRVNNVFDHFSDCDFLAALYNPFGKFKPHLQKLCDGINKMLD 184          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. UniProt/SwissProt
Match: sp|Q7T364|TPL2B_DANRE (Tumor necrosis factor, alpha-induced protein 8-like protein 2 B OS=Danio rerio OX=7955 GN=tnfaip8l2b PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.790e-19
Identity = 54/185 (29.19%), Postives = 105/185 (56.76%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCR---NHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            ++ M L+ QKK+ SK ++K +V+ ++++ ++ I D ++R+   YT +R  A K +KD+IK+ +KI +LF ++ F++EE++ + +F+    +     I         + +V+ D+L E    ++ +LL LV+ HLT KS  +I +        E LT+  +   P K  +++IC  L  +++ G L
Sbjct:    6 SKDMALKAQKKILSKMATKSMVQMIIDDTSSEILDELYRVSKEYTGNRSEAQKVVKDLIKVVVKIGVLFRHNRFNEEELKLAQNFQKKLRQGAMTAISFHEVDFTFDKTVMSDILTE----SRDMLLKLVNTHLTTKSHGRINHVFNHYADPELLTQLYNSSGPLKPHLNKICNGLNKLLENGTL 186          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. UniProt/SwissProt
Match: sp|Q6DFE2|TP8L3_XENLA (Tumor necrosis factor alpha-induced protein 8-like protein 3 OS=Xenopus laevis OX=8355 GN=tnfaip8l3 PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.438e-17
Identity = 53/185 (28.65%), Postives = 101/185 (54.59%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELII---KSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            +++  ++ QKK+ SK ++K +   L+++ ++ IFD + ++   Y  +++ A+K +KD++K+ +K+ +L+ N  FS EE+E   +FR    + C   +   +     + +VL  LL E     K++L  LV RHLT KS  +I          EFLT   S++  ++  + RIC  +  ++D  +L
Sbjct:   22 SKSFAVQAQKKILSKMATKTMANMLIDDTSSEIFDELFKVTKEYVKNKKEAHKVLKDLVKVAVKVGILYRNKQFSLEELEIVENFRKKLNQTCMTAVSFFEVEYTFDKNVLSGLLHE----CKTLLHELVQRHLTPKSHSRIDRVFNHFADVEFLTALYSLEGNYRPYLKRICEGVNKLLDERVL 202          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. UniProt/SwissProt
Match: sp|Q8WVP5|TP8L1_HUMAN (Tumor necrosis factor alpha-induced protein 8-like protein 1 OS=Homo sapiens OX=9606 GN=TNFAIP8L1 PE=1 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 5.926e-17
Identity = 54/191 (28.27%), Postives = 93/191 (48.69%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRD---------VFFKICELIIKSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            T+++ L+ QKKL SK +SK +V  L+++ ++ + D ++R    +T SR+ A K +K+++K+ +K+ LL   D    EE+     FR          V F   +     R          +L   L++ + +L   V  HLT KS  +I +    L   +FL       EP+++ + RIC  L  ++D G L
Sbjct:    6 TKSLALQAQKKLLSKMASKAVVAVLVDDTSSEVLDELYRATREFTRSRKEAQKMLKNLVKVALKLGLLLRGDQLGGEELALLRRFRHRARCLAMTAVSFHQVDFTFDRR----------VLAAGLLECRDLLHQAVGPHLTAKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL 186          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. UniProt/SwissProt
Match: sp|Q5GJ75|TP8L3_HUMAN (Tumor necrosis factor alpha-induced protein 8-like protein 3 OS=Homo sapiens OX=9606 GN=TNFAIP8L3 PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.407e-16
Identity = 55/185 (29.73%), Postives = 103/185 (55.68%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCR---NHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            ++++ L+ QKK+ SK +SK +   L+++ ++ IFD ++++   +T++++ A+K MKD+IK+ IKI +L+ N+ FS EE+     FR    +    I+         + +VL +LL E     K ++  LV RHLT ++  +I +        EFL+   S+D   +  + RIC  +  ++D  +L
Sbjct:  112 SKSLALQAQKKILSKIASKTVANMLIDDTSSEIFDELYKVTKEHTHNKKEAHKIMKDLIKVAIKIGILYRNNQFSQEELVIVEKFRKKLNQTAMTIVSFYEVEYTFDRNVLSNLLHE----CKDLVHELVQRHLTPRTHGRINHVFNHFADVEFLSTLYSLDGDCRPNLKRICEGINKLLDEKVL 292          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. UniProt/SwissProt
Match: sp|Q5BKH4|TP8L2_XENTR (Tumor necrosis factor alpha-induced protein 8-like protein 2 OS=Xenopus tropicalis OX=8364 GN=tnfaip8l2 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 4.432e-16
Identity = 52/182 (28.57%), Postives = 95/182 (52.20%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            ++ + L+ QKK+ S+ +SK +V   ++E ++ I D ++R+   YT ++  + K +K++IK+ +KI +LF ++ FS EE+  + DF+          I        +   D+L + LM+ K++LL LV +HLT KS  +I +        E L +           + +IC  L  ++D G L
