serrate RNA effector molecule

Overview
Nameserrate RNA effector molecule (AKG62128.1)
Smed IDSMED30019623
Length (bp)2740
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of serrate RNA effector molecule (SMED30019623) t-SNE clustered cells

Violin plots show distribution of expression levels for serrate RNA effector molecule (SMED30019623) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of serrate RNA effector molecule (SMED30019623) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for serrate RNA effector molecule (SMED30019623) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019623

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30019623h1SMcG0007175 SmedASXL_015734SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30019623h1SMcG0007175 Contig37575newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019623h1SMcG0007175 Contig37575uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30019623h1SMcG0007175 dd_Smed_v4_1872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019623h1SMcG0007175 dd_Smed_v4_1872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019623h1SMcG0007175 dd_Smed_v4_1872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019623h1SMcG0007175 dd_Smed_v4_1872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019623h1SMcG0007175 dd_Smed_v4_1872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of serrate RNA effector molecule vs. Ensembl Human
Match: SRRT (serrate, RNA effector molecule [Source:HGNC Symbol;Acc:HGNC:24101])

HSP 1 Score: 371.318 bits (952), Expect = 2.529e-118
Identity = 190/362 (52.49%), Postives = 256/362 (70.72%), Query Frame = 2
Query: 1091 EPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDT-TNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPE-HPSNRPG 2170
            +PR LHKT S+F+RN+ PN+ R+EI +L K Y GF+R+AL +P P+R+FFRRGWVT+DR+VNIKEICWNL NIRL +C++   VNR+LT+R+R +  +  HK ++R+DIK+A++L+   D R  LW  E G       + S NP+L NIT+YL++E S EEE LLG +  +  E      +P+ I VE D+KL  VLD+L+LYLR VHS DYY+T EY  EDEMP+RCGI+H RG        ++  EV E+ K+FE K   +L+  E L+ +EA+K+G K  ++ V+ F+  NTQE+ KDKWLCPLSGKKFKGP+FV+KHI NKH +K+E VK+   FFNN+L D KRP LPE  P+  PG
Sbjct:   43 KPRPLHKTCSLFMRNIAPNISRAEIISLCKRYPGFMRVALSEPQPERRFFRRGWVTFDRSVNIKEICWNLQNIRLRECELSPGVNRDLTRRVRNINGITQHKQIVRNDIKLAAKLIHTLDDRTQLWASEPGTPPLPTSLPSQNPILKNITDYLIEEVSAEEEELLGSSGGAPPEEPPKEGNPAEINVERDEKLIKVLDKLLLYLRIVHSLDYYNTCEYPNEDEMPNRCGIIHVRGP--MPPNRISHGEVLEWQKTFEEKLTPLLSVRESLSEEEAQKMGRKDPEQEVEKFVTSNTQELGKDKWLCPLSGKKFKGPEFVRKHIFNKHAEKIEEVKKEVAFFNNFLTDAKRPALPEIKPAQPPG 402          
BLAST of serrate RNA effector molecule vs. Ensembl Human
Match: SRRT (serrate, RNA effector molecule [Source:HGNC Symbol;Acc:HGNC:24101])

HSP 1 Score: 369.392 bits (947), Expect = 3.041e-113
Identity = 190/362 (52.49%), Postives = 256/362 (70.72%), Query Frame = 2
Query: 1091 EPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDT-TNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPE-HPSNRPG 2170
            +PR LHKT S+F+RN+ PN+ R+EI +L K Y GF+R+AL +P P+R+FFRRGWVT+DR+VNIKEICWNL NIRL +C++   VNR+LT+R+R +  +  HK ++R+DIK+A++L+   D R  LW  E G       + S NP+L NIT+YL++E S EEE LLG +  +  E      +P+ I VE D+KL  VLD+L+LYLR VHS DYY+T EY  EDEMP+RCGI+H RG        ++  EV E+ K+FE K   +L+  E L+ +EA+K+G K  ++ V+ F+  NTQE+ KDKWLCPLSGKKFKGP+FV+KHI NKH +K+E VK+   FFNN+L D KRP LPE  P+  PG
Sbjct:  412 KPRPLHKTCSLFMRNIAPNISRAEIISLCKRYPGFMRVALSEPQPERRFFRRGWVTFDRSVNIKEICWNLQNIRLRECELSPGVNRDLTRRVRNINGITQHKQIVRNDIKLAAKLIHTLDDRTQLWASEPGTPPLPTSLPSQNPILKNITDYLIEEVSAEEEELLGSSGGAPPEEPPKEGNPAEINVERDEKLIKVLDKLLLYLRIVHSLDYYNTCEYPNEDEMPNRCGIIHVRGP--MPPNRISHGEVLEWQKTFEEKLTPLLSVRESLSEEEAQKMGRKDPEQEVEKFVTSNTQELGKDKWLCPLSGKKFKGPEFVRKHIFNKHAEKIEEVKKEVAFFNNFLTDAKRPALPEIKPAQPPG 771          

HSP 2 Score: 113.235 bits (282), Expect = 7.595e-25
Identity = 53/122 (43.44%), Postives = 78/122 (63.93%), Query Frame = 2
Query:  518 PPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTIL 883
            P M  FK FL   DD ++  +A+K+YN+YK  F  +Q++ FF +H ++EWFR KY P  V KR+ E    +Q R  +F  L E  W DN+ + +D+ D+IV+++DA VI +EGG  +DL IL
Sbjct:  147 PVMKTFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDEVGKRRQEARGALQNRLRVFLSLMETGWFDNLLLDIDKADAIVKMLDAAVIKMEGGTENDLRIL 268          
BLAST of serrate RNA effector molecule vs. Ensembl Human
Match: SRRT (serrate, RNA effector molecule [Source:HGNC Symbol;Acc:HGNC:24101])

HSP 1 Score: 369.392 bits (947), Expect = 3.111e-113
Identity = 190/362 (52.49%), Postives = 256/362 (70.72%), Query Frame = 2
Query: 1091 EPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDT-TNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPE-HPSNRPG 2170
            +PR LHKT S+F+RN+ PN+ R+EI +L K Y GF+R+AL +P P+R+FFRRGWVT+DR+VNIKEICWNL NIRL +C++   VNR+LT+R+R +  +  HK ++R+DIK+A++L+   D R  LW  E G       + S NP+L NIT+YL++E S EEE LLG +  +  E      +P+ I VE D+KL  VLD+L+LYLR VHS DYY+T EY  EDEMP+RCGI+H RG        ++  EV E+ K+FE K   +L+  E L+ +EA+K+G K  ++ V+ F+  NTQE+ KDKWLCPLSGKKFKGP+FV+KHI NKH +K+E VK+   FFNN+L D KRP LPE  P+  PG
Sbjct:  413 KPRPLHKTCSLFMRNIAPNISRAEIISLCKRYPGFMRVALSEPQPERRFFRRGWVTFDRSVNIKEICWNLQNIRLRECELSPGVNRDLTRRVRNINGITQHKQIVRNDIKLAAKLIHTLDDRTQLWASEPGTPPLPTSLPSQNPILKNITDYLIEEVSAEEEELLGSSGGAPPEEPPKEGNPAEINVERDEKLIKVLDKLLLYLRIVHSLDYYNTCEYPNEDEMPNRCGIIHVRGP--MPPNRISHGEVLEWQKTFEEKLTPLLSVRESLSEEEAQKMGRKDPEQEVEKFVTSNTQELGKDKWLCPLSGKKFKGPEFVRKHIFNKHAEKIEEVKKEVAFFNNFLTDAKRPALPEIKPAQPPG 772          

HSP 2 Score: 113.235 bits (282), Expect = 7.605e-25
Identity = 53/122 (43.44%), Postives = 78/122 (63.93%), Query Frame = 2
Query:  518 PPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTIL 883
            P M  FK FL   DD ++  +A+K+YN+YK  F  +Q++ FF +H ++EWFR KY P  V KR+ E    +Q R  +F  L E  W DN+ + +D+ D+IV+++DA VI +EGG  +DL IL
Sbjct:  147 PVMKTFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDEVGKRRQEARGALQNRLRVFLSLMETGWFDNLLLDIDKADAIVKMLDAAVIKMEGGTENDLRIL 268          
BLAST of serrate RNA effector molecule vs. Ensembl Human
Match: SRRT (serrate, RNA effector molecule [Source:HGNC Symbol;Acc:HGNC:24101])

HSP 1 Score: 369.392 bits (947), Expect = 3.348e-113
Identity = 190/362 (52.49%), Postives = 256/362 (70.72%), Query Frame = 2
Query: 1091 EPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDT-TNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPE-HPSNRPG 2170
            +PR LHKT S+F+RN+ PN+ R+EI +L K Y GF+R+AL +P P+R+FFRRGWVT+DR+VNIKEICWNL NIRL +C++   VNR+LT+R+R +  +  HK ++R+DIK+A++L+   D R  LW  E G       + S NP+L NIT+YL++E S EEE LLG +  +  E      +P+ I VE D+KL  VLD+L+LYLR VHS DYY+T EY  EDEMP+RCGI+H RG        ++  EV E+ K+FE K   +L+  E L+ +EA+K+G K  ++ V+ F+  NTQE+ KDKWLCPLSGKKFKGP+FV+KHI NKH +K+E VK+   FFNN+L D KRP LPE  P+  PG
Sbjct:  412 KPRPLHKTCSLFMRNIAPNISRAEIISLCKRYPGFMRVALSEPQPERRFFRRGWVTFDRSVNIKEICWNLQNIRLRECELSPGVNRDLTRRVRNINGITQHKQIVRNDIKLAAKLIHTLDDRTQLWASEPGTPPLPTSLPSQNPILKNITDYLIEEVSAEEEELLGSSGGAPPEEPPKEGNPAEINVERDEKLIKVLDKLLLYLRIVHSLDYYNTCEYPNEDEMPNRCGIIHVRGP--MPPNRISHGEVLEWQKTFEEKLTPLLSVRESLSEEEAQKMGRKDPEQEVEKFVTSNTQELGKDKWLCPLSGKKFKGPEFVRKHIFNKHAEKIEEVKKEVAFFNNFLTDAKRPALPEIKPAQPPG 771          

HSP 2 Score: 113.235 bits (282), Expect = 7.683e-25
Identity = 53/122 (43.44%), Postives = 78/122 (63.93%), Query Frame = 2
Query:  518 PPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTIL 883
            P M  FK FL   DD ++  +A+K+YN+YK  F  +Q++ FF +H ++EWFR KY P  V KR+ E    +Q R  +F  L E  W DN+ + +D+ D+IV+++DA VI +EGG  +DL IL
Sbjct:  147 PVMKTFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDEVGKRRQEARGALQNRLRVFLSLMETGWFDNLLLDIDKADAIVKMLDAAVIKMEGGTENDLRIL 268          
BLAST of serrate RNA effector molecule vs. Ensembl Human
Match: SRRT (serrate, RNA effector molecule [Source:HGNC Symbol;Acc:HGNC:24101])

HSP 1 Score: 369.392 bits (947), Expect = 3.425e-113
Identity = 190/362 (52.49%), Postives = 256/362 (70.72%), Query Frame = 2
Query: 1091 EPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDT-TNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPE-HPSNRPG 2170
            +PR LHKT S+F+RN+ PN+ R+EI +L K Y GF+R+AL +P P+R+FFRRGWVT+DR+VNIKEICWNL NIRL +C++   VNR+LT+R+R +  +  HK ++R+DIK+A++L+   D R  LW  E G       + S NP+L NIT+YL++E S EEE LLG +  +  E      +P+ I VE D+KL  VLD+L+LYLR VHS DYY+T EY  EDEMP+RCGI+H RG        ++  EV E+ K+FE K   +L+  E L+ +EA+K+G K  ++ V+ F+  NTQE+ KDKWLCPLSGKKFKGP+FV+KHI NKH +K+E VK+   FFNN+L D KRP LPE  P+  PG
Sbjct:  413 KPRPLHKTCSLFMRNIAPNISRAEIISLCKRYPGFMRVALSEPQPERRFFRRGWVTFDRSVNIKEICWNLQNIRLRECELSPGVNRDLTRRVRNINGITQHKQIVRNDIKLAAKLIHTLDDRTQLWASEPGTPPLPTSLPSQNPILKNITDYLIEEVSAEEEELLGSSGGAPPEEPPKEGNPAEINVERDEKLIKVLDKLLLYLRIVHSLDYYNTCEYPNEDEMPNRCGIIHVRGP--MPPNRISHGEVLEWQKTFEEKLTPLLSVRESLSEEEAQKMGRKDPEQEVEKFVTSNTQELGKDKWLCPLSGKKFKGPEFVRKHIFNKHAEKIEEVKKEVAFFNNFLTDAKRPALPEIKPAQPPG 772          

HSP 2 Score: 113.235 bits (282), Expect = 7.694e-25
Identity = 53/122 (43.44%), Postives = 78/122 (63.93%), Query Frame = 2
Query:  518 PPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTIL 883
            P M  FK FL   DD ++  +A+K+YN+YK  F  +Q++ FF +H ++EWFR KY P  V KR+ E    +Q R  +F  L E  W DN+ + +D+ D+IV+++DA VI +EGG  +DL IL
Sbjct:  147 PVMKTFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDEVGKRRQEARGALQNRLRVFLSLMETGWFDNLLLDIDKADAIVKMLDAAVIKMEGGTENDLRIL 268          
BLAST of serrate RNA effector molecule vs. Ensembl Celegans
Match: E01A2.2 (Serrate RNA effector molecule homolog [Source:UniProtKB/Swiss-Prot;Acc:Q966L5])

HSP 1 Score: 355.14 bits (910), Expect = 6.198e-110
Identity = 215/581 (37.01%), Postives = 326/581 (56.11%), Query Frame = 2
Query:  479 IPKSDDTPNYPTQP------PMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEK-RKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILDSKRYRSESPNDSHILEDVVVKSPEKVTSSEGIEVVNKEIIEPDDKKFXXXXXXXXXXXXKFEKKSELQEPRA-LHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDTTNPM----------SSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPS-NIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHAR-----GAHIHVDKP----LTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRP 2137
            + +S +  + PT+       P+  FK FL  Q+DDI  + A+KKYNEYK      QL+ FF +H ++EWFR KY P   +K R+  LE N+Q R ++F  L E+   +   +   + ++I+R++D+VV+ LE G   +L  + +++   ES  D        +K  E    +E      KE  EP+ K+  E   + E  E   E  +E    +  +H+T S+FLRN+ P +   E+E L K   GFLRLAL D   +RKF+RRGW T+ R +NIKEICW LN  RL + D+ AI+NR++T+R+R    +A+HK V  +D+K+A +L   +DK+  L+   D  D    M          +S NPL+  +   +     ++    +       L ++  G  P+  I+ E DD +   LD LI+YLR VHS D+Y+   Y  ED MP+RCG++H R     G  I  D+     + QK V ++I  F  + E  L   + ++ +E +K+G K  ++ V+ FI +NT E++KDKWLCPLSGKKFKGP+F++KH+ +KH DK+E  +   +FFNNYL D +RP
Sbjct:   63 VSRSGNGSDLPTESDSIYSGPLQTFKKFLTSQEDDISEEDAIKKYNEYKTEHRKHQLERFFRAHKDEEWFRLKYKPDDAKKLREAHLE-NVQKRLQVFNELKEQGQFNKFSLDFGDAEAIIRMLDSVVVKLENGTEDELKAVLAQKLEDESLAD--------IKKDENGNGTE----QPKE--EPEVKQ--ESGATEELEEGAIEDGTEKSSNKVNIHRTCSVFLRNIPPGLTYEELEGLCKKSPGFLRLALTDGIAERKFYRRGWATFKRDINIKEICWALNAHRLRETDLNAIINRDITRRVRTNNGIASHKQVAINDLKLAVKLTVLYDKKIGLFNAADEADADREMDIRMGVDLVAASTNPLIKEVKSLV----PHDVLNDISEEEAELLGVSNGGEAPAEKIRFERDDNILKALDLLIVYLRIVHSIDFYNHGHYAQEDSMPNRCGLIHVRGQPPSGVSITTDEDGALVVPQKFVNDFISGFNSRIEKGLIEKQYVSEEELEKMGKKDGEKEVEAFIQKNTVELAKDKWLCPLSGKKFKGPEFIRKHLQSKHEDKLEEARAEADFFNNYLADAQRP 622          
BLAST of serrate RNA effector molecule vs. Ensembl Celegans
Match: E01A2.2 (Serrate RNA effector molecule homolog [Source:UniProtKB/Swiss-Prot;Acc:Q966L5])

