Serine/threonine-protein phosphatase with EF-hands

Overview
NameSerine/threonine-protein phosphatase with EF-hands
Smed IDSMED30019620
Length (bp)1175
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein phosphatase with EF-hands (SMED30019620) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase with EF-hands (SMED30019620) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019620

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30019620SMESG000003989.1 SmedASXL_010207SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30019620SMESG000003989.1 dd_Smed_v4_21185_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30019620SMESG000003989.1 dd_Smed_v6_21185_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30019620SMESG000003989.1 OX_Smed_1.0.07890ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Human
Match: PPEF2 (protein phosphatase with EF-hand domain 2 [Source:HGNC Symbol;Acc:HGNC:9244])

HSP 1 Score: 102.064 bits (253), Expect = 8.208e-23
Identity = 43/79 (54.43%), Postives = 56/79 (70.89%), Query Frame = 1
Query:  562 ESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKQL 798
            E+  + +    EW+QV+++LWSDP    GCK NT RGGGCYFGPDVT Q L+K  M+ +IRSHECK  G+++CH  K L
Sbjct:  426 EAGELRKPTQEEWRQVVDILWSDPMAQEGCKANTIRGGGCYFGPDVTQQLLQKYNMQFLIRSHECKPEGYEFCHNRKVL 504          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Human
Match: PPEF2 (protein phosphatase with EF-hand domain 2 [Source:HGNC Symbol;Acc:HGNC:9244])

HSP 1 Score: 101.293 bits (251), Expect = 1.591e-22
Identity = 44/84 (52.38%), Postives = 57/84 (67.86%), Query Frame = 1
Query:  547 SVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKQL 798
            S    E+  + +    EW+QV+++LWSDP    GCK NT RGGGCYFGPDVT Q L+K  M+ +IRSHECK  G+++CH  K L
Sbjct:  421 SEADSEAGELRKPTQEEWRQVVDILWSDPMAQEGCKANTIRGGGCYFGPDVTQQLLQKYNMQFLIRSHECKPEGYEFCHNRKVL 504          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Human
Match: PPEF1 (protein phosphatase with EF-hand domain 1 [Source:HGNC Symbol;Acc:HGNC:9243])

HSP 1 Score: 95.5153 bits (236), Expect = 1.300e-20
Identity = 40/66 (60.61%), Postives = 52/66 (78.79%), Query Frame = 1
Query:  595 EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK 792
            EW+Q++++LWSDPR  NGC  NT RGGGCYFGPDVT + L K  +K++IRSHECK  G++ CH+ K
Sbjct:  352 EWEQIIDILWSDPRGKNGCFPNTCRGGGCYFGPDVTSKILNKYQLKMLIRSHECKPEGYEICHDGK 417          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Human
Match: PPP5C (protein phosphatase 5 catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9322])

HSP 1 Score: 68.9366 bits (167), Expect = 4.012e-12
Identity = 37/76 (48.68%), Postives = 45/76 (59.21%), Query Frame = 1
Query:  613 NLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKQLRCVCNHR*VSKCPN 840
            +LLWSDP+P NG  ++  RG  C FGPDVT  FLE+N +  IIRSHE K  G++  H     RCV     V   PN
Sbjct:  383 DLLWSDPQPQNGRSISK-RGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGG---RCVT----VFSAPN 450          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Human
Match: PPP5C (protein phosphatase 5 catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9322])

HSP 1 Score: 68.9366 bits (167), Expect = 4.049e-12
Identity = 37/76 (48.68%), Postives = 45/76 (59.21%), Query Frame = 1
Query:  613 NLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKQLRCVCNHR*VSKCPN 840
            +LLWSDP+P NG  ++  RG  C FGPDVT  FLE+N +  IIRSHE K  G++  H     RCV     V   PN
Sbjct:  382 DLLWSDPQPQNGRSISK-RGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGG---RCVT----VFSAPN 449          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Celegans
Match: pef-1 (Serine/threonine-protein phosphatase with EF-hands pef-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EBX9])

HSP 1 Score: 91.2781 bits (225), Expect = 1.055e-19
Identity = 41/89 (46.07%), Postives = 61/89 (68.54%), Query Frame = 1
Query:  538 QFKSVLQ------YESDNMNEC-EINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCH 783
            +F+SVL+       ES+  N    ++EWKQ+L+++WSDP+   GC  N +RGGG