Sbjct:    6 SKDLALQAQKKILSRMASKSMVNMFIDETSSEILDELYRVSKEYTKNKSESQKVIKNLIKIAVKIGVLFRHNRFSPEELVLAQDFKSKLHNGAMTAISFYEVE-FTFEKDVLPDILMECKNLLLRLVEKHLTPKSHGRIQHVFNHFADPEMLCQLYDPKGSLWPHLQKICHGLNKLIDEGKL 186          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. TrEMBL
Match: A0A1I8J535 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 2.769e-31
Identity = 65/180 (36.11%), Postives = 109/180 (60.56%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRG 721
            +Q+  LR QKK+ SK ++K  VK  ++  + R+FD +++L+  +T SRQ A K +K +IKLN+KI +L++ND+F+DEE   ++DFRD F  +   +++  + R  ++    L+      + ++L L+ RHL++KS+  +  CA F     FL+       P    MD IC D+QD++DRG
Sbjct: 1643 SQSFSLRAQKKIVSKLATKKSVKIFIDAASARVFDKIYKLVKTHTGSRQAAQKLLKQIIKLNMKIGVLYLNDMFNDEERAMADDFRDKFNDLTTDLVR-MQTRRSTLDQASLVRQFRDCEQLVLRLIRRHLSEKSQAGVRTCATFFTEPAFLSALFDRSSPLAAQMDSICDDIQDLLDRG 1821          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. TrEMBL
Match: A0A448XDV5 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS27893 PE=4 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 8.502e-26
Identity = 66/182 (36.26%), Postives = 109/182 (59.89%), Query Frame = 2
Query:  197 LRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSR-----RCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            +R QKKLA     K + KF +++ ++R+ DN++ L+  YT S+  A K MKD++K+++KI++L  N+V ++EE   + DFR+ F  I E+I++ R     R       I  L+E L  A+ I LL++  HL+ KS+  +  CA+F     F       +E F+ IM+ IC D+++++DRGLL
Sbjct:   27 IRMQKKLAGHVP-KNMFKFFLDDTSSRVLDNIYNLVKLYTVSKMSAKKLMKDILKIDVKISILHFNNVMTEEEKVLTADFRECFHNIAEVILRMRNPRRSRLSGPDASISKLIELLTDAERIALLIIEHHLSVKSQETLQTCAKFFKNSNFFEACFEREE-FRPIMNEICVDIEELLDRGLL 206          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. TrEMBL
Match: A0A267FNY1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004618g1 PE=4 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 2.840e-23
Identity = 56/182 (30.77%), Postives = 102/182 (56.04%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
             Q++ LR QKKL  K +++  VK  ++  + R FD+++R++  +T SR  A K MK ++KLN+K+ +L+ +D+ S+ E   ++ FRD F  +   ++  +R R   +  + L +     ++I L +V RHL++KS   I  C++      FL        P    M  +C D+Q+++DRG++
Sbjct:   37 AQSVSLRAQKKLIGKLANQKAVKIFIDATSARAFDSIYRIVKLHTGSRSRAQKTMKHIVKLNMKVAVLYTHDILSESEKALADQFRDRFNDLATDLVLMQRGRRQ-LDKEKLAKQFRDCEAIALRMVRRHLSEKSLTSIRTCSDLFTEPRFLQALFDPSSPLAPHMTSLCQDVQELLDRGVV 217          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. TrEMBL
Match: A0A1I8GAC0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015718g1 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 5.054e-23
Identity = 56/182 (30.77%), Postives = 102/182 (56.04%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
             Q++ LR QKKL  K +++  VK  ++  + R FD+++R++  +T SR  A K MK ++KLN+K+ +L+ +D+ S+ E   ++ FRD F  +   ++  +R R   +  + L +     ++I L +V RHL++KS   I  C++      FL        P    M  +C D+Q+++DRG++
Sbjct:   37 AQSVSLRAQKKLIGKLANQKAVKIFIDATSARAFDSIYRIVKLHTGSRSRAQKTMKHIVKLNMKVAVLYTHDILSESEKALADQFRDRFNDLATDLVLMQRGRRQ-LDKEKLAKQFRDCEAIALRMVRRHLSEKSLTSIRTCSDLFTEPRFLQALFDRSSPLAPHMTSLCQDVQELLDRGVV 217          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. TrEMBL
Match: G4VEC4 (Putative tumor necrosis factor induced protein OS=Schistosoma mansoni OX=6183 GN=Smp_022740 PE=4 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 8.696e-22
Identity = 58/186 (31.18%), Postives = 104/186 (55.91%), Query Frame = 2
Query:  185 QTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCRNH-----SVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            Q++ LR QKKL      K ++K  +++ + R+F+N+ RL+  YT + +LA    K  IKLN+K  +L  ND+ SDE++  + +F +   +I E+ ++  R +          ID L++ + +A   L+  V  H++ +S+ K    ++F   REF+ +  +    + T M++I  DL+D+MDRGL 
Sbjct:   24 QSISLRAQKKLVGSLP-KGIIKLFLDDSSARLFENIFRLIKQYTGNNKLAAYLTKQAIKLNVKALILISNDILSDEQLNHAYEFHEKCHQIAEIALRLGRPKRRLMPGVEPSIDKLIQTMKEANQTLIEAVKHHISQQSQDKFKEFSDFFCRREFVVEVFTNKVKYSTHMEKIYDDLEDMMDRGLF 208          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Cavefish
Match: tnfaip8l3 (TNF alpha induced protein 8 like 3 [Source:NCBI gene;Acc:103022034])