HSP 1 Score: 280.026 bits (715), Expect = 6.522e-84
Identity = 148/365 (40.55%), Postives = 218/365 (59.73%), Query Frame = 2
Query: 1103 LHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDTTNPM----------SSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPS-NIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHAR-----GAHIHVDKP----LTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRP 2137
            +H+T S+FLRN+ P +   E+E L K   GFLRLAL D   +RKF+RRGW T+ R +NIKEICW LN  RL + D+ AI+NR++T+R+R    +A+HK V  +D+K+A +L   +DK+  L+   D  D    M          +S NPL+  +   +     ++    +       L ++  G  P+  I+ E DD +   LD LI+YLR VHS D+Y+   Y  ED MP+RCG++H R     G  I  D+     + QK V ++I  F  + E  L   + ++ +E +K+G K  ++ V+ FI +NT E++KDKWLCPLSGKKFKGP+F++KH+ +KH DK+E  +   +FFNNYL D +RP
Sbjct:   79 IHRTCSVFLRNIPPGLTYEELEGLCKKSPGFLRLALTDGIAERKFYRRGWATFKRDINIKEICWALNAHRLRETDLNAIINRDITRRVRTNNGIASHKQVAINDLKLAVKLTVLYDKKIGLFNAADEADADREMDIRMGVDLVAASTNPLIKEVKSLV----PHDVLNDISEEEAELLGVSNGGEAPAEKIRFERDDNILKALDLLIVYLRIVHSIDFYNHGHYAQEDSMPNRCGLIHVRGQPPSGVSITTDEDGALVVPQKFVNDFISGFNSRIEKGLIEKQYVSEEELEKMGKKDGEKEVEAFIQKNTVELAKDKWLCPLSGKKFKGPEFIRKHLQSKHEDKLEEARAEADFFNNYLADAQRP 439          
BLAST of serrate RNA effector molecule vs. Ensembl Fly
Match: Ars2 (gene:FBgn0033062 transcript:FBtr0310665)

HSP 1 Score: 368.237 bits (944), Expect = 1.792e-112
Identity = 185/377 (49.07%), Postives = 249/377 (66.05%), Query Frame = 2
Query: 1091 EPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQR---------------EDGKDTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARG-AHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPEHP--SNRP 2167
            +PRALH+T SIFLRNL P++ RSEIEA+   +SG+LR+A+ DP  +R+++RRGW+T+ R VNIKEICW LNN RL DC++GAIVNR+L++R+RP   +  HK V+R DIK+ +++    D++  LW                 E+G  +T   +S NP+L NIT+YL+                  L LT    D     +E D++L +VLDRL+LYLR VHS DYY+  EY  EDEMP+RCGI+HARG   + V    T  +V+EYIK +E K +  L     L+ +E K LG K  +  V+ F+  NTQE++KDKWLCPLSGKKFKGP+F++KHI NKH +KV+ V++  ++FNNYL DPKRPQLPEHP  S RP
Sbjct:  503 QPRALHRTSSIFLRNLAPSITRSEIEAVCNRFSGYLRVAIADPLVERRWYRRGWITFMRDVNIKEICWGLNNQRLRDCEMGAIVNRDLSRRVRPANGITAHKQVVRSDIKLCAKIALNLDEKFRLWAEGPKDDSNSARANESSENGSGSTYGFNSQNPVLQNITDYLI--------EEASAEEEELLGLTGENKDTEGEPIERDEQLISVLDRLVLYLRIVHSVDYYNHCEYPYEDEMPNRCGIIHARGPPPVRV----TNNDVQEYIKIYESKLQQFLTKTVPLSDEEIKNLGAKDAETEVEKFVQANTQELAKDKWLCPLSGKKFKGPEFIRKHIFNKHEEKVDEVRKEVQYFNNYLRDPKRPQLPEHPGTSKRP 867          

HSP 2 Score: 108.612 bits (270), Expect = 1.048e-23
Identity = 52/127 (40.94%), Postives = 76/127 (59.84%), Query Frame = 2
Query:  512 TQPPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILDSK 892
            TQP ML  K FL  QD++I   + M+KY EYK  F  +QL  FF +H ++EWF+ KY P+   KR  E    +Q R ++F  L E   + ++K+   + D+++R++D  VI LEGG   DL +LD K
Sbjct:  147 TQPAMLNLKQFLDTQDENISDSEVMRKYTEYKTDFKRQQLNEFFVAHKDEEWFKNKYHPEDSVKRSEEQRGFLQRRTDVFMELLENGTIGSVKVDSSQADALIRVLDTCVIKLEGGTDEDLKVLDEK 273          
BLAST of serrate RNA effector molecule vs. Ensembl Fly
Match: Ars2 (gene:FBgn0033062 transcript:FBtr0310667)

HSP 1 Score: 368.237 bits (944), Expect = 1.911e-112
Identity = 185/377 (49.07%), Postives = 249/377 (66.05%), Query Frame = 2
Query: 1091 EPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLW---------------QREDGKDTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARG-AHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPEHP--SNRP 2167
            +PRALH+T SIFLRNL P++ RSEIEA+   +SG+LR+A+ DP  +R+++RRGW+T+ R VNIKEICW LNN RL DC++GAIVNR+L++R+RP   +  HK V+R DIK+ +++    D++  LW                 E+G  +T   +S NP+L NIT+YL+                  L LT    D     +E D++L +VLDRL+LYLR VHS DYY+  EY  EDEMP+RCGI+HARG   + V    T  +V+EYIK +E K +  L     L+ +E K LG K  +  V+ F+  NTQE++KDKWLCPLSGKKFKGP+F++KHI NKH +KV+ V++  ++FNNYL DPKRPQLPEHP  S RP
Sbjct:  507 QPRALHRTSSIFLRNLAPSITRSEIEAVCNRFSGYLRVAIADPLVERRWYRRGWITFMRDVNIKEICWGLNNQRLRDCEMGAIVNRDLSRRVRPANGITAHKQVVRSDIKLCAKIALNLDEKFRLWAEGPKDDSNSARANESSENGSGSTYGFNSQNPVLQNITDYLI--------EEASAEEEELLGLTGENKDTEGEPIERDEQLISVLDRLVLYLRIVHSVDYYNHCEYPYEDEMPNRCGIIHARGPPPVRV----TNNDVQEYIKIYESKLQQFLTKTVPLSDEEIKNLGAKDAETEVEKFVQANTQELAKDKWLCPLSGKKFKGPEFIRKHIFNKHEEKVDEVRKEVQYFNNYLRDPKRPQLPEHPGTSKRP 871          

HSP 2 Score: 108.612 bits (270), Expect = 1.117e-23
Identity = 52/127 (40.94%), Postives = 76/127 (59.84%), Query Frame = 2
Query:  512 TQPPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILDSK 892
            TQP ML  K FL  QD++I   + M+KY EYK  F  +QL  FF +H ++EWF+ KY P+   KR  E    +Q R ++F  L E   + ++K+   + D+++R++D  VI LEGG   DL +LD K
Sbjct:  151 TQPAMLNLKQFLDTQDENISDSEVMRKYTEYKTDFKRQQLNEFFVAHKDEEWFKNKYHPEDSVKRSEEQRGFLQRRTDVFMELLENGTIGSVKVDSSQADALIRVLDTCVIKLEGGTDEDLKVLDEK 277          
BLAST of serrate RNA effector molecule vs. Ensembl Fly
Match: Ars2 (gene:FBgn0033062 transcript:FBtr0086020)

HSP 1 Score: 367.851 bits (943), Expect = 2.924e-112
Identity = 185/377 (49.07%), Postives = 249/377 (66.05%), Query Frame = 2
Query: 1091 EPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQR---------------EDGKDTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARG-AHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPEHP--SNRP 2167
            +PRALH+T SIFLRNL P++ RSEIEA+   +SG+LR+A+ DP  +R+++RRGW+T+ R VNIKEICW LNN RL DC++GAIVNR+L++R+RP   +  HK V+R DIK+ +++    D++  LW                 E+G  +T   +S NP+L NIT+YL+                  L LT    D     +E D++L +VLDRL+LYLR VHS DYY+  EY  EDEMP+RCGI+HARG   + V    T  +V+EYIK +E K +  L     L+ +E K LG K  +  V+ F+  NTQE++KDKWLCPLSGKKFKGP+F++KHI NKH +KV+ V++  ++FNNYL DPKRPQLPEHP  S RP
Sbjct:  507 QPRALHRTSSIFLRNLAPSITRSEIEAVCNRFSGYLRVAIADPLVERRWYRRGWITFMRDVNIKEICWGLNNQRLRDCEMGAIVNRDLSRRVRPANGITAHKQVVRSDIKLCAKIALNLDEKFRLWAEGPKDDSNSARANESSENGSGSTYGFNSQNPVLQNITDYLI--------EEASAEEEELLGLTGENKDTEGEPIERDEQLISVLDRLVLYLRIVHSVDYYNHCEYPYEDEMPNRCGIIHARGPPPVRV----TNNDVQEYIKIYESKLQQFLTKTVPLSDEEIKNLGAKDAETEVEKFVQANTQELAKDKWLCPLSGKKFKGPEFIRKHIFNKHEEKVDEVRKEVQYFNNYLRDPKRPQLPEHPGTSKRP 871          

HSP 2 Score: 108.227 bits (269), Expect = 1.309e-23
Identity = 52/127 (40.94%), Postives = 76/127 (59.84%), Query Frame = 2
Query:  512 TQPPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILDSK 892
            TQP ML  K FL  QD++I   + M+KY EYK  F  +QL  FF +H ++EWF+ KY P+   KR  E    +Q R ++F  L E   + ++K+   + D+++R++D  VI LEGG   DL +LD K
Sbjct:  151 TQPAMLNLKQFLDTQDENISDSEVMRKYTEYKTDFKRQQLNEFFVAHKDEEWFKNKYHPEDSVKRSEEQRGFLQRRTDVFMELLENGTIGSVKVDSSQADALIRVLDTCVIKLEGGTDEDLKVLDEK 277          
BLAST of serrate RNA effector molecule vs. Ensembl Fly
Match: Ars2 (gene:FBgn0033062 transcript:FBtr0086021)

HSP 1 Score: 367.851 bits (943), Expect = 2.924e-112
Identity = 185/377 (49.07%), Postives = 249/377 (66.05%), Query Frame = 2
Query: 1091 EPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQR---------------EDGKDTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARG-AHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPEHP--SNRP 2167
            +PRALH+T SIFLRNL P++ RSEIEA+   +SG+LR+A+ DP  +R+++RRGW+T+ R VNIKEICW LNN RL DC++GAIVNR+L++R+RP   +  HK V+R DIK+ +++    D++  LW                 E+G  +T   +S NP+L NIT+YL+                  L LT    D     +E D++L +VLDRL+LYLR VHS DYY+  EY  EDEMP+RCGI+HARG   + V    T  +V+EYIK +E K +  L     L+ +E K LG K  +  V+ F+  NTQE++KDKWLCPLSGKKFKGP+F++KHI NKH +KV+ V++  ++FNNYL DPKRPQLPEHP  S RP
Sbjct:  507 QPRALHRTSSIFLRNLAPSITRSEIEAVCNRFSGYLRVAIADPLVERRWYRRGWITFMRDVNIKEICWGLNNQRLRDCEMGAIVNRDLSRRVRPANGITAHKQVVRSDIKLCAKIALNLDEKFRLWAEGPKDDSNSARANESSENGSGSTYGFNSQNPVLQNITDYLI--------EEASAEEEELLGLTGENKDTEGEPIERDEQLISVLDRLVLYLRIVHSVDYYNHCEYPYEDEMPNRCGIIHARGPPPVRV----TNNDVQEYIKIYESKLQQFLTKTVPLSDEEIKNLGAKDAETEVEKFVQANTQELAKDKWLCPLSGKKFKGPEFIRKHIFNKHEEKVDEVRKEVQYFNNYLRDPKRPQLPEHPGTSKRP 871          

HSP 2 Score: 108.227 bits (269), Expect = 1.309e-23
Identity = 52/127 (40.94%), Postives = 76/127 (59.84%), Query Frame = 2
Query:  512 TQPPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILDSK 892
            TQP ML  K FL  QD++I   + M+KY EYK  F  +QL  FF +H ++EWF+ KY P+   KR  E    +Q R ++F  L E   + ++K+   + D+++R++D  VI LEGG   DL +LD K
Sbjct:  151 TQPAMLNLKQFLDTQDENISDSEVMRKYTEYKTDFKRQQLNEFFVAHKDEEWFKNKYHPEDSVKRSEEQRGFLQRRTDVFMELLENGTIGSVKVDSSQADALIRVLDTCVIKLEGGTDEDLKVLDEK 277          
BLAST of serrate RNA effector molecule vs. Ensembl Fly
Match: Ars2 (gene:FBgn0033062 transcript:FBtr0086018)

HSP 1 Score: 367.851 bits (943), Expect = 2.924e-112
Identity = 185/377 (49.07%), Postives = 249/377 (66.05%), Query Frame = 2
Query: 1091 EPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQR---------------EDGKDTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARG-AHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPEHP--SNRP 2167
            +PRALH+T SIFLRNL P++ RSEIEA+   +SG+LR+A+ DP  +R+++RRGW+T+ R VNIKEICW LNN RL DC++GAIVNR+L++R+RP   +  HK V+R DIK+ +++    D++  LW                 E+G  +T   +S NP+L NIT+YL+                  L LT    D     +E D++L +VLDRL+LYLR VHS DYY+  EY  EDEMP+RCGI+HARG   + V    T  +V+EYIK +E K +  L     L+ +E K LG K  +  V+ F+  NTQE++KDKWLCPLSGKKFKGP+F++KHI NKH +KV+ V++  ++FNNYL DPKRPQLPEHP  S RP
Sbjct:  507 QPRALHRTSSIFLRNLAPSITRSEIEAVCNRFSGYLRVAIADPLVERRWYRRGWITFMRDVNIKEICWGLNNQRLRDCEMGAIVNRDLSRRVRPANGITAHKQVVRSDIKLCAKIALNLDEKFRLWAEGPKDDSNSARANESSENGSGSTYGFNSQNPVLQNITDYLI--------EEASAEEEELLGLTGENKDTEGEPIERDEQLISVLDRLVLYLRIVHSVDYYNHCEYPYEDEMPNRCGIIHARGPPPVRV----TNNDVQEYIKIYESKLQQFLTKTVPLSDEEIKNLGAKDAETEVEKFVQANTQELAKDKWLCPLSGKKFKGPEFIRKHIFNKHEEKVDEVRKEVQYFNNYLRDPKRPQLPEHPGTSKRP 871          

HSP 2 Score: 108.227 bits (269), Expect = 1.309e-23
Identity = 52/127 (40.94%), Postives = 76/127 (59.84%), Query Frame = 2
Query:  512 TQPPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILDSK 892
            TQP ML  K FL  QD++I   + M+KY EYK  F  +QL  FF +H ++EWF+ KY P+   KR  E    +Q R ++F  L E   + ++K+   + D+++R++D  VI LEGG   DL +LD K
Sbjct:  151 TQPAMLNLKQFLDTQDENISDSEVMRKYTEYKTDFKRQQLNEFFVAHKDEEWFKNKYHPEDSVKRSEEQRGFLQRRTDVFMELLENGTIGSVKVDSSQADALIRVLDTCVIKLEGGTDEDLKVLDEK 277          
BLAST of serrate RNA effector molecule vs. Ensembl Zebrafish
Match: srrt (serrate RNA effector molecule homolog (Arabidopsis) [Source:NCBI gene;Acc:192311])

HSP 1 Score: 362.459 bits (929), Expect = 1.375e-110
Identity = 184/353 (52.12%), Postives = 252/353 (71.39%), Query Frame = 2
Query: 1094 PRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDT-TNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPE 2149
            PR LH+T S+F+R++ P + ++EI AL + Y GF+R+ L +P P+R+FFRR WVT+DR VNIKEICWNL NIRL DC++   VNR+L +R+R V  +  HK V+R+DIK+A++L+   D R  LW ++  ++T T  + + NP+L NIT+YL++E S EEE LLG     + E      +P+ I VE D+KL  VLDRL+ YLR VHS DYY+T EY  EDEMP+RCGI+H RG  I  ++ +T +EV ++ K+FE K   + +  E L+ DEA K+G K  ++ V+ F+  NTQE+ KDKWLCPLSGKKFKGP+FV+KHILNKH DK+E VK+   FFNN+L+D KRP +PE
Sbjct:  445 PRPLHRTCSLFMRSIAPTISKAEIVALCRRYPGFMRVCLSEPQPERRFFRRCWVTFDRGVNIKEICWNLQNIRLRDCELAPGVNRDLARRVRNVNGITQHKQVLRNDIKLAAKLIHALDDREKLWSQKPREETPTLELPAQNPILKNITDYLIEEVSAEEEELLGSAGGGDSEDGSKEGNPTEITVERDEKLVKVLDRLLFYLRIVHSIDYYNTCEYPSEDEMPNRCGIIHVRGP-IPPNR-ITLREVSDWQKTFEEKMGPLFSVKENLSEDEAAKMGRKDPEQEVEKFVVANTQELGKDKWLCPLSGKKFKGPEFVRKHILNKHGDKIEEVKKEVVFFNNFLMDAKRPCIPE 795          

HSP 2 Score: 107.457 bits (267), Expect = 3.231e-23
Identity = 48/126 (38.10%), Postives = 77/126 (61.11%), Query Frame = 2
Query:  509 PTQPPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILD 886
            P  P M  FK FL   DD ++  +++K+YNEYK  F  +Q++ FF +H ++EWFR KY P    +RK E    +Q R  ++ YL + NW +++ + ++    I +++DA VI +EGG  +DL IL+
Sbjct:  148 PPPPVMKTFKEFLISLDDSVDETESVKRYNEYKIDFRRQQMQDFFLAHKDEEWFRSKYHPDEAGRRKAEAHSALQNRLGVYMYLMDNNWFESVSLDIERAPQITKILDAAVIKMEGGAENDLRILE 273          
BLAST of serrate RNA effector molecule vs. Ensembl Zebrafish
Match: srrt (serrate RNA effector molecule homolog (Arabidopsis) [Source:NCBI gene;Acc:192311])

HSP 1 Score: 361.303 bits (926), Expect = 5.642e-110
Identity = 184/353 (52.12%), Postives = 252/353 (71.39%), Query Frame = 2
Query: 1094 PRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDT-TNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPE 2149
            PR LH+T S+F+R++ P + ++EI AL + Y GF+R+ L +P P+R+FFRR WVT+DR VNIKEICWNL NIRL DC++   VNR+L +R+R V  +  HK V+R+DIK+A++L+   D R  LW ++  ++T T  + + NP+L NIT+YL++E S EEE LLG     + E      +P+ I VE D+KL  VLDRL+ YLR VHS DYY+T EY  EDEMP+RCGI+H RG  I  ++ +T +EV ++ K+FE K   + +  E L+ DEA K+G K  ++ V+ F+  NTQE+ KDKWLCPLSGKKFKGP+FV+KHILNKH DK+E VK+   FFNN+L+D KRP +PE
Sbjct:  463 PRPLHRTCSLFMRSIAPTISKAEIVALCRRYPGFMRVCLSEPQPERRFFRRCWVTFDRGVNIKEICWNLQNIRLRDCELAPGVNRDLARRVRNVNGITQHKQVLRNDIKLAAKLIHALDDREKLWSQKPREETPTLELPAQNPILKNITDYLIEEVSAEEEELLGSAGGGDSEDGSKEGNPTEITVERDEKLVKVLDRLLFYLRIVHSIDYYNTCEYPSEDEMPNRCGIIHVRGP-IPPNR-ITLREVSDWQKTFEEKMGPLFSVKENLSEDEAAKMGRKDPEQEVEKFVVANTQELGKDKWLCPLSGKKFKGPEFVRKHILNKHGDKIEEVKKEVVFFNNFLMDAKRPCIPE 813          

HSP 2 Score: 107.071 bits (266), Expect = 3.849e-23
Identity = 48/126 (38.10%), Postives = 77/126 (61.11%), Query Frame = 2
Query:  509 PTQPPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILD 886
            P  P M  FK FL   DD ++  +++K+YNEYK  F  +Q++ FF +H ++EWFR KY P    +RK E    +Q R  ++ YL + NW +++ + ++    I +++DA VI +EGG  +DL IL+
Sbjct:  166 PPPPVMKTFKEFLISLDDSVDETESVKRYNEYKIDFRRQQMQDFFLAHKDEEWFRSKYHPDEAGRRKAEAHSALQNRLGVYMYLMDNNWFESVSLDIERAPQITKILDAAVIKMEGGAENDLRILE 291          
BLAST of serrate RNA effector molecule vs. Ensembl Xenopus
Match: SRRT (serrate, RNA effector molecule [Source:HGNC Symbol;Acc:HGNC:24101])

HSP 1 Score: 344.739 bits (883), Expect = 2.117e-104
Identity = 180/373 (48.26%), Postives = 251/373 (67.29%), Query Frame = 2
Query: 1094 PRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLD-PKRPQLPEHPSNRPGVKTTESGEIRNEG 2209
            PR LHKT SIF+RN+ PN+ ++EI AL K Y GF+R+AL +P P+R+F R+ +VT+DR+VNIKEICW++ NIRL +C++   VNR+LT R+R +  +  H+P++R+DIK+A+RL+   D+R  LW+ E G      +S+ NP+L NIT+YL+DE + EEE LL     +    T    +P+ I VE D+KL  VLD+L+ YLR VHS DYY+T EY  EDEMP RCG++H RG  +  ++ ++  EV E+ K+FE K   +    E L+ +EA K+G K  ++ V+ F+  NTQE+ K+KWLCPLSGKKFKGP+FV+KHI NKH +K+E VK+   F    L D  +RP LPE    RP V T   G+    G
Sbjct:  387 PRPLHKTCSIFMRNIPPNISKAEITALCKRYPGFMRVALSEPQPERRFLRKAYVTFDRSVNIKEICWSVQNIRLRECELSPGVNRDLTYRVRNINGITMHRPIVRNDIKLAARLIHALDERALLWEGEQGDQM---VSAQNPILKNITDYLIDEVNAEEEELLFSAGRTPETETPKEGNPTEISVERDEKLIKVLDKLLFYLRIVHSVDYYNTCEYPNEDEMPTRCGMMHVRGP-LPPNR-VSHGEVAEWQKTFEEKLSPLFAVRETLSEEEAVKMGKKDPEQEVEKFVTANTQELGKEKWLCPLSGKKFKGPEFVRKHIFNKHGEKIEEVKKEVAF--QTLPDRQQRPALPEVEPLRPPVGTAGQGKSLAAG 752          

HSP 2 Score: 105.531 bits (262), Expect = 1.396e-22
Identity = 48/123 (39.02%), Postives = 79/123 (64.23%), Query Frame = 2
Query:  518 PPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILD 886
            P M  FK FL   +D ++  +A+K+YN+YK  F  +Q++ FF +H ++EWFR KY P  V K K E +  ++ R   F YL E +W++ +++ + ++ +I++++DA VI +EGG   DL ILD
Sbjct:  147 PIMKTFKEFLLSLEDSVDETEAVKRYNDYKIDFRRQQMQEFFLAHKDEEWFRSKYHPDEVGKHKQESQAALRNRLSAFMYLMENSWLNEVQLDIAQSTAIIKVLDAAVIKMEGGTEIDLKILD 269          
BLAST of serrate RNA effector molecule vs. Ensembl Xenopus
Match: SRRT (serrate, RNA effector molecule [Source:HGNC Symbol;Acc:HGNC:24101])

HSP 1 Score: 343.199 bits (879), Expect = 1.204e-103
Identity = 178/364 (48.90%), Postives = 248/364 (68.13%), Query Frame = 2
Query: 1094 PRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLD-PKRPQLPEHPSNRPGVKTT 2182
            PR LHKT SIF+RN+ PN+ ++EI AL K Y GF+R+AL +P P+R+F R+ +VT+DR+VNIKEICW++ NIRL +C++   VNR+LT R+R +  +  H+P++R+DIK+A+RL+   D+R  LW+ E G      +S+ NP+L NIT+YL+DE + EEE LL     +    T    +P+ I VE D+KL  VLD+L+ YLR VHS DYY+T EY  EDEMP RCG++H RG  +  ++ ++  EV E+ K+FE K   +    E L+ +EA K+G K  ++ V+ F+  NTQE+ K+KWLCPLSGKKFKGP+FV+KHI NKH +K+E VK+   F    L D  +RP LPE    RP V T 
Sbjct:  408 PRPLHKTCSIFMRNIPPNISKAEITALCKRYPGFMRVALSEPQPERRFLRKAYVTFDRSVNIKEICWSVQNIRLRECELSPGVNRDLTYRVRNINGITMHRPIVRNDIKLAARLIHALDERALLWEGEQGDQM---VSAQNPILKNITDYLIDEVNAEEEELLFSAGRTPETETPKEGNPTEISVERDEKLIKVLDKLLFYLRIVHSVDYYNTCEYPNEDEMPTRCGMMHVRGP-LPPNR-VSHGEVAEWQKTFEEKLSPLFAVRETLSEEEAVKMGKKDPEQEVEKFVTANTQELGKEKWLCPLSGKKFKGPEFVRKHIFNKHGEKIEEVKKEVAF--QTLPDRQQRPALPEVEPLRPPVGTA 764          

HSP 2 Score: 105.531 bits (262), Expect = 1.575e-22
Identity = 48/123 (39.02%), Postives = 79/123 (64.23%), Query Frame = 2
Query:  518 PPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILD 886
            P M  FK FL   +D ++  +A+K+YN+YK  F  +Q++ FF +H ++EWFR KY P  V K K E +  ++ R   F YL E +W++ +++ + ++ +I++++DA VI +EGG   DL ILD
Sbjct:  147 PIMKTFKEFLLSLEDSVDETEAVKRYNDYKIDFRRQQMQEFFLAHKDEEWFRSKYHPDEVGKHKQESQAALRNRLSAFMYLMENSWLNEVQLDIAQSTAIIKVLDAAVIKMEGGTEIDLKILD 269          
BLAST of serrate RNA effector molecule vs. Ensembl Xenopus
Match: SRRT (serrate, RNA effector molecule [Source:HGNC Symbol;Acc:HGNC:24101])

HSP 1 Score: 342.813 bits (878), Expect = 1.314e-103
Identity = 178/364 (48.90%), Postives = 248/364 (68.13%), Query Frame = 2
Query: 1094 PRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLD-PKRPQLPEHPSNRPGVKTT 2182
            PR LHKT SIF+RN+ PN+ ++EI AL K Y GF+R+AL +P P+R+F R+ +VT+DR+VNIKEICW++ NIRL +C++   VNR+LT R+R +  +  H+P++R+DIK+A+RL+   D+R  LW+ E G      +S+ NP+L NIT+YL+DE + EEE LL     +    T    +P+ I VE D+KL  VLD+L+ YLR VHS DYY+T EY  EDEMP RCG++H RG  +  ++ ++  EV E+ K+FE K   +    E L+ +EA K+G K  ++ V+ F+  NTQE+ K+KWLCPLSGKKFKGP+FV+KHI NKH +K+E VK+   F    L D  +RP LPE    RP V T 
Sbjct:  403 PRPLHKTCSIFMRNIPPNISKAEITALCKRYPGFMRVALSEPQPERRFLRKAYVTFDRSVNIKEICWSVQNIRLRECELSPGVNRDLTYRVRNINGITMHRPIVRNDIKLAARLIHALDERALLWEGEQGDQM---VSAQNPILKNITDYLIDEVNAEEEELLFSAGRTPETETPKEGNPTEISVERDEKLIKVLDKLLFYLRIVHSVDYYNTCEYPNEDEMPTRCGMMHVRGP-LPPNR-VSHGEVAEWQKTFEEKLSPLFAVRETLSEEEAVKMGKKDPEQEVEKFVTANTQELGKEKWLCPLSGKKFKGPEFVRKHIFNKHGEKIEEVKKEVAF--QTLPDRQQRPALPEVEPLRPPVGTA 759          

HSP 2 Score: 105.531 bits (262), Expect = 1.691e-22
Identity = 48/123 (39.02%), Postives = 79/123 (64.23%), Query Frame = 2
Query:  518 PPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILD 886
            P M  FK FL   +D ++  +A+K+YN+YK  F  +Q++ FF +H ++EWFR KY P  V K K E +  ++ R   F YL E +W++ +++ + ++ +I++++DA VI +EGG   DL ILD
Sbjct:  147 PIMKTFKEFLLSLEDSVDETEAVKRYNDYKIDFRRQQMQEFFLAHKDEEWFRSKYHPDEVGKHKQESQAALRNRLSAFMYLMENSWLNEVQLDIAQSTAIIKVLDAAVIKMEGGTEIDLKILD 269          
BLAST of serrate RNA effector molecule vs. Ensembl Xenopus
Match: SRRT (serrate, RNA effector molecule [Source:HGNC Symbol;Acc:HGNC:24101])

HSP 1 Score: 341.658 bits (875), Expect = 2.104e-103
Identity = 178/364 (48.90%), Postives = 248/364 (68.13%), Query Frame = 2
Query: 1094 PRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLD-PKRPQLPEHPSNRPGVKTT 2182
            PR LHKT SIF+RN+ PN+ ++EI AL K Y GF+R+AL +P P+R+F R+ +VT+DR+VNIKEICW++ NIRL +C++   VNR+LT R+R +  +  H+P++R+DIK+A+RL+   D+R  LW+ E G      +S+ NP+L NIT+YL+DE + EEE LL     +    T    +P+ I VE D+KL  VLD+L+ YLR VHS DYY+T EY  EDEMP RCG++H RG  +  ++ ++  EV E+ K+FE K   +    E L+ +EA K+G K  ++ V+ F+  NTQE+ K+KWLCPLSGKKFKGP+FV+KHI NKH +K+E VK+   F    L D  +RP LPE    RP V T 
Sbjct:  372 PRPLHKTCSIFMRNIPPNISKAEITALCKRYPGFMRVALSEPQPERRFLRKAYVTFDRSVNIKEICWSVQNIRLRECELSPGVNRDLTYRVRNINGITMHRPIVRNDIKLAARLIHALDERALLWEGEQGDQM---VSAQNPILKNITDYLIDEVNAEEEELLFSAGRTPETETPKEGNPTEISVERDEKLIKVLDKLLFYLRIVHSVDYYNTCEYPNEDEMPTRCGMMHVRGP-LPPNR-VSHGEVAEWQKTFEEKLSPLFAVRETLSEEEAVKMGKKDPEQEVEKFVTANTQELGKEKWLCPLSGKKFKGPEFVRKHIFNKHGEKIEEVKKEVAF--QTLPDRQQRPALPEVEPLRPPVGTA 728          