HSP 1 Score: 75.8702 bits (185), Expect = 3.071e-16
Identity = 48/185 (25.95%), Postives = 98/185 (52.97%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCR---NHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            ++++ L+ QKK+ SK ++  +   L ++ ++ I D +++    +T S++ A+K +KD+IK+ +K+ +L+ N  F  EE+E    F+    +    ++         + S+L ++LLE     + +L  LV  HLT +S  +I +        EFLT+     E ++  + +IC  +  ++D G+L
Sbjct:   22 SKSLALQAQKKILSKMATMAVANLLTDDTSSGILDELYKASREFTKSKKEAHKIIKDVIKIALKVGILYRNHQFGPEELETVERFKKKMNQAAMTVVSFYEVEYTFDRSILSEMLLE----CRDLLHELVENHLTARSHGRIDHVFNHFADVEFLTELYGTAEDYRLSLRKICDGINKLLDEGVL 202          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Cavefish
Match: tnfaip8l2b (TNF alpha induced protein 8 like 2 [Source:NCBI gene;Acc:103021955])

HSP 1 Score: 73.559 bits (179), Expect = 1.571e-15
Identity = 50/185 (27.03%), Postives = 97/185 (52.43%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCR---NHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            ++ + ++ QKK+ S  ++K +V+  +++ ++ I D ++R+   +T +R  A K +KD+IK+ +KI +LF ++ FS+EE+  +  F+    +     I         + +V+ ++    L   + +LL LV  HLT KS  +I +        E LT     D P+K  + +IC  L  +++ G L
Sbjct:    6 SKDLAMKAQKKILSNMANKSVVQMFIDDTSSEILDELYRVSKEFTGNRTEAQKVIKDLIKVVVKIAVLFRHNRFSEEELSLAQKFKKKLQQGAMTAISFHEVEFTFDKNVMSNI----LTTCRDMLLKLVGTHLTPKSHGRINHVFNHYSDIELLTHLYDPDGPYKPHLTKICNGLNKLLEEGKL 186          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Cavefish
Match: tnfaip8l1 (tumor necrosis factor, alpha-induced protein 8-like 1 [Source:NCBI gene;Acc:393303])