HSP 2 Score: 105.145 bits (261), Expect = 1.907e-22
Identity = 48/123 (39.02%), Postives = 79/123 (64.23%), Query Frame = 2
Query:  518 PPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILD 886
            P M  FK FL   +D ++  +A+K+YN+YK  F  +Q++ FF +H ++EWFR KY P  V K K E +  ++ R   F YL E +W++ +++ + ++ +I++++DA VI +EGG   DL ILD
Sbjct:  147 PIMKTFKEFLLSLEDSVDETEAVKRYNDYKIDFRRQQMQEFFLAHKDEEWFRSKYHPDEVGKHKQESQAALRNRLSAFMYLMENSWLNEVQLDIAQSTAIIKVLDAAVIKMEGGTEIDLKILD 269          
BLAST of serrate RNA effector molecule vs. Ensembl Xenopus
Match: SRRT (serrate, RNA effector molecule [Source:HGNC Symbol;Acc:HGNC:24101])

HSP 1 Score: 339.732 bits (870), Expect = 4.502e-103
Identity = 178/365 (48.77%), Postives = 244/365 (66.85%), Query Frame = 2
Query: 1094 PRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPL-----TQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLD-PKRPQLPEHPSNRPG 2170
            PR LHKT SIF+RN+ PN+ ++EI AL K Y GF+R+AL +P P+R+F R+ +VT+DR+VNIKEICW++ NIRL +C++   VNR+LT R+R +  +  H+P++R+DIK+A+RL+   D+R  LW+ E G      +S+ NP+L NIT+YL+DE + EEE LL     +    T    +P+ I VE D+KL  VLD+L+ YLR VHS DYY+T EY  EDEMP RCG++H RG       PL     +  EV E+ K+FE K   +    E L+ +EA K+G K  ++ V+ F+  NTQE+ K+KWLCPLSGKKFKGP+FV+KHI NKH +K+E VK+   F    L D  +RP LPE     PG
Sbjct:  392 PRPLHKTCSIFMRNIPPNISKAEITALCKRYPGFMRVALSEPQPERRFLRKAYVTFDRSVNIKEICWSVQNIRLRECELSPGVNRDLTYRVRNINGITMHRPIVRNDIKLAARLIHALDERALLWEGEQGDQM---VSAQNPILKNITDYLIDEVNAEEEELLFSAGRTPETETPKEGNPTEISVERDEKLIKVLDKLLFYLRIVHSVDYYNTCEYPNEDEMPTRCGMMHVRG-------PLPPNRVSHGEVAEWQKTFEEKLSPLFAVRETLSEEEAVKMGKKDPEQEVEKFVTANTQELGKEKWLCPLSGKKFKGPEFVRKHIFNKHGEKIEEVKKEVAF--QTLPDRQQRPALPEVKPLYPG 744          

HSP 2 Score: 105.145 bits (261), Expect = 1.639e-22
Identity = 48/123 (39.02%), Postives = 79/123 (64.23%), Query Frame = 2
Query:  518 PPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILD 886
            P M  FK FL   +D ++  +A+K+YN+YK  F  +Q++ FF +H ++EWFR KY P  V K K E +  ++ R   F YL E +W++ +++ + ++ +I++++DA VI +EGG   DL ILD
Sbjct:  147 PIMKTFKEFLLSLEDSVDETEAVKRYNDYKIDFRRQQMQEFFLAHKDEEWFRSKYHPDEVGKHKQESQAALRNRLSAFMYLMENSWLNEVQLDIAQSTAIIKVLDAAVIKMEGGTEIDLKILD 269          
BLAST of serrate RNA effector molecule vs. Ensembl Mouse
Match: Srrt (serrate RNA effector molecule homolog (Arabidopsis) [Source:MGI Symbol;Acc:MGI:1933527])

HSP 1 Score: 365.925 bits (938), Expect = 3.827e-112
Identity = 190/362 (52.49%), Postives = 255/362 (70.44%), Query Frame = 2
Query: 1091 EPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGK-DTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPE-HPSNRPG 2170
            +PR LHKT S+F+RN+ PN+ R+EI +L K Y GF+R+AL +P P+R+FFRRGWVT+DR+VNIKEICWNL NIRL +C++   VNR+LT+R+R +  +  HK ++R+DIK+A++L+   D R  LW  E G       + S NP+L NIT+YL++E S EEE LLG +     E      +P+ I VE D+KL  VLD+L+LYLR VHS DYY+T EY  EDEMP+RCGI+H RG        ++  EV E+ K+FE K   +L+  E L+ +EA+K+G K  ++ V+ F+  NTQE+ KDKWLCPLSGKKFKGP+FV+KHI NKH +K+E VK+   FFNN+L D KRP LPE  P+  PG
Sbjct:  412 KPRPLHKTCSLFMRNIAPNISRAEIISLCKRYPGFMRVALSEPQPERRFFRRGWVTFDRSVNIKEICWNLQNIRLRECELSPGVNRDLTRRVRNINGITQHKQIVRNDIKLAAKLIHTLDDRTQLWASEPGTPPVPTSLPSQNPILKNITDYLIEEVSAEEEELLGSSGGPPPEEPPKEGNPAEINVERDEKLIKVLDKLLLYLRIVHSLDYYNTCEYPNEDEMPNRCGIIHVRGP--MPPNRISHGEVLEWQKTFEEKLTPLLSVRESLSEEEAQKMGRKDPEQEVEKFVTSNTQELGKDKWLCPLSGKKFKGPEFVRKHIFNKHAEKIEEVKKEVAFFNNFLTDAKRPALPEIKPAQPPG 771          

HSP 2 Score: 112.464 bits (280), Expect = 7.633e-25
Identity = 53/122 (43.44%), Postives = 79/122 (64.75%), Query Frame = 2
Query:  518 PPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTIL 883
            P M  FK FL   DD ++  +A+K+YN+YK  F  +Q++ FF +H ++EWFR KY P  V KR+ E    +Q R ++F  L E  W DN+ + +D+ D+IV+++DA VI +EGG  +DL IL
Sbjct:  147 PIMKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDEVGKRRQEARGALQNRLKVFLSLMESGWFDNLLLDIDKADAIVKMLDAAVIKMEGGTENDLRIL 268          
BLAST of serrate RNA effector molecule vs. Ensembl Mouse
Match: Srrt (serrate RNA effector molecule homolog (Arabidopsis) [Source:MGI Symbol;Acc:MGI:1933527])

HSP 1 Score: 365.925 bits (938), Expect = 4.333e-112
Identity = 190/362 (52.49%), Postives = 255/362 (70.44%), Query Frame = 2
Query: 1091 EPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGK-DTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPE-HPSNRPG 2170
            +PR LHKT S+F+RN+ PN+ R+EI +L K Y GF+R+AL +P P+R+FFRRGWVT+DR+VNIKEICWNL NIRL +C++   VNR+LT+R+R +  +  HK ++R+DIK+A++L+   D R  LW  E G       + S NP+L NIT+YL++E S EEE LLG +     E      +P+ I VE D+KL  VLD+L+LYLR VHS DYY+T EY  EDEMP+RCGI+H RG        ++  EV E+ K+FE K   +L+  E L+ +EA+K+G K  ++ V+ F+  NTQE+ KDKWLCPLSGKKFKGP+FV+KHI NKH +K+E VK+   FFNN+L D KRP LPE  P+  PG
Sbjct:  412 KPRPLHKTCSLFMRNIAPNISRAEIISLCKRYPGFMRVALSEPQPERRFFRRGWVTFDRSVNIKEICWNLQNIRLRECELSPGVNRDLTRRVRNINGITQHKQIVRNDIKLAAKLIHTLDDRTQLWASEPGTPPVPTSLPSQNPILKNITDYLIEEVSAEEEELLGSSGGPPPEEPPKEGNPAEINVERDEKLIKVLDKLLLYLRIVHSLDYYNTCEYPNEDEMPNRCGIIHVRGP--MPPNRISHGEVLEWQKTFEEKLTPLLSVRESLSEEEAQKMGRKDPEQEVEKFVTSNTQELGKDKWLCPLSGKKFKGPEFVRKHIFNKHAEKIEEVKKEVAFFNNFLTDAKRPALPEIKPAQPPG 771          

HSP 2 Score: 112.849 bits (281), Expect = 7.050e-25
Identity = 53/122 (43.44%), Postives = 79/122 (64.75%), Query Frame = 2
Query:  518 PPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTIL 883
            P M  FK FL   DD ++  +A+K+YN+YK  F  +Q++ FF +H ++EWFR KY P  V KR+ E    +Q R ++F  L E  W DN+ + +D+ D+IV+++DA VI +EGG  +DL IL
Sbjct:  147 PIMKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDEVGKRRQEARGALQNRLKVFLSLMESGWFDNLLLDIDKADAIVKMLDAAVIKMEGGTENDLRIL 268          
BLAST of serrate RNA effector molecule vs. Ensembl Mouse
Match: Srrt (serrate RNA effector molecule homolog (Arabidopsis) [Source:MGI Symbol;Acc:MGI:1933527])

HSP 1 Score: 365.925 bits (938), Expect = 4.460e-112
Identity = 190/362 (52.49%), Postives = 255/362 (70.44%), Query Frame = 2
Query: 1091 EPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGK-DTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPE-HPSNRPG 2170
            +PR LHKT S+F+RN+ PN+ R+EI +L K Y GF+R+AL +P P+R+FFRRGWVT+DR+VNIKEICWNL NIRL +C++   VNR+LT+R+R +  +  HK ++R+DIK+A++L+   D R  LW  E G       + S NP+L NIT+YL++E S EEE LLG +     E      +P+ I VE D+KL  VLD+L+LYLR VHS DYY+T EY  EDEMP+RCGI+H RG        ++  EV E+ K+FE K   +L+  E L+ +EA+K+G K  ++ V+ F+  NTQE+ KDKWLCPLSGKKFKGP+FV+KHI NKH +K+E VK+   FFNN+L D KRP LPE  P+  PG
Sbjct:  412 KPRPLHKTCSLFMRNIAPNISRAEIISLCKRYPGFMRVALSEPQPERRFFRRGWVTFDRSVNIKEICWNLQNIRLRECELSPGVNRDLTRRVRNINGITQHKQIVRNDIKLAAKLIHTLDDRTQLWASEPGTPPVPTSLPSQNPILKNITDYLIEEVSAEEEELLGSSGGPPPEEPPKEGNPAEINVERDEKLIKVLDKLLLYLRIVHSLDYYNTCEYPNEDEMPNRCGIIHVRGP--MPPNRISHGEVLEWQKTFEEKLTPLLSVRESLSEEEAQKMGRKDPEQEVEKFVTSNTQELGKDKWLCPLSGKKFKGPEFVRKHIFNKHAEKIEEVKKEVAFFNNFLTDAKRPALPEIKPAQPPG 771          

HSP 2 Score: 112.464 bits (280), Expect = 7.352e-25
Identity = 53/122 (43.44%), Postives = 79/122 (64.75%), Query Frame = 2
Query:  518 PPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTIL 883
            P M  FK FL   DD ++  +A+K+YN+YK  F  +Q++ FF +H ++EWFR KY P  V KR+ E    +Q R ++F  L E  W DN+ + +D+ D+IV+++DA VI +EGG  +DL IL
Sbjct:  147 PIMKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDEVGKRRQEARGALQNRLKVFLSLMESGWFDNLLLDIDKADAIVKMLDAAVIKMEGGTENDLRIL 268          
BLAST of serrate RNA effector molecule vs. Ensembl Mouse
Match: Srrt (serrate RNA effector molecule homolog (Arabidopsis) [Source:MGI Symbol;Acc:MGI:1933527])

HSP 1 Score: 332.413 bits (851), Expect = 1.944e-103
Identity = 183/364 (50.27%), Postives = 247/364 (67.86%), Query Frame = 2
Query: 1091 EPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDR--KFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDG-KDTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPE-HPSNRPG 2170
            +PR LHKT S+F+RN+ PN+ R+EI ++    SG + L  +     R  +FFRRGWVT+DR+VNIKEICWNL NIRL +C++   VNR+LT+R+R +  +  HK ++R+DIK+A++L+   D R  LW  E G       + S NP+L NIT+YL++E S EEE LLG +     E      +P+ I VE D+KL  VLD+L+LYLR VHS DYY+T EY  EDEMP+RCGI+H RG        ++  EV E+ K+FE K   +L+  E L+ +EA+K+G K  ++ V+ F+  NTQE+ KDKWLCPLSGKKFKGP+FV+KHI NKH +K+E VK+   FFNN+L D KRP LPE  P+  PG
Sbjct:   56 KPRPLHKTCSLFMRNIAPNISRAEIISV----SGDIGLRGRVGVNPRSFRFFRRGWVTFDRSVNIKEICWNLQNIRLRECELSPGVNRDLTRRVRNINGITQHKQIVRNDIKLAAKLIHTLDDRTQLWASEPGTPPVPTSLPSQNPILKNITDYLIEEVSAEEEELLGSSGGPPPEEPPKEGNPAEINVERDEKLIKVLDKLLLYLRIVHSLDYYNTCEYPNEDEMPNRCGIIHVRGPM--PPNRISHGEVLEWQKTFEEKLTPLLSVRESLSEEEAQKMGRKDPEQEVEKFVTSNTQELGKDKWLCPLSGKKFKGPEFVRKHIFNKHAEKIEEVKKEVAFFNNFLTDAKRPALPEIKPAQPPG 413          
BLAST of serrate RNA effector molecule vs. Ensembl Mouse
Match: Srrt (serrate RNA effector molecule homolog (Arabidopsis) [Source:MGI Symbol;Acc:MGI:1933527])

HSP 1 Score: 199.134 bits (505), Expect = 2.686e-57
Identity = 99/180 (55.00%), Postives = 131/180 (72.78%), Query Frame = 2
Query: 1634 SNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPE-HPSNRPG 2170
            + I VE D+KL  VLD+L+LYLR VHS DYY+T EY  EDEMP+RCGI+H RG  +  ++ ++  EV E+ K+FE K   +L+  E L+ +EA+K+G K  ++ V+ F+  NTQE+ KDKWLCPLSGKKFKGP+FV+KHI NKH +K+E VK+   FFNN+L D KRP LPE  P+  PG
Sbjct:   17 AEINVERDEKLIKVLDKLLLYLRIVHSLDYYNTCEYPNEDEMPNRCGIIHVRGP-MPPNR-ISHGEVLEWQKTFEEKLTPLLSVRESLSEEEAQKMGRKDPEQEVEKFVTSNTQELGKDKWLCPLSGKKFKGPEFVRKHIFNKHAEKIEEVKKEVAFFNNFLTDAKRPALPEIKPAQPPG 194          
BLAST of serrate RNA effector molecule vs. UniProt/SwissProt
Match: sp|B4NYV0|SRRT_DROYA (Serrate RNA effector molecule homolog OS=Drosophila yakuba OX=7245 GN=Ars2 PE=3 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 4.186e-116
Identity = 189/377 (50.13%), Postives = 256/377 (67.90%), Query Frame = 2
Query: 1091 EPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQR---------------EDGKDTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARG-AHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPEHP--SNRP 2167
            +PRALH+T SIFLRNL P++ R+EIEA+   ++G+LR+A+ DP  +R+++RRGW+T+ R VNIKEICW LNN RL DC++GAIVNR+L++R+RP   L  HK V+R DIK+ +++    D+R  LW                 E+G  +T   +S NP+L NIT+YL++E S           +  L LT    D     +E D++L +VLDRL+LYLR VHS DYY+  EY  EDEMP+RCGI+HARG A + V    T  +V+EYIK++E K +  L    LL+ +E K LG K  +  V+ F+  NTQE++KDKWLCPLSGKKFKGP+F++KHI NKH +KV+ V++  ++FNNYL DPKRPQLPEHP  S RP
Sbjct:  508 QPRALHRTSSIFLRNLAPSITRAEIEAVCNRFTGYLRVAIADPLVERRWYRRGWITFMRDVNIKEICWGLNNQRLRDCEMGAIVNRDLSRRVRPANGLTAHKQVVRSDIKLCAKIALNLDERFRLWAEVPTDDSNSARADESSENGSGSTYGFNSKNPVLQNITDYLIEEAS--------AEEDELLGLTGENKDTEGEAIERDEQLISVLDRLVLYLRIVHSVDYYNHCEYPYEDEMPNRCGIIHARGPAPVRV----TNNDVQEYIKTYESKLQQFLTKTVLLSDEEIKDLGAKDAETEVEKFVQANTQELAKDKWLCPLSGKKFKGPEFIRKHIFNKHDEKVDEVRKEVQYFNNYLRDPKRPQLPEHPGTSKRP 872          

HSP 2 Score: 110.153 bits (274), Expect = 3.438e-23
Identity = 61/172 (35.47%), Postives = 91/172 (52.91%), Query Frame = 2
Query:  512 TQPPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILDSKRYRSESPNDSHILEDVVVKSPEKVTSSEGIEVVNKEIIEPDDKKF 1027
            TQP ML  K FL  QD++I   + M+KY EYK  F  +QL  FF +H ++EWF+ KY P+   KR  E    +Q R ++F  L E   + ++K+   + D+++R++D  VI LEGG   DL +LD      E P D  + E        K    E ++ + K I  P ++K 
Sbjct:  152 TQPAMLNLKQFLDTQDENISDSEVMRKYTEYKTDFKRQQLNEFFVAHKDEEWFKNKYHPEDSVKRSEEQRGFLQRRTDVFVELLENGTIGSVKVDSSQGDALIRVLDTCVIKLEGGTDEDLKVLD------EKPKDLVVYE-------RKTEPMESVKAMEKAISSPKEEKI 310          
BLAST of serrate RNA effector molecule vs. UniProt/SwissProt
Match: sp|Q17FR9|SRRT_AEDAE (Serrate RNA effector molecule homolog OS=Aedes aegypti OX=7159 GN=Ars2 PE=3 SV=1)

HSP 1 Score: 379.022 bits (972), Expect = 1.357e-115
Identity = 189/362 (52.21%), Postives = 250/362 (69.06%), Query Frame = 2
Query: 1094 PRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDTTN----PMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIK--VEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPEHPSN 2161
            PRALH+T SIFLRNL P++ ++E+EA+ K Y+GFLR+A+ DP  +R++FRRGWVT+ R VNIKEICWNLNNIRL DC++GAIVN++L++R+RPV  L  HK ++R DIK+ +++    D +  LW+ ++     N     + S NP+L NIT+YL++E S           +  L L+   +  SN    VE D +L  VLD+LILYLR VHS D+Y+  EY  EDEMP+RCGI+HARG        +T  E++EYI++FE K    L     L  +E KKLG K  +  V+ FI  NTQE++KDKWLCPLSGKKFKGPDFV+KHI NKH +KV+ V++  E+FNNYL D KRPQLPEHP N
Sbjct:  508 PRALHRTSSIFLRNLAPSITKAEVEAMCKRYNGFLRVAIADPLLERRWFRRGWVTFRRDVNIKEICWNLNNIRLRDCELGAIVNKDLSRRVRPVNGLTCHKTIVRSDIKLCAKIAHNLDDKVGLWKEQEDNGEKNGESFGLQSKNPVLQNITDYLIEEAS--------AEEDELLGLSTEAAKKSNDGELVERDTQLIEVLDKLILYLRVVHSIDFYNHCEYPYEDEMPNRCGIIHARGPPPQ--NKVTSNEIQEYIRTFEGKMGSFLARAVDLEEEEMKKLGAKDAEAEVEKFIQANTQELAKDKWLCPLSGKKFKGPDFVRKHIFNKHNEKVDEVRKEVEYFNNYLKDTKRPQLPEHPGN 859          

HSP 2 Score: 103.605 bits (257), Expect = 3.528e-21
Identity = 52/127 (40.94%), Postives = 75/127 (59.06%), Query Frame = 2
Query:  512 TQPPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILDSK 892
            TQP M+  K FL  QDD I   +A++KYN+YK  F  +QL  FF +H ++EWF+ KY P+   KRK E    ++ R ++F  L +   +  + +     D ++RL+D VVI LEGG   DL +LD K
Sbjct:  133 TQPCMMTLKQFLATQDDSISDSEAIQKYNDYKLEFKRQQLNEFFVAHKDEEWFKMKYHPEESLKRKEEQFGFLKRRCDVFVELLDHGDISKVSVDTSNTDPLLRLLDTVVIKLEGGTDEDLKVLDEK 259          
BLAST of serrate RNA effector molecule vs. UniProt/SwissProt
Match: sp|Q28WQ8|SRRT_DROPS (Serrate RNA effector molecule homolog OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=Ars2 PE=3 SV=2)

HSP 1 Score: 373.244 bits (957), Expect = 2.656e-113
Identity = 186/392 (47.45%), Postives = 255/392 (65.05%), Query Frame = 2
Query: 1094 PRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQR----------------EDGKDTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGS--DPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPEHPSNRPGVKTTESGEIRNEGQF 2215
            PRA+H+T SIFLRNL P++ ++EIEAL   +SG+LR A+ DP  +R+++RRGW+T+ R VNIKEICW+LNN RL DC++GAIVNR+L++R+RP   +  HK V+R DIK+ +R+V   D++  LW                   +G  ++   +S NP+L NIT+YL+             +      L ++G   D     +E D++L +VLDRL+LYLR VHS DYY+  EY  EDEMP+RCGI+HARG        +T  E+ EYIKS+E K    L    LL+ D+ K LG K  D  V+ F+  NTQE++KDKWLCPLSGKKFKGP+F++KHI NKH +KV+ V++  ++FNNYL DPKRPQLPEHP +   VK  E+  +R  G +
Sbjct:  516 PRAMHRTSSIFLRNLAPSITKAEIEALCSRFSGYLRTAIADPLVERRWYRRGWITFTRDVNIKEICWSLNNQRLRDCEMGAIVNRDLSRRVRPANGITAHKQVVRSDIKLCARIVMNLDEKFKLWSEGPLSKPSPASDSEATAANGSGSSYGFNSKNPVLQNITDYLI----------EEASAEEEELLGLSGDRKDGEGEPIERDEQLLSVLDRLVLYLRIVHSVDYYNHCEYPYEDEMPNRCGIIHARGP---APSRVTSNELNEYIKSYEGKLLQFLTKTALLSEDQIKDLGAKNADTEVEKFVQANTQELAKDKWLCPLSGKKFKGPEFIRKHIFNKHEEKVDEVRKEVQYFNNYLRDPKRPQLPEHPGS---VKRPETESVRGPGGY 891          

HSP 2 Score: 104.76 bits (260), Expect = 1.502e-21
Identity = 50/127 (39.37%), Postives = 74/127 (58.27%), Query Frame = 2
Query:  512 TQPPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILDSK 892
            TQP ML  K FL  QD++I   + M+KY EYK  F  +QL  FF +H ++EWF+ KY P+    R  E    ++ R ++F  L E   + ++K+     D+++R++D  VI LEGG   DL +LD K
Sbjct:  150 TQPAMLNLKQFLDTQDENISDSEVMRKYTEYKTDFKRQQLNEFFVAHKDEEWFKNKYHPEDSVNRSEEQRGFLRRRTDVFVELLENGTIGSVKVDSSHGDALIRVLDTCVIKLEGGTDEDLKVLDEK 276          
BLAST of serrate RNA effector molecule vs. UniProt/SwissProt
Match: sp|B3N3F7|SRRT_DROER (Serrate RNA effector molecule homolog OS=Drosophila erecta OX=7220 GN=Ars2 PE=3 SV=1)

HSP 1 Score: 372.474 bits (955), Expect = 5.304e-113
Identity = 208/468 (44.44%), Postives = 285/468 (60.90%), Query Frame = 2
Query:  848 LEGGNAHDLTILDSKRYRSESPNDSHILEDVVVKSPE-KVTSSEGIEVVNKEIIEPDDKKFXXXXXXXXXXXXKFEKKSELQEPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQR---------------EDGKDTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARG-AHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPEHPSNRPGVKTTESGEIR 2200
            LEG    +   LDSK   +E+        D  +KSPE   T  +G +  +   +E D+KK   +       E     K +  +PRALH+T SIFLRNL P++ R+EIE +   ++G+LR+A+ DP  +R+++RRGW+T+ R VNIKEICW LNN RL DC++GAIVNR+L++R+RP   +  HK V+R DIK+ +++    D+R  LW                 E+G  +T   +S NP+L NIT+YL+                  L LT    D     +E D++L +VLDRL+LYLR VHS DYY+  EY  EDEMP+RCGI+HARG A + V    T  +V+EYIK++E K +  L    LL+ +E K LG K  +  V+ F+  NTQE++KDKWLCPLSGKKFKGP+F++KHI NKH +KV+ V++  ++FNNYL DPKRPQLPEHP      K TES   R
Sbjct:  437 LEGKEIVEPKELDSKSNTAEN--------DDTLKSPEISPTPIKGTDNGDDNKVEEDEKKPSVDEIKVVETETIDLDKVKNGQPRALHRTSSIFLRNLAPSITRAEIETVCNRFTGYLRVAIADPLVERRWYRRGWITFMRDVNIKEICWGLNNHRLRDCEMGAIVNRDLSRRVRPANGITAHKQVVRSDIKLCAKIALNLDERFRLWAEVPTDDSHPSRADESTENGSGSTYGFNSKNPVLQNITDYLI--------EEASAEEEELLGLTGENKDTDGEPIERDEQLISVLDRLVLYLRIVHSVDYYNHCEYPYEDEMPNRCGIIHARGPAPVRV----TNNDVQEYIKTYESKLQQFLTKTVLLSDEEIKDLGAKDPETEVEKFVQANTQELAKDKWLCPLSGKKFKGPEFIRKHIFNKHEEKVDEVRKEVQYFNNYLRDPKRPQLPEHPGT---SKRTESESAR 881          

HSP 2 Score: 110.538 bits (275), Expect = 2.509e-23
Identity = 60/162 (37.04%), Postives = 89/162 (54.94%), Query Frame = 2
Query:  512 TQPPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILDSKRY------RSESPNDSHILEDVVVKSPEKVTSSEG 979
            TQP ML  K FL  QD++I   + M+KY EYK  F  +QL  FF +H ++EWF+ KY P+   KR  E    +Q R ++F  L E   + ++K+   + D+++R++D  VI LEGG   DL +LD K        R   P +S    +  + SP++   SEG
Sbjct:  151 TQPAMLNLKQFLDTQDENISDSEVMRKYTEYKTDFKRQQLNEFFVAHKDEEWFKNKYHPEDSVKRSDEQRGFLQRRTDVFVELLENGTIGSVKVDSSQGDALIRVLDTCVIKLEGGTDEDLKVLDEKPKDPVVCERKAEPIESAKAVEKTINSPKEEKISEG 312          
BLAST of serrate RNA effector molecule vs. UniProt/SwissProt
Match: sp|B4LIK8|SRRT_DROVI (Serrate RNA effector molecule homolog OS=Drosophila virilis OX=7244 GN=Ars2 PE=3 SV=1)

HSP 1 Score: 372.089 bits (954), Expect = 9.132e-113
Identity = 198/477 (41.51%), Postives = 279/477 (58.49%), Query Frame = 2
Query:  851 EGGNA-HDLTILDSKRYRSESPNDSHILEDVVVKSPEKVTSSEGIEVVNKEIIEPDDKKFXXXXXXXXXXXXKFEKKSELQEPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQRED---------------------GKDTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPEHPSNRPGVKTTESGEIRNEGQF 2215
            EGG A  D   + S++   +   D+    ++    P    + E  E   K  +E       +            +K  +  +PRALH+T SIFLRNL P++ ++EIEA+   +SG+LR+A+ DP  +R+++RRGW+T+ R VNIKEICW+LNN RL DC++GAIVNR+L++R+RP   +  HK ++R DIK+ +++    D+R  LW   D                     G  TT   +S NP+L NIT+YL+                  L L     D     +E D++L +VLDRL+LYLR VHS DYY+  EY  EDEMP+RCGI+HARG        +T  +V+EYIK+++ K +  L     L+ DE K+LG K  +  V+ F+  NTQE++KDKWLCPLSGKKFKGP+F++KHI NKH +KV+ V++  ++FNNYL DPKRPQLPEHP +    K TES   R  G +
Sbjct:  446 EGGTALQDAAAIKSEQSDEQQEKDAEQPAELQADEPAAAKNGEEPEKTEKNEVE------TKSTADDVTETIDLDKVKDGPQPRALHRTSSIFLRNLAPSITKAEIEAICTRFSGYLRVAIADPLVERRWYRRGWITFTRDVNIKEICWSLNNQRLRDCEMGAIVNRDLSRRVRPANGITAHKQIVRADIKLCAKIAMNLDERFKLWSEADSTQQQPDAESKPSADATNGSGGSSTTYGFNSKNPVLQNITDYLI--------EEASAEEEELLGLAGDNKDGEGEPIERDEQLISVLDRLVLYLRIVHSVDYYNHCEYPYEDEMPNRCGIIHARGPPPMR---VTSNDVQEYIKAYDGKLQQFLTKSVQLSDDEIKELGAKNPETEVEKFVQANTQELAKDKWLCPLSGKKFKGPEFIRKHIFNKHEEKVDEVRKEVQYFNNYLRDPKRPQLPEHPGS---SKRTESESGRGSGGY 902          