HSP 1 Score: 68.9366 bits (167), Expect = 9.516e-14
Identity = 47/182 (25.82%), Postives = 93/182 (51.10%), Query Frame = 2
Query:  191 MVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCR---NHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            + L+ QKKL SK ++K +    +++ ++ + D ++R+   YT +R+ A K +K++IK+ +K+ +L+ N  FS+EE+     FR     +    +   +     +  V+  LL +     + +L   ++RHLT KS  ++ +        +FL    S  E ++  + RIC  +  ++D G L
Sbjct:   10 LALQAQKKLMSKMATKAVANLFIDDTSSEVLDELYRVTKEYTRNRKEAQKIIKNLIKMVVKLGVLYRNGQFSNEELVLVERFRKKVHTLAMTAVSFHQIDFTFDRRVMSGLLND----CRDLLHQAINRHLTAKSHARVNHVFNHFADCDFLATLYSPSEVYRAHLQRICDGVNKMLDEGNL 187          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Sea Lamprey
Match: tnfaip8l3 (tumor necrosis factor, alpha-induced protein 8-like 3 [Source:NCBI gene;Acc:393322])

HSP 1 Score: 71.2478 bits (173), Expect = 2.541e-15
Identity = 45/185 (24.32%), Postives = 95/185 (51.35%), Query Frame = 2
Query:  179 PTQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCRNHSVLI----DLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRG 721
             ++++ ++ QKKL  K +++ +  FL+++ A+ + D ++R    +++ R+ + K +KD++K+ +K+ +L  N  FS +E+  +  F+    K+ +  + +     H V      D+L   L   + +L  L+  HLT+KS  ++ N        EFL      +  F+  + +IC  L  +M+ G
Sbjct:    7 SSKSLAVQAQKKLLGKMATRSVAGFLIDDAASDVLDELYRARKAFSHDRKASQKAVKDLVKVAVKLAVLARNGQFSTDELATAECFKR---KLNQATLTA--VSFHEVEFTFDRDVLARTLEDCREMLHRLIGHHLTEKSHARVDNVFRSFGDGEFLAVLYGTEPAFQQHLAKICQGLNKLMEDG 186          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Nematostella
Match: EDO37213 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGA8])

HSP 1 Score: 73.1738 bits (178), Expect = 9.394e-16
Identity = 53/183 (28.96%), Postives = 98/183 (53.55%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDE-PFKTIMDRICFDLQDIMDRGLL 727
            ++++ LR QKK+  K SSK + K L+++    + D +++L     +S++ A K +KD+IK+ +KI++LF N+ F+ EEI  +  FR   FK   +   S    + S     L ++L + +++L  L+ RHLT KS  ++ +   +      L +    +E  F+ I+  +   L  +M+ G L
Sbjct:    8 SKSVALRAQKKVLGKLSSKGMAKALVDDTTGDLLDQLYKLAKMEASSKKEAEKLIKDLIKIVVKISILFRNNQFNKEEIMLAEKFRKN-FKSAAMTFISFYEVDFSFDRQFLSKSLCECQALLHQLIERHLTSKSHGRVDHVFNYFANGALLERLFDPNEQAFRVILKNMVDGLNKLMEDGSL 189          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Medaka
Match: tnfaip8l2b (tumor necrosis factor, alpha-induced protein 8-like protein 2 B [Source:NCBI gene;Acc:101166904])