HSP 2 Score: 110.538 bits (275), Expect = 2.708e-23
Identity = 62/180 (34.44%), Postives = 97/180 (53.89%), Query Frame = 2
Query:  512 TQPPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILDSK--------RYRSESPNDSHILEDVVVKSPEKVTSSEGIEVVNKEIIEPDDKKF 1027
            TQP ML  K FL  QD++I   + M+KY EYK  F  +QL  FF +H ++EWF+ KY P+   +R  E    ++ R ++F  L E   + ++K+   + DS+VR++D  VI LEGG   DL ILD K          +SES  ++ ++     +SP++  S +G +     ++ P  K  
Sbjct:  154 TQPAMLTLKQFLDTQDENISDSEVMRKYTEYKTDFKRQQLNEFFVAHKDEEWFKNKYHPEDSVRRSEEQRGFLKRRTDVFLELLENGTIGSVKVDSSQADSLVRVLDTCVIKLEGGTDEDLKILDEKPKETPVVYERKSES-TEASVVAKREPESPKQTKSEKGADEEQPVVVSPQRKSL 332          
BLAST of serrate RNA effector molecule vs. TrEMBL
Match: A0A0F7GYG7 (Serrate RNA effector molecule (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 839.336 bits (2167), Expect = 0.000e+0
Identity = 517/522 (99.04%), Postives = 519/522 (99.43%), Query Frame = 2
Query:  980 IEVVNKEIIEPDDKKFXXXXXXXXXXXXKFEKKSELQEPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPEHPSNRPGVKTTESGEIRNEGQFDNNNKRFGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSSPNGGGYRDSXXXXXXXXXXXXXXXXXYYRKSSYPXXXXXXXXXXXXXXYYARKVLSYNDLDAPMDD 2545
            IE+VNKEIIE DDKKFEEEIESTENVEEKFEKKSE QEPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDTTNPMSSNNPLLANITEYLVDEGSYEEEALLGGNLNSNLELTVTGSDP NIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPEHPSNRPGVKTTESGEIRNEGQFDNNNKRFGDNDSRNRNMDNNRNFSRRNDDFDNRRPNYRNDRGSSPNGGGYRDSGNRNNNFGDNRGG+NGNYYRKSSYPSRGSQSRQRNGGGSYYARKVLSYNDLDAPMDD
Sbjct:    2 IEIVNKEIIEADDKKFEEEIESTENVEEKFEKKSEXQEPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDTTNPMSSNNPLLANITEYLVDEGSYEEEALLGGNLNSNLELTVTGSDPLNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPEHPSNRPGVKTTESGEIRNEGQFDNNNKRFGDNDSRNRNMDNNRNFSRRNDDFDNRRPNYRNDRGSSPNGGGYRDSGNRNNNFGDNRGGSNGNYYRKSSYPSRGSQSRQRNGGGSYYARKVLSYNDLDAPMDD 523          
BLAST of serrate RNA effector molecule vs. TrEMBL
Match: A0A3B3B9F3 (Serrate RNA effector molecule homolog (Arabidopsis) OS=Oryzias melastigma OX=30732 PE=4 SV=1)

HSP 1 Score: 459.529 bits (1181), Expect = 3.919e-145
Identity = 257/570 (45.09%), Postives = 365/570 (64.04%), Query Frame = 2
Query:  509 PTQPPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILDSKRYRSESPNDSHIL---------EDVVVKSPEKVTSSEG-----------IEVVNKEIIEPDDKKFXXXXXXXXXXXXKFEKKSELQEPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQ---REDGKDTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPE 2149
            P  P M  FK FL   DD ++  +A+K+YNEYK  F  +Q++ FF +H ++EWFR KY P    + K E    +  R  +FT+L E  W DN+ + ++++ +I+R++DA VI +EGG  HDL ILD      E+ + S            EDV V S E   S E             +++N  +++  +   +E  E  +  E+K +  S    PR LH+T S+F+R++ P + ++EI AL + Y GFLR+ L DP P+R+FFRR WVT+DR+VNIKE+CWNL NIRL DC++   VNR+L +R+R V  +  HK V+R+DIK+A++L+   D++ +LW    +E+G  +  P S  NP+L NIT+YL++E S EEE LLG     + E      +P+ + VE DDKLA VLDRL+LYLR VHS DYY+T EY  EDEMP+RCG++H RG  I  ++ +T  EV++++K  E K   + +  E+L+ +EA K+G K  +E V+ FI+ NTQE+ KDKWLCPLSGKKFKGP+FV+KHILNKH DK+E VK+   FFNN+L+D KRP LPE
Sbjct:  142 PPPPIMKSFKEFLLSLDDSVDETEAVKRYNEYKVDFRRQQMQDFFLAHKDEEWFRSKYHPDEASRLKAEARSAVHNRLNVFTFLMENGWFDNVSLDIEQSPAIIRVLDAAVIKMEGGTDHDLRILDMPTEEEENKDKSASASAGDQLSKREDVKVLSGEGKPSGEKDKSEKVRVYYLSKLINFLLLKSVNASPKENSEEDKKEEKKPKDDSP--RPRPLHRTCSLFMRSIAPTISKAEIIALCRRYPGFLRVCLSDPHPERRFFRRCWVTFDRSVNIKEVCWNLQNIRLRDCELAPGVNRDLARRVRNVNGITQHKQVLRNDIKLAAKLIHSLDEKGDLWSSKAQEEGPGSELPAS--NPILKNITDYLIEEVSAEEEELLGSGSGMDTEDGNKEGNPTEMTVERDDKLAKVLDRLLLYLRIVHSVDYYNTCEYPSEDEMPNRCGMIHVRGP-IPPNR-ITHGEVQQWLKMMEEKLTPLFSLKEILSEEEAGKMGRKNPEEEVEKFISANTQELGKDKWLCPLSGKKFKGPEFVRKHILNKHGDKIEEVKKEVAFFNNFLMDAKRPSLPE 705          
BLAST of serrate RNA effector molecule vs. TrEMBL
Match: A0A3Q2DCY0 (Serrate RNA effector molecule homolog (Arabidopsis) OS=Cyprinodon variegatus OX=28743 PE=4 SV=1)

HSP 1 Score: 455.677 bits (1171), Expect = 3.607e-143
Identity = 259/599 (43.24%), Postives = 366/599 (61.10%), Query Frame = 2
Query:  509 PTQPPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILD----------------SKRYRSESPNDSHILEDVVVKSPEKVTSSEGIEVVNKEIIEPDDKKFXXXXXXXXXXXXKFEKKS---ELQEPR------------------------------ALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQ---REDGKDTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPE 2149
            P  P M  FK FL   DD ++  +A+K+YNEYK  F  +Q++ FF +H ++EWFR KY P    + K E + ++  R  +F +L E  W DN+ + +D+  +I++++DA VI +EGG  HDL ILD                     S+   D   ++     S EK  + +  EV   + +E  D    E      +V+E+ EK++   E  EP+                               LHKTFS+F+R++ P + ++EI AL + Y GFLR+ L DP P+R+FFRR WVT+DR+VNIKEICWNL NIRL DC++   VNR+L +R+R V  +  HK V+R+DIK+A++L+   D++ +LW    +EDG+ T  P  + NP+L NIT+YL++E S EEE LLG     + E +    +P+ + VE DDKLA VLDRL+LYLR VHS DYY+T EY  EDEMP+RCG++H RG  +  ++ +T  EV+++ K  E K   + N  E+L+ +EA K+G K  DE V+ FI+ NTQE+ KDKWLCPLSGKKFKGP+FV+KHILNKH +K+E VK+   FFNN+L+D KRP LPE
Sbjct:  143 PPPPIMKSFKEFLLSLDDTVDETEAVKRYNEYKIDFRRQQMQDFFLAHKDEEWFRSKYHPDEASRLKAEAQSSLCNRLNVFMFLMENGWFDNVSLDIDQTPAIIKVLDAAVIKMEGGTDHDLRILDMPPEEEEEREKSASASGGGGESQRREDQKAVDRQRKPSGEKDKTEKVCEVFCWQTMEEGDSGGAEAKADGLDVKEEAEKEAVREEKPEPKKVIFSSKPKQNDEEEKKEEKKPKDDSPRPRPLHKTFSLFMRSIAPTISKAEIVALCRRYPGFLRVCLSDPHPERRFFRRCWVTFDRSVNIKEICWNLQNIRLRDCELAPGVNRDLARRVRNVNGITQHKQVLRNDIKLAAKLIHALDEKGDLWSNKAQEDGQSTELP--AQNPILKNITDYLIEEVSAEEEELLGSGSGMDPEESAKEGNPAELTVERDDKLAKVLDRLLLYLRIVHSVDYYNTCEYPSEDEMPNRCGMIHVRGP-VPPNR-VTHGEVQQWEKVIEEKLMPLFNLKEVLSEEEAVKMGRKDPDEEVEKFISANTQELGKDKWLCPLSGKKFKGPEFVRKHILNKHGEKIEEVKKEVLFFNNFLMDAKRPSLPE 737          
BLAST of serrate RNA effector molecule vs. TrEMBL
Match: J9K6M8 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=1)

HSP 1 Score: 449.899 bits (1156), Expect = 6.048e-142
Identity = 247/566 (43.64%), Postives = 352/566 (62.19%), Query Frame = 2
Query:  512 TQPPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILDSKRYRSESPNDSHILEDVVVKSPEKVTSSEGIEVVNKEIIEPDDKK------FXXXXXXXXXXXXKFEKKSELQEPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGK----DTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKA-ELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPEHPSNRPGVK 2176
            TQPPM+  K FL  QDD+I  ++A+ KYNEYK  F   QL  FF +H ++EWF+ KY P    KRK E    ++ R E+F    E   ++++ +  D  + +V L+D+VVI LEGG   DLT+L+ K           IL+      PEK  + + I        E D  K       + +     ++    ++  ++ +PRALH+T S+FLRNL P + +SE+E + K + GF+RL++ DP P+R++FRRGWVT+DR VNIKEICWNLN++RL D ++GAIVNR+L++RIR V  + NH+ V R+D+K+ + ++  FD R  LWQ  DG+    + T  + S NP+L NIT++L+      EEA            T    D      E D +L   LD+++LYLR VHS D+Y+ +EY  EDEMP+RCGI+HAR A      P TQ+E+ +Y  +F+ KA  L +++   ++  E  +LG K  +E ++ F+  NTQEISKDKWLCPLSGKKFKGP+FV+KHI NKH+DK++ VK+  ++FNNYL DPKRPQLPEHP ++ G K
Sbjct:  141 TQPPMMSLKSFLITQDDNITDEEALAKYNEYKLQFKRNQLNEFFVAHKDEEWFKIKYHPDDSVKRKEEQTIALKKRLEVFKEFLENGKVESVCVDADNPEPLVHLLDSVVIKLEGGTDFDLTVLNPK----------EILKAKQEPEPEKKETDKKINAGGNSDGEVDSDKEDEAMDVDGQKPEVLDITNDSDQNDDVVKPRALHRTTSVFLRNLAPAITKSELETICKRFPGFIRLSIADPLPERRWFRRGWVTFDRDVNIKEICWNLNSVRLRDSELGAIVNRDLSKRIRSVNGVTNHRQVARNDMKLCASIINNFDNRSGLWQLTDGEQPASEKTYGVVSRNPVLHNITDFLI------EEASAEEEELLGENATCEPED----NTEKDLQLFKALDKMLLYLRIVHSVDFYNHSEYVNEDEMPNRCGIMHARCA--LPSNPPTQQEITDYCNNFQTKANSLTVSTSHEVSEKELMQLGAKHEEEEIEKFVTSNTQEISKDKWLCPLSGKKFKGPEFVRKHIFNKHIDKLDDVKKEVKYFNNYLRDPKRPQLPEHPGSKQGRK 684          
BLAST of serrate RNA effector molecule vs. TrEMBL
Match: A0A423U785 (Arsenite-resistance protein 2-like protein OS=Penaeus vannamei OX=6689 GN=C7M84_022254 PE=4 SV=1)

HSP 1 Score: 444.121 bits (1141), Expect = 1.884e-139
Identity = 257/588 (43.71%), Postives = 363/588 (61.73%), Query Frame = 2
Query:  509 PTQPPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILDSKRYRSESPNDSHILEDVVVKSPEKVTSSEGIEVVNKEII--------------------EPDDKKFXXXXXXXXXXXXKF--------EKKSELQEPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDTTNPM----SSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPEHPSNRPGVK 2176
            PTQPPM+ FK F++Q DD I  ++A++KY++YK  F  +QL  FF +H  +EWF+ KY P+   KR+ E   N++ R  +F  L E N M+NI +  D++D +++L+D+VVI LEGG   DL +LD                    ++PE+   S+ IE   K  I                    EP      EE    +   +++        EK++  ++      + SIFLRNL P + + E+EA+ + Y+GFLR A+ DP P+R++FRRGWVT+ R VNIK+ICWNLNNIRL DC++GAIVNR+L++RIR V  + +H+ V+R DIK++++++   D R  LW  E  ++  N +    SS+NP+L NIT+YL++E S EEE LLG N  S           +   +E D  L  VLDRL+LYLR VHS DYY+ +EY  EDEMP+RCGI+HARG  I     +T +EV++Y ++FE K    L  +  L+ DEAKKLG K  +E V+ F+  NTQE++KDKW CPL GKKFKG ++V KHIL KH +KV+ VK+  ++FNNYL DPKRPQLPE+P N+ G +
Sbjct:  139 PTQPPMMTFKAFMEQCDDSISEEEALRKYSDYKLEFKRQQLNEFFINHKEEEWFKAKYHPEECVKRRDEQLSNLKRRVSVFCELFEMNRMENISVDADQSDQLLKLLDSVVIKLEGGTDLDLQVLD--------------------QAPEEDVKSQPIEEEKKPFILGEDSDEGEEKEKSEEKNPDEPLKMDMSEEQMELQKKAKEYLKQKVNEGEKETRKRKHSGSSSSTSIFLRNLAPTITKQEVEAMCRRYNGFLRAAIADPQPERRWFRRGWVTFKRDVNIKDICWNLNNIRLRDCELGAIVNRDLSRRIRTVNGITSHRSVVRSDIKLSAKIIQNLDSRWGLWI-ESTENLDNALLSLTSSSNPVLRNITDYLIEEASAEEEELLGANDASANNSEEKAEGEA---IERDPSLIKVLDRLLLYLRIVHSVDYYNHSEYPNEDEMPNRCGIMHARG--IPPSSKVTPQEVQDYCRAFENKIGSFLQPLTKLSDDEAKKLGLKEAEEEVEKFVQSNTQEVAKDKWQCPLCGKKFKGAEYVHKHILIKHAEKVKEVKKEVDYFNNYLRDPKRPQLPEYPGNKHGGR 700          
BLAST of serrate RNA effector molecule vs. Ensembl Cavefish
Match: srrt (serrate RNA effector molecule homolog (Arabidopsis) [Source:NCBI gene;Acc:192311])

HSP 1 Score: 370.933 bits (951), Expect = 6.761e-114
Identity = 186/354 (52.54%), Postives = 249/354 (70.34%), Query Frame = 2
Query: 1094 PRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDT--TNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPE 2149
            PR LHKT S+F+R++ P + ++EI AL + Y GF+R+ L DP P+R+FFRR WVT+DR VNIK+ICWNL NIRL DC++   VNR+L +R+R +  +  HK V+R+DIK+A++L+   D R  LW      D      + + NP+L NIT+YL+DE S EEE LLG    ++ E      +P+ I VE D+KL  VLDRL+ YLR VHS DYY+  EY  EDEMP+RCGI+H RG  I  ++ +T +EV ++ K+FE K  L+ +  E L+ DEA K+G K  ++ V+ F+  NTQE+ KDKWLCPLSGKKFKGP+FV+KHILNKH DK+E VK+  EFFNN+L+D KRP LPE
Sbjct:  422 PRPLHKTSSLFMRSIAPTISKAEIVALCRRYPGFMRVCLSDPQPERRFFRRCWVTFDRAVNIKDICWNLQNIRLRDCELAPGVNRDLARRVRNINGITQHKQVLRNDIKLAAKLIHSLDDREALWSPRPSGDAPVAVEIPAQNPILKNITDYLIDEVSAEEEELLGSVGGADSEEGAKEGNPTEITVERDEKLVKVLDRLLFYLRIVHSIDYYNCCEYPSEDEMPNRCGIIHVRGP-IPPNR-ITHREVGDWEKTFEEKLVLLFSVKETLSEDEAVKMGRKAPEQEVEKFVTANTQELGKDKWLCPLSGKKFKGPEFVRKHILNKHGDKIEEVKKEVEFFNNFLMDAKRPSLPE 773          

HSP 2 Score: 106.301 bits (264), Expect = 5.280e-23
Identity = 49/126 (38.89%), Postives = 77/126 (61.11%), Query Frame = 2
Query:  509 PTQPPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILD 886
            P  P M  FK FL   DD ++  +++K+YNEYK  F  +Q++ FF +H ++EWFR KY P    KRK +    +Q R  +F  L E +W D++ + +D    I++++DA VI +EGG  +D+ IL+
Sbjct:  148 PPPPVMKSFKEFLLSLDDSVDETESVKRYNEYKIEFRRQQMQDFFLAHKDEEWFRSKYHPDESSKRKADAHAALQNRLNVFMDLMENSWFDSVSMDIDRAPQILKILDAAVIKMEGGTENDMRILE 273          
BLAST of serrate RNA effector molecule vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010621.1 (pep scaffold:Pmarinus_7.0:GL476849:23359:42927:-1 gene:ENSPMAG00000009614.1 transcript:ENSPMAT00000010621.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 345.51 bits (885), Expect = 1.594e-105
Identity = 174/362 (48.07%), Postives = 246/362 (67.96%), Query Frame = 2
Query: 1091 EPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLW---QREDGKDTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSD-----PSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKG-PDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPE 2149
            +PRALH+T S+F+RN+ PN+ +SEI A+ K Y GF+R+AL DP  +R+F+RRGWVT++R+VNIKEICW+L NIRL +C++  +VNR+L +R+R V  +  HKPV+R+DI++A++L+   D++  LW   Q     D   P SS NP+L NIT+YL++E S           +  L   +TGSD      S++ +E D KL  VLDRL+LYLR VHS DYY+  EYQ EDEMP+RCG++H RG  +  ++  T  EV EY +  E +   +LN+ +  T +EA K+G K  ++ V+ ++  NTQE+ KDKW+CP SGKKFK   +F++KHI NKH DK+  V++   FFNNYL+D KRP  PE
Sbjct:  382 KPRALHRTCSLFMRNIAPNIPKSEIVAIFKRYPGFVRVALSDPQIERRFYRRGWVTFERSVNIKEICWSLQNIRLRECELSPVVNRDLARRVRGVQGITQHKPVVRNDIRLAAKLIQALDQKAQLWSATQPIKDTDILAPFSSQNPILKNITDYLIEEVS--------AEEDELLGNAITGSDEPKDSTSDVPLERDGKLLQVLDRLVLYLRIVHSVDYYNACEYQNEDEMPNRCGMIHVRGP-LPTNR-ATHNEVTEYERQQEERLAPLLNARDTPTPEEAIKMGKKDPEQEVEKYVQGNTQEVGKDKWVCPFSGKKFKEIMEFLRKHIFNKHADKLGEVQREVGFFNNYLMDLKRPGPPE 733          

HSP 2 Score: 101.679 bits (252), Expect = 2.570e-22
Identity = 52/138 (37.68%), Postives = 82/138 (59.42%), Query Frame = 2
Query:  479 IPKSDDTPNYPTQPPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMD--AVVILLEGGNAHDLTILD 886
            +P+ +  P YP    M  FK FL    + ++  +A+++YN YK  F  +QL  FF +H ++EWFR KY P+   KRK E    +Q R + FT+L E  W ++I + +D+++ I+R++D  A VI +EGG   DL  +D
Sbjct:  126 VPEVEAPPAYPI---MKTFKEFLLSIAESVDETEAVRRYNNYKIEFRRQQLHEFFMAHKDEEWFRVKYHPEESAKRKHEAASALQHRLKAFTFLLEGGWFNSISLDIDKSEQIIRVLDAGAAVIKMEGGTDLDLQTVD 260          
BLAST of serrate RNA effector molecule vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001670.1 (pep scaffold:Pmarinus_7.0:GL480784:6169:22985:1 gene:ENSPMAG00000001502.1 transcript:ENSPMAT00000001670.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.606 bits (392), Expect = 4.347e-40
Identity = 69/161 (42.86%), Postives = 111/161 (68.94%), Query Frame = 2
Query: 1070 EKKSELQEPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDTTNPMSSN--NPLLANITEYL 1546
            E++  L  PR  H+  SIFLRN+ P + ++EI +L + + GF+R+AL +P P+R F+RRGWVT+   VNI++ICWNL N++L +C++  +VNR+L +R+R V  ++ H  V R+ +++A +LV   D+R  LW+  +G  TT P +S+  NPLL  +++YL
Sbjct:  415 EEQGLLPRPRNFHRNMSIFLRNIAPYISKAEIVSLCRRFPGFMRVALSEPQPERGFYRRGWVTFSGHVNIQDICWNLQNVKLRECELSPVVNRDLARRMRIVSGVSLHATVARNHLRLALKLVHALDRRAKLWEYTEG--TTIPGTSDGANPLLGGLSKYL 573          

HSP 2 Score: 83.9593 bits (206), Expect = 5.710e-17
Identity = 47/123 (38.21%), Postives = 72/123 (58.54%), Query Frame = 2
Query:  524 MLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDA---VVILLEGGNAHDLTIL 883
            M  FK FL   DD +E  +A+K Y+EYK  F  +Q++ FF +H  +EWFR +Y P   EKR+ ++  + + R  +F  L +  W+DN+ + +D+ D I   +DA     +L+EGG A DL  L
Sbjct:  142 MKSFKEFLVTLDDAVEETEAVKLYSEYKQEFQQQQMQDFFLAHKGEEWFRTRYHPDEREKRRRDIIASARHRVAVFCMLKQHKWLDNVTLDLDKTDQIAHFLDAARTASMLMEGGTAEDLKAL 264          
BLAST of serrate RNA effector molecule vs. Ensembl Nematostella
Match: EDO46264 (Ars2/serrate-like protein; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQB5])

HSP 1 Score: 308.145 bits (788), Expect = 3.020e-89
Identity = 156/381 (40.94%), Postives = 231/381 (60.63%), Query Frame = 2
Query: 1094 PRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDTTNP-----------------------------MSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPE 2149
            PR LHKT+S+F+RN+ P++ +++I A  K + GFLR+AL DP+PDR+F+RRGW+T+DR+V+IK+I W+ NNIR+ + ++  ++NR+L++RIRPV  +   K V+R  IK+A+ L+   DK+  +++++  K                                  + + NP+LA+++E +    + EE       L           D S +    D  L  VLDR++LYLR VHS DYY+  +Y  EDEMP+RCGI+H RG    V +  T  E  E+ K+ + K EL L   E +  +E  KLG +  +  ++ F+  NTQE++KDKWLCPLSGKKF+GP+FV+KHI NKH D+VE V+   EFFN ++ DPKRP  PE
Sbjct:  693 PRPLHKTYSLFMRNIPPSISKADIAAACKRFPGFLRVALSDPSPDRRFYRRGWITFDRSVDIKQINWDFNNIRIKEAELNPVINRDLSRRIRPVNGITQAKQVVRESIKLAADLIRVLDKKSAVYEKDQEKQEEQNGKEKETAEKKEEGEEGEEKPAEEKEPPLNIPNENPILASLSEDV----AEEEGGEEMELLGKGSPPADGDGDKSEVDFTQDPALLRVLDRMLLYLRVVHSMDYYNCGDYPHEDEMPNRCGIMHVRGP---VPEKATLAEAHEWQKNTKQKLELFLQEKETVPDEEILKLGKRDPESEIEKFVEANTQELAKDKWLCPLSGKKFRGPEFVRKHIFNKHADQVEEVRMEVEFFNRFIADPKRPANPE 1066          

HSP 2 Score: 109.383 bits (272), Expect = 2.812e-24
Identity = 57/136 (41.91%), Postives = 82/136 (60.29%), Query Frame = 2
Query:  509 PTQPPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILDSKRYRSESPN 916
            P  P M   K FL  QDD+I+  +A+ KY  YK  F   QL  FF  H ++EWFR +Y P+   +R+ EL+++++ R   F  L E     ++++ VD +D+IV+ +DAVVI LEGG+  DL ILD    RS SP+
Sbjct:  149 PPGPVMQTLKQFLATQDDNIDDMEAICKYQAYKLDFKKTQLNDFFQQHKDEEWFRMRYHPREAAQRQKELQRSVRCRLNCFLELMEMELSKDLRLEVDHSDAIVKFLDAVVIKLEGGSDEDLAILD----RSPSPS 280          
BLAST of serrate RNA effector molecule vs. Ensembl Medaka
Match: srrt (serrate, RNA effector molecule [Source:NCBI gene;Acc:101166978])

HSP 1 Score: 369.007 bits (946), Expect = 2.497e-113
Identity = 190/361 (52.63%), Postives = 260/361 (72.02%), Query Frame = 2
Query: 1076 KSELQEPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLW---QREDGKDTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPE 2149
            K +   PR LH+T S+F+R++ P++ ++EI AL + Y GFLR+ L DP P+R+FFRR WVT+DR+VNIKE+CWNL NIRL DC++   VNR+L +R+R V  +  HK V+R+DIK+A++L+   D++ +LW    +E+G  +  P S  NP+L NIT+YL++E S EEE LLG     + E      +P+ + VE DDKLA VLDRL+LYLR VHS DYY+T EY  EDEMP+RCG++H RG  I  ++ +T  EV++++K  E K   + +  E+L+ +EA K+G K  +E V+ FI+ NTQE+ KDKWLCPLSGKKFKGP+FV+KHILNKH DKVE VK+   FFNN+L+D KRP LPE
Sbjct:  417 KDDSPRPRPLHRTCSLFMRSIAPSISKAEIIALCRRYPGFLRVCLSDPHPERRFFRRCWVTFDRSVNIKEVCWNLQNIRLRDCELAPGVNRDLARRVRNVNGITQHKQVLRNDIKLAAKLIHALDEKGDLWGSKAQEEGPGSELPAS--NPILKNITDYLIEEVSAEEEELLGSGSGMDTEDNNKEGNPAEMTVERDDKLAKVLDRLVLYLRIVHSVDYYNTCEYPSEDEMPNRCGMIHVRGP-IPPNR-ITHGEVQQWLKMMEEKLTPLFSLKEMLSEEEAVKMGRKNPEEEVEKFISANTQELGKDKWLCPLSGKKFKGPEFVRKHILNKHGDKVEEVKKEVAFFNNFLMDAKRPSLPE 773          

HSP 2 Score: 114.005 bits (284), Expect = 1.891e-25
Identity = 52/126 (41.27%), Postives = 78/126 (61.90%), Query Frame = 2
Query:  509 PTQPPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILD 886
            P  P M  FK FL   DD ++  +A+K+YNEYK  F  +Q++ FF +H ++EWFR KY P    + K E    +  R  +FT+L E  W D++ + ++++  I+R++DA VI +EGG  HDL ILD
Sbjct:  142 PPPPIMKSFKEFLLSLDDSVDETEAVKRYNEYKVDFRRQQMQDFFLAHKDEEWFRSKYHPDEASRLKAEARSALHNRLNVFTFLMENGWFDHVSLDIEQSPVIIRVLDAAVIKMEGGTDHDLRILD 267          
BLAST of serrate RNA effector molecule vs. Planmine SMEST
Match: SMESG000030605.1 (SMESG000030605.1)

HSP 1 Score: 1327.38 bits (3434), Expect = 0.000e+0
Identity = 791/796 (99.37%), Postives = 794/796 (99.75%), Query Frame = 2
Query:  158 MADSEEECDTWRNRDKYPKEREEVKAKSPSPVEQRNEVRNDKRSFNSYQSPNKSIEPPFKRQRREGDEYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPKSDDTPNYPTQPPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILDSKRYRSESPNDSHILEDVVVKSPEKVTSSEGIEVVNKEIIEPDDKKFXXXXXXXXXXXXKFEKKSELQEPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPEHPSNRPGVKTTESGEIRNEGQFDNNNKRFGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSSPNGGGYRDSXXXXXXXXXXXXXXXXXYYRKSSYPXXXXXXXXXXXXXXYYARKVLSYNDLDAPMDD 2545
            MADSEEECDTWRNRDKYPKEREEVKAKSPSPVEQRNEVRNDKRSFNSYQSPNKSIEPPFKRQRREGDEYNNNFNSN+N NPHNRDNKDFRDNRRESSFDNRFNSNSSIPKSDDTPNYPTQPPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILDSKRYRSESPNDSHILEDVVVKSPEKVTSSE IE+VNKEIIEPDDKKFEEEIESTENVEEKFEKKSELQEPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDTTNPMSSNNPLLANITEYLVDEGSYEEEALLGGNLNSNLELTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPEHPSNRPGVKTTESGEIRNEGQFDNNNKRFGDNDSRNRNMDNNRNFSRRNDDFDNRRPNYRNDRGSSPNGGGYRDSGNRNNNFGDNRGG+NGNYYRKSSYPSRGSQSRQRNGGGSYYARKVLSYNDLDAPMDD
Sbjct:    1 MADSEEECDTWRNRDKYPKEREEVKAKSPSPVEQRNEVRNDKRSFNSYQSPNKSIEPPFKRQRREGDEYNNNFNSNINSNPHNRDNKDFRDNRRESSFDNRFNSNSSIPKSDDTPNYPTQPPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILDSKRYRSESPNDSHILEDVVVKSPEKVTSSEEIEIVNKEIIEPDDKKFEEEIESTENVEEKFEKKSELQEPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDTTNPMSSNNPLLANITEYLVDEGSYEEEALLGGNLNSNLELTVTGSDPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPEHPSNRPGVKTTESGEIRNEGQFDNNNKRFGDNDSRNRNMDNNRNFSRRNDDFDNRRPNYRNDRGSSPNGGGYRDSGNRNNNFGDNRGGSNGNYYRKSSYPSRGSQSRQRNGGGSYYARKVLSYNDLDAPMDD 796          
BLAST of serrate RNA effector molecule vs. Planmine SMEST
Match: SMESG000023055.1 (SMESG000023055.1)