HSP 1 Score: 76.6406 bits (187), Expect = 1.411e-16
Identity = 50/182 (27.47%), Postives = 96/182 (52.75%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            ++ M ++ QKK+ S  ++K  V+  +++ ++ I D ++R+   YT ++  A K +KD++K+ +KI +LF N+ FS+EE+  + DF+          I      + +    ++ E L   + +LL LV+ HLT KS  +I +        + LTK    +  F+  + RIC  L  +++ G +
Sbjct:    6 SKDMAMKAQKKILSSMATKSSVQMFIDDTSSEILDELYRVSKEYTGNKSEAQKVVKDLVKIAVKIGVLFRNNRFSNEELRVAQDFKKKLHTGAMTAISFYEV-DFTFDKTVMSEILADCRDLLLKLVNTHLTPKSHGRINHVFNHYGDPQLLTKLYDPNSNFRPNLTRICKGLNKLVEDGTI 186          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Medaka
Match: tnfaip8l2b (tumor necrosis factor, alpha-induced protein 8-like protein 2 B [Source:NCBI gene;Acc:101166904])

HSP 1 Score: 76.6406 bits (187), Expect = 1.411e-16
Identity = 50/182 (27.47%), Postives = 96/182 (52.75%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            ++ M ++ QKK+ S  ++K  V+  +++ ++ I D ++R+   YT ++  A K +KD++K+ +KI +LF N+ FS+EE+  + DF+          I      + +    ++ E L   + +LL LV+ HLT KS  +I +        + LTK    +  F+  + RIC  L  +++ G +
Sbjct:    6 SKDMAMKAQKKILSSMATKSSVQMFIDDTSSEILDELYRVSKEYTGNKSEAQKVVKDLVKIAVKIGVLFRNNRFSNEELRVAQDFKKKLHTGAMTAISFYEV-DFTFDKTVMSEILADCRDLLLKLVNTHLTPKSHGRINHVFNHYGDPQLLTKLYDPNSNFRPNLTRICKGLNKLVEDGTI 186          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Medaka
Match: tnfaip8l2b (tumor necrosis factor, alpha-induced protein 8-like protein 2 B [Source:NCBI gene;Acc:101166904])

HSP 1 Score: 76.6406 bits (187), Expect = 1.794e-16
Identity = 50/182 (27.47%), Postives = 96/182 (52.75%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            ++ M ++ QKK+ S  ++K  V+  +++ ++ I D ++R+   YT ++  A K +KD++K+ +KI +LF N+ FS+EE+  + DF+          I      + +    ++ E L   + +LL LV+ HLT KS  +I +        + LTK    +  F+  + RIC  L  +++ G +
Sbjct:   26 SKDMAMKAQKKILSSMATKSSVQMFIDDTSSEILDELYRVSKEYTGNKSEAQKVVKDLVKIAVKIGVLFRNNRFSNEELRVAQDFKKKLHTGAMTAISFYEV-DFTFDKTVMSEILADCRDLLLKLVNTHLTPKSHGRINHVFNHYGDPQLLTKLYDPNSNFRPNLTRICKGLNKLVEDGTI 206          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Medaka
Match: tnfaip8l2b (tumor necrosis factor, alpha-induced protein 8-like protein 2 B [Source:NCBI gene;Acc:101166904])