HSP 1 Score: 580.096 bits (1494), Expect = 0.000e+0
Identity = 293/584 (50.17%), Postives = 422/584 (72.26%), Query Frame = 2
Query:  503 NYPTQPPMLLFKHFLQQQDDDIEMDQAMKKYNEYKDSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTYLHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILDSKRYRSESPNDSHILEDVVVK-------------------SPEKVTSS-------EGIEVVNKEIIEPDDKKFXXXXXXXXXXXXKFEKKSELQEPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLALQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELTQRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDTTNPMSSNNPLLANITEYLVDEGSYXXXXXXXXXXXXXXXXTVTGS---DPSNIKVEVDDKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHVDKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVFIAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFFNNYLLDPKRPQLPEHPSNRP 2167
            NY TQPPMLLFKHFL QQ+D+I ++ AM+KYNEYK++F  +QL++FF++H ++EWF EKY P ++E ++ +  +NI  RK++F +L+E  +MD + +H++  DS+ +L+D+ VILLEGG  +DL +L+ K YR++SP  + I  D+  K                   S  ++TS         G E   + +++   K+   EI+S E +    E  +E  +PR LHK+ S+F++N+HP V RS++E LVKP+ G++R+ALQDP P+RKF RRGWVT++R+ ++K + W LN  +L D D+GA+VN+E++QRIRP   + NH+ VMR D+K A++LVAKFDKR +LW+ ++           NPLL NITE+LVDEGSYEEEA LGG+++SNL +T  G    DP+NI+++ D  LA VLDRL+LYLR VHS+DYYS TEY+IED +P+RCG+LHARG  ++ D+ L+Q  +E+Y+K FE+KAEL+L+S++ L    A +LG K ++E+V+ FI +NT+EI+ +KWLCPLSGKKFKGPD+V+KHILNK+ D+++ VKQ  +FFNNY+LDP+RPQLPEHPSNRP
Sbjct:   61 NYITQPPMLLFKHFLNQQEDNILVEDAMRKYNEYKEAFACEQLQSFFETHKDEEWFMEKYHPDYIEAKEFKRLENIDSRKKVFMWLYENKYMDEVSVHINYQDSLFKLLDSAVILLEGGTENDLRVLEKKVYRADSPERTEIKIDIKSKNDPSSLKWDDFNTSSGDDDSDVEITSGVKASDRDSGRESDREAVVDVPKKELSPEIKSPEEMMANDELPAEGVDPRPLHKSCSVFIKNIHPKVFRSQLEELVKPFPGYVRIALQDPMPERKFLRRGWVTFERSSDVKNVVWELNKAKLLDVDLGAVVNKEISQRIRPTQPVTNHRAVMRQDVKYAAKLVAKFDKRRHLWESDNDA---------NPLLCNITEHLVDEGSYEEEAYLGGDISSNLAITGRGGSTNDPNNIRMDEDLDLARVLDRLVLYLRIVHSYDYYSATEYEIEDFLPNRCGLLHARGNLLYPDQRLSQAHLEKYMKDFEIKAELVLDSIDNLDFVVASRLGVKGIEEAVEKFITDNTKEITTEKWLCPLSGKKFKGPDYVRKHILNKYADRIDNVKQTVQFFNNYILDPRRPQLPEHPSNRP 635          
The following BLAST results are available for this feature:
BLAST of serrate RNA effector molecule vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SRRT2.529e-11852.49serrate, RNA effector molecule [Source:HGNC Symbol... [more]
SRRT3.041e-11352.49serrate, RNA effector molecule [Source:HGNC Symbol... [more]
SRRT3.111e-11352.49serrate, RNA effector molecule [Source:HGNC Symbol... [more]
SRRT3.348e-11352.49serrate, RNA effector molecule [Source:HGNC Symbol... [more]
SRRT3.425e-11352.49serrate, RNA effector molecule [Source:HGNC Symbol... [more]
back to top
BLAST of serrate RNA effector molecule vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
E01A2.26.198e-11037.01Serrate RNA effector molecule homolog [Source:Uni... [more]
E01A2.26.522e-8440.55Serrate RNA effector molecule homolog [Source:Uni... [more]
back to top
BLAST of serrate RNA effector molecule vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ars21.792e-11249.07gene:FBgn0033062 transcript:FBtr0310665[more]
Ars21.911e-11249.07gene:FBgn0033062 transcript:FBtr0310667[more]
Ars22.924e-11249.07gene:FBgn0033062 transcript:FBtr0086020[more]
Ars22.924e-11249.07gene:FBgn0033062 transcript:FBtr0086021[more]
Ars22.924e-11249.07gene:FBgn0033062 transcript:FBtr0086018[more]
back to top
BLAST of serrate RNA effector molecule vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
srrt1.375e-11052.12serrate RNA effector molecule homolog (Arabidopsis... [more]
srrt5.642e-11052.12serrate RNA effector molecule homolog (Arabidopsis... [more]
back to top
BLAST of serrate RNA effector molecule vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SRRT2.117e-10448.26serrate, RNA effector molecule [Source:HGNC Symbol... [more]
SRRT1.204e-10348.90serrate, RNA effector molecule [Source:HGNC Symbol... [more]
SRRT1.314e-10348.90serrate, RNA effector molecule [Source:HGNC Symbol... [more]
SRRT2.104e-10348.90serrate, RNA effector molecule [Source:HGNC Symbol... [more]
SRRT4.502e-10348.77serrate, RNA effector molecule [Source:HGNC Symbol... [more]
back to top
BLAST of serrate RNA effector molecule vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Srrt3.827e-11252.49serrate RNA effector molecule homolog (Arabidopsis... [more]
Srrt4.333e-11252.49serrate RNA effector molecule homolog (Arabidopsis... [more]
Srrt4.460e-11252.49serrate RNA effector molecule homolog (Arabidopsis... [more]
Srrt1.944e-10350.27serrate RNA effector molecule homolog (Arabidopsis... [more]
Srrt2.686e-5755.00serrate RNA effector molecule homolog (Arabidopsis... [more]
back to top
BLAST of serrate RNA effector molecule vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B4NYV0|SRRT_DROYA4.186e-11650.13Serrate RNA effector molecule homolog OS=Drosophil... [more]
sp|Q17FR9|SRRT_AEDAE1.357e-11552.21Serrate RNA effector molecule homolog OS=Aedes aeg... [more]
sp|Q28WQ8|SRRT_DROPS2.656e-11347.45Serrate RNA effector molecule homolog OS=Drosophil... [more]
sp|B3N3F7|SRRT_DROER5.304e-11344.44Serrate RNA effector molecule homolog OS=Drosophil... [more]
sp|B4LIK8|SRRT_DROVI9.132e-11341.51Serrate RNA effector molecule homolog OS=Drosophil... [more]
back to top
BLAST of serrate RNA effector molecule vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0F7GYG70.000e+099.04Serrate RNA effector molecule (Fragment) OS=Schmid... [more]
A0A3B3B9F33.919e-14545.09Serrate RNA effector molecule homolog (Arabidopsis... [more]
A0A3Q2DCY03.607e-14343.24Serrate RNA effector molecule homolog (Arabidopsis... [more]
J9K6M86.048e-14243.64Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
A0A423U7851.884e-13943.71Arsenite-resistance protein 2-like protein OS=Pena... [more]
back to top
BLAST of serrate RNA effector molecule vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
srrt6.761e-11452.54serrate RNA effector molecule homolog (Arabidopsis... [more]
back to top
BLAST of serrate RNA effector molecule vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000010621.11.594e-10548.07pep scaffold:Pmarinus_7.0:GL476849:23359:42927:-1 ... [more]
ENSPMAT00000001670.14.347e-4042.86pep scaffold:Pmarinus_7.0:GL480784:6169:22985:1 ge... [more]
back to top
BLAST of serrate RNA effector molecule vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of serrate RNA effector molecule vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO462643.020e-8940.94Ars2/serrate-like protein; Predicted protein [Sou... [more]
back to top
BLAST of serrate RNA effector molecule vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
srrt2.497e-11352.63serrate, RNA effector molecule [Source:NCBI gene;A... [more]
back to top
BLAST of serrate RNA effector molecule vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000030605.10.000e+099.37SMESG000030605.1[more]
SMESG000023055.10.000e+050.17SMESG000023055.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30019623
GenBankAKG62128.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019623 ID=SMED30019623|Name=serrate RNA effector molecule|organism=Schmidtea mediterranea sexual|type=transcript|length=2740bp
ATTTAACGGTAGACATTTTCACTTACTATTATTTTTTATAATTTCTAAAA
TTGTGGCGCATGATATATGGTTTTTTTAAATTTTAAAATGAAATGAAATT
AGTTTTTGTTAAATATCGTATACACAGTATCAATTAACATTACTTTATAA
TGCTCCTATGGCTGACTCTGAAGAAGAATGCGATACTTGGAGAAATCGTG
ATAAGTATCCTAAAGAACGGGAAGAAGTCAAGGCTAAATCACCAAGTCCA
GTTGAACAAAGAAACGAAGTAAGAAATGATAAAAGATCATTTAATAGTTA
TCAATCTCCCAATAAATCAATTGAACCACCGTTTAAACGCCAACGCCGAG
AAGGAGATGAATATAATAATAATTTTAATTCAAATGTCAATTTTAATCCG
CACAATAGAGACAATAAAGATTTTAGAGATAATAGAAGAGAATCAAGTTT
TGACAATAGATTCAATTCTAATAGTAGTATACCTAAATCTGATGATACTC
CAAATTATCCAACGCAGCCACCTATGCTACTTTTTAAACATTTTTTACAG
CAACAAGATGATGACATTGAAATGGACCAAGCTATGAAAAAATATAATGA
ATATAAAGATTCATTTGTTACAAAACAACTCAAGGCTTTCTTTGATTCTC
ACTCTAATCAGGAGTGGTTTCGAGAGAAGTATTCTCCTCAATTTGTCGAA
AAGAGGAAAGTAGAATTAGAGAAAAACATTCAATTAAGAAAAGAAATTTT
TACTTATTTGCATGAAAGAAACTGGATGGATAATATCAAAATTCACGTTG
ACGAAAATGATAGTATTGTTCGCCTGATGGATGCAGTCGTTATTTTGCTA
GAGGGTGGAAATGCTCATGATTTAACAATTTTGGACAGTAAGCGATATCG
ATCAGAGTCTCCCAATGATTCTCATATTTTGGAAGATGTAGTAGTTAAAT
CACCAGAAAAAGTAACCTCTAGTGAGGGAATCGAAGTTGTTAACAAGGAA
ATTATTGAGCCTGATGATAAAAAATTTGAAGAAGAAATAGAGTCAACTGA
AAATGTTGAAGAAAAGTTTGAGAAAAAATCGGAATTACAAGAACCACGTG
CACTCCATAAAACATTTTCTATTTTTCTACGCAATCTTCATCCTAATGTC
CTTCGAAGTGAAATTGAAGCATTAGTTAAACCATACAGTGGTTTTTTGAG
ATTAGCTCTACAAGATCCTACTCCAGATAGAAAATTCTTTAGACGAGGCT
GGGTAACTTATGATAGAACTGTTAATATTAAAGAAATATGCTGGAATTTG
AATAACATTAGATTACATGATTGTGATATCGGAGCTATTGTAAATAGAGA
ACTGACTCAAAGAATTAGGCCCGTAATGGTATTAGCAAATCACAAGCCCG
TGATGAGGCATGATATTAAAATCGCGTCTAGATTAGTTGCAAAATTCGAC
AAGCGACATAATTTATGGCAGCGAGAGGATGGTAAAGATACTACAAATCC
AATGTCCAGCAATAATCCGTTGTTAGCGAACATTACTGAGTATTTGGTTG
ATGAAGGTAGTTACGAAGAGGAGGCTCTTTTAGGTGGTAATTTAAATTCA
AATCTAGAACTAACTGTAACCGGCAGTGATCCATCGAATATTAAAGTTGA
AGTTGATGATAAACTTGCAGCGGTACTGGATAGATTAATTCTTTATTTGC
GATTCGTTCATTCGTTTGATTACTATTCAACGACAGAATATCAAATTGAA
GATGAAATGCCACATAGATGTGGAATTTTGCACGCCCGTGGGGCTCATAT
CCATGTCGATAAGCCACTGACCCAGAAGGAAGTTGAAGAGTATATCAAAT
CGTTTGAAATGAAAGCTGAATTAATTCTGAATTCCGTAGAATTATTGACT
ATAGATGAAGCGAAAAAGTTAGGCTATAAGACTCTAGACGAATCTGTCGA
CGTGTTTATCGCAGAGAATACGCAAGAAATATCTAAAGATAAGTGGCTGT
GTCCATTATCTGGCAAAAAATTCAAAGGCCCAGATTTCGTACAGAAACAT
ATTTTGAATAAGCACATGGACAAAGTGGAATTGGTTAAGCAAAACACGGA
ATTTTTCAATAATTATCTGTTGGATCCCAAGCGGCCTCAGTTACCGGAAC
ATCCATCGAATCGTCCAGGTGTCAAAACAACGGAAAGCGGAGAGATTAGA
AATGAAGGCCAATTTGACAACAATAACAAAAGGTTCGGGGATAACGATTC
GAGAAATCGTAACATGGATAATAATCGGAATTTCTCTCGCAGGAATGATG
ATTTTGATAATCGTCGTCCAAATTACAGAAACGATCGGGGCTCGTCTCCG
AATGGCGGAGGATATCGGGATTCTGGTAATAGAAACAATAATTTCGGTGA
TAATCGAGGCGGAACCAATGGAAACTATTATCGGAAAAGTAGTTATCCAT
CAAGAGGTAGCCAATCACGTCAAAGGAATGGAGGGGGCTCATATTATGCT
CGAAAAGTGTTAAGCTATAATGATTTAGATGCTCCAATGGACGATTGAAT
GAGATATAGTGTAGCATTTTTACAGTGTTTATAAATACATTTTAATTGTC
ACTACTCGCGGGTGAGATTGAATTATTGATTGATGTAATTGTGTTCATAA
TGTTTCCAAGATGACTGTCAGAATTTGTTTTTTGATGTGTTTATCTTAAA
TATATTTTTCGATAATATATTCGTAGGTTTAAACTTTTTG
back to top

protein sequence of SMED30019623-orf-1

>SMED30019623-orf-1 ID=SMED30019623-orf-1|Name=SMED30019623-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=797bp
MADSEEECDTWRNRDKYPKEREEVKAKSPSPVEQRNEVRNDKRSFNSYQS
PNKSIEPPFKRQRREGDEYNNNFNSNVNFNPHNRDNKDFRDNRRESSFDN
RFNSNSSIPKSDDTPNYPTQPPMLLFKHFLQQQDDDIEMDQAMKKYNEYK
DSFVTKQLKAFFDSHSNQEWFREKYSPQFVEKRKVELEKNIQLRKEIFTY
LHERNWMDNIKIHVDENDSIVRLMDAVVILLEGGNAHDLTILDSKRYRSE
SPNDSHILEDVVVKSPEKVTSSEGIEVVNKEIIEPDDKKFEEEIESTENV
EEKFEKKSELQEPRALHKTFSIFLRNLHPNVLRSEIEALVKPYSGFLRLA
LQDPTPDRKFFRRGWVTYDRTVNIKEICWNLNNIRLHDCDIGAIVNRELT
QRIRPVMVLANHKPVMRHDIKIASRLVAKFDKRHNLWQREDGKDTTNPMS
SNNPLLANITEYLVDEGSYEEEALLGGNLNSNLELTVTGSDPSNIKVEVD
DKLAAVLDRLILYLRFVHSFDYYSTTEYQIEDEMPHRCGILHARGAHIHV
DKPLTQKEVEEYIKSFEMKAELILNSVELLTIDEAKKLGYKTLDESVDVF
IAENTQEISKDKWLCPLSGKKFKGPDFVQKHILNKHMDKVELVKQNTEFF
NNYLLDPKRPQLPEHPSNRPGVKTTESGEIRNEGQFDNNNKRFGDNDSRN
RNMDNNRNFSRRNDDFDNRRPNYRNDRGSSPNGGGYRDSGNRNNNFGDNR
GGTNGNYYRKSSYPSRGSQSRQRNGGGSYYARKVLSYNDLDAPMDD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR039727SE/Ars2
IPR000299FERM_domain
IPR021933SERRATE/Ars2_N
IPR007042SERRATE/Ars2_C
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003676nucleic acid binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 287..307
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 668..684
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 83..98
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 725..776
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 99..116
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 685..724
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 656..780
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..116
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..42
NoneNo IPR availablePANTHERPTHR13165:SF0SERRATE RNA EFFECTOR MOLECULE HOMOLOGcoord: 22..795
IPR021933SERRATE/Ars2, N-terminalPFAMPF12066DUF3546coord: 127..235
e-value: 4.2E-31
score: 107.4
IPR007042SERRATE/Ars2 , C-terminalPFAMPF04959ARS2coord: 554..759
e-value: 2.6E-47
score: 161.7
IPR039727SERRATE/Ars2PANTHERPTHR13165ARSENITE-RESISTANCE PROTEIN 2coord: 22..795