HSP 1 Score: 76.2554 bits (186), Expect = 4.707e-16
Identity = 50/182 (27.47%), Postives = 96/182 (52.75%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            ++ M ++ QKK+ S  ++K  V+  +++ ++ I D ++R+   YT ++  A K +KD++K+ +KI +LF N+ FS+EE+  + DF+          I      + +    ++ E L   + +LL LV+ HLT KS  +I +        + LTK    +  F+  + RIC  L  +++ G +
Sbjct:   64 SKDMAMKAQKKILSSMATKSSVQMFIDDTSSEILDELYRVSKEYTGNKSEAQKVVKDLVKIAVKIGVLFRNNRFSNEELRVAQDFKKKLHTGAMTAISFYEV-DFTFDKTVMSEILADCRDLLLKLVNTHLTPKSHGRINHVFNHYGDPQLLTKLYDPNSNFRPNLTRICKGLNKLVEDGTI 244          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Medaka
Match: tnfaip8l3 (TNF alpha induced protein 8 like 3 [Source:NCBI gene;Acc:101174899])

HSP 1 Score: 72.7886 bits (177), Expect = 4.547e-15
Identity = 46/182 (25.27%), Postives = 98/182 (53.85%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            ++++ L+ QKK+ SK ++  +   L ++ ++ I D ++++   +T S++ A+K +KD+IK+++KI +L+ N  FS EE++    F+    +     +       ++   ++L E L + + +L  LV +HLT +S  +I +        EFL +     E ++  + +IC  +  ++D G L
Sbjct:   22 SRSLALQAQKKILSKMATMVVANMLTDDTSSEILDELYKVSREFTKSKKEAHKIIKDVIKISLKIGILYRNHQFSQEELDTVERFKKKMNQAAMTAVSFYEVE-YTFDRNILSELLFECRDLLHSLVEQHLTARSHGRIDHVFNHFAHGEFLAELYGDGEEYRLSLRKICNGINKLLDEGTL 202          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Planmine SMEST
Match: SMESG000055619.1 (SMESG000055619.1)

HSP 1 Score: 372.089 bits (954), Expect = 5.969e-132
Identity = 194/194 (100.00%), Postives = 194/194 (100.00%), Query Frame = 2
Query:  146 MCXXXXXXXLIPTQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            MCESSSSSELIPTQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL
Sbjct:    1 MCESSSSSELIPTQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 194          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Planmine SMEST
Match: SMESG000023256.1 (SMESG000023256.1)

HSP 1 Score: 133.65 bits (335), Expect = 4.361e-38
Identity = 69/183 (37.70%), Postives = 118/183 (64.48%), Query Frame = 2
Query:  182 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIK-SRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 727
            +QT+ ++ QKKLASK S+K LVKF ++E + R+F+N++ LL  +  S++ ANK MK ++K+N K+ +LFIN V S+ +IE     R+ F K+ ++ +   R+    +V +D L+E   +  + ++++   +LT+KS+ KI  C  F   +EFL    S  EP+   M++IC D+Q+++DRG+L
Sbjct:   21 SQTISIKVQKKLASKLSTKKLVKFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 203          
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Planmine SMEST
Match: SMESG000002914.1 (SMESG000002914.1)

HSP 1 Score: 51.6026 bits (122), Expect = 8.328e-8
Identity = 42/155 (27.10%), Postives = 79/155 (50.97%), Query Frame = 2
Query:  176 IPTQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIKSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLT 640
            I    ++LR QKK  S F+++  +  ++++ AN++  + + LL      R+ A K     IK+ +KIT L   +  + EEI+K ++ +  F    ++I+        +     L E L K +++L  +V+ H+T+K+K K+      +   EFLT
Sbjct:    6 IDVGNIILRTQKKFLSAFANRKTLGPILDDDANKLLTSAYHLLREVF-GRKEAQKMTTRWIKILVKITFLVNANELNGEEIKKLDEVQSEFGTTVKVILSFWEIE-FTFESSHLQEKLKKMENLLASIVNNHMTEKNKSKLKMLFNLISQEEFLT 158          
The following BLAST results are available for this feature:
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TNFAIP8L36.058e-1829.73TNF alpha induced protein 8 like 3 [Source:HGNC Sy... [more]
TNFAIP8L11.234e-1728.27TNF alpha induced protein 8 like 1 [Source:HGNC Sy... [more]
TNFAIP8L11.234e-1728.27TNF alpha induced protein 8 like 1 [Source:HGNC Sy... [more]
TNFAIP8L32.930e-1729.73TNF alpha induced protein 8 like 3 [Source:HGNC Sy... [more]
TNFAIP8L25.918e-1527.57TNF alpha induced protein 8 like 2 [Source:HGNC Sy... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sigmar1.659e-1229.71gene:FBgn0034894 transcript:FBtr0072096[more]
sigmar1.659e-1229.71gene:FBgn0034894 transcript:FBtr0072098[more]
sigmar2.167e-1229.71gene:FBgn0034894 transcript:FBtr0072097[more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tnfaip8l2b3.695e-2029.19tumor necrosis factor, alpha-induced protein 8-lik... [more]
tnfaip8l2b3.695e-2029.19tumor necrosis factor, alpha-induced protein 8-lik... [more]
tnfaip8l36.007e-1627.03tumor necrosis factor, alpha-induced protein 8-lik... [more]
CR407586.17.421e-1627.03pep chromosome:GRCz11:CHR_ALT_CTG18_1_44:39521878:... [more]
tnfaip8l2a1.496e-1426.49tumor necrosis factor, alpha-induced protein 8-lik... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TNFAIP8L31.080e-1828.65TNF alpha induced protein 8 like 3 [Source:NCBI ge... [more]
tnfaip8l28.367e-1728.57TNF alpha induced protein 8 like 2 [Source:NCBI ge... [more]
tnfaip8l21.329e-1629.17TNF alpha induced protein 8 like 2 [Source:NCBI ge... [more]
tnfaip88.764e-1526.49TNF alpha induced protein 8 [Source:NCBI gene;Acc:... [more]
tnfaip81.089e-1426.49TNF alpha induced protein 8 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tnfaip8l13.012e-1424.73tumor necrosis factor, alpha-induced protein 8-lik... [more]
Tnfaip8l21.487e-1326.49tumor necrosis factor, alpha-induced protein 8-lik... [more]
Tnfaip8l34.282e-1326.37tumor necrosis factor, alpha-induced protein 8-lik... [more]
Tnfaip89.721e-1022.66tumor necrosis factor, alpha-induced protein 8 [So... [more]
Tnfaip81.406e-922.65tumor necrosis factor, alpha-induced protein 8 [So... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7T364|TPL2B_DANRE2.790e-1929.19Tumor necrosis factor, alpha-induced protein 8-lik... [more]
sp|Q6DFE2|TP8L3_XENLA1.438e-1728.65Tumor necrosis factor alpha-induced protein 8-like... [more]
sp|Q8WVP5|TP8L1_HUMAN5.926e-1728.27Tumor necrosis factor alpha-induced protein 8-like... [more]
sp|Q5GJ75|TP8L3_HUMAN1.407e-1629.73Tumor necrosis factor alpha-induced protein 8-like... [more]
sp|Q5BKH4|TP8L2_XENTR4.432e-1628.57Tumor necrosis factor alpha-induced protein 8-like... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8J5352.769e-3136.11Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A448XDV58.502e-2636.26Uncharacterized protein OS=Protopolystoma xenopodi... [more]
A0A267FNY12.840e-2330.77Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GAC05.054e-2330.77Uncharacterized protein OS=Macrostomum lignano OX=... [more]
G4VEC48.696e-2231.18Putative tumor necrosis factor induced protein OS=... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tnfaip8l33.071e-1625.95TNF alpha induced protein 8 like 3 [Source:NCBI ge... [more]
tnfaip8l2b1.571e-1527.03TNF alpha induced protein 8 like 2 [Source:NCBI ge... [more]
tnfaip8l19.516e-1425.82tumor necrosis factor, alpha-induced protein 8-lik... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tnfaip8l32.541e-1524.32tumor necrosis factor, alpha-induced protein 8-lik... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO372139.394e-1628.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tnfaip8l2b1.411e-1627.47tumor necrosis factor, alpha-induced protein 8-lik... [more]
tnfaip8l2b1.411e-1627.47tumor necrosis factor, alpha-induced protein 8-lik... [more]
tnfaip8l2b1.794e-1627.47tumor necrosis factor, alpha-induced protein 8-lik... [more]
tnfaip8l2b4.707e-1627.47tumor necrosis factor, alpha-induced protein 8-lik... [more]
tnfaip8l34.547e-1525.27TNF alpha induced protein 8 like 3 [Source:NCBI ge... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000055619.15.969e-132100.00SMESG000055619.1[more]
SMESG000023256.14.361e-3837.70SMESG000023256.1[more]
SMESG000002914.18.328e-827.10SMESG000002914.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019632 ID=SMED30019632|Name=Tumor necrosis factor alpha-induced protein 8-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=847bp
CAGTAAACAACATGAAATTTATTTTAAATGATTTCTATAGTAACAGAAAT
ATTCAAAACTAATTCCATTTCTCTTTGAATTTGTGTTGAAAAGTTATTTA
ACAAAGGAAATTATTTTTCTAACAGAAATCCCATTTCAACAATCTATGTG
TGAATCGTCGAGTTCCAGTGAGTTGATTCCCACTCAAACAATGGTGTTGC
GCTGTCAGAAAAAGTTGGCAAGTAAATTCTCGTCAAAATATCTCGTCAAA
TTTCTAATGAATGAACCGGCAAATAGAATTTTCGACAATGTTCACCGATT
ACTGTTCCATTATACAAATTCTCGCCAATTAGCAAACAAACAAATGAAAG
ACATGATTAAATTGAATATCAAAATCACTTTGCTTTTCATCAATGATGTT
TTCAGTGATGAAGAAATCGAGAAGTCAAATGATTTTCGTGACGTATTTTT
CAAAATCTGTGAACTAATAATAAAAAGTCGACGATGCCGGAATCATTCAG
TTCTCATAGATTTGCTATTGGAAAATCTCATGAAAGCAAAATCCATTCTT
CTATTACTTGTCCATCGCCATTTGACTGATAAGTCCAAATGTAAAATTAT
CAATTGTGCAGAGTTTCTTGTGACGAGAGAATTTCTGACGAAAAGTTTGT
CAATTGATGAACCCTTTAAAACAATAATGGATAGAATTTGTTTCGATCTT
CAAGATATCATGGATCGGGGATTGCTTTGATAAATTGATTGGTTGTTTAA
TTGGCTGTGTGCACCTGATTGGTCAGTTGGGACAATCAAATATTTTGTAT
GAGCACATTAATTTTAAATGTAATCATAGTTTAATTGTTAGATCGGA
back to top

protein sequence of SMED30019632-orf-1

>SMED30019632-orf-1 ID=SMED30019632-orf-1|Name=SMED30019632-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=195bp
MCESSSSSELIPTQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVH
RLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDV
FFKICELIIKSRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCK
IINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006915apoptotic process
GO:0042981regulation of apoptotic process
GO:0043065positive regulation of apoptotic process
GO:0043154negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0002376immune system process
GO:0045087innate immune response
GO:0050728negative regulation of inflammatory response
GO:0050868negative regulation of T cell activation
Vocabulary: molecular function
TermDefinition
GO:0043027cysteine-type endopeptidase inhibitor activity involved in apoptotic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR038355TNFAIP8_sf
IPR008477TNFAIP8-like
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008477Tumor necrosis factor alpha-induced protein 8-likePFAMPF05527DUF758coord: 13..192
e-value: 1.8E-36
score: 125.8
IPR008477Tumor necrosis factor alpha-induced protein 8-likePANTHERPTHR12757TUMOR NECROSIS FACTOR INDUCED PROTEINcoord: 7..193
IPR038355TNFAIP8 superfamilyGENE3DG3DSA:1.20.1440.160coord: 11..194
e-value: 9.9E-38
score: 131.6
NoneNo IPR availablePANTHERPTHR12757:SF1TUMOR NECROSIS FACTOR ALPHA-INDUCED PROTEIN 8-LIKE PROTEINcoord: 7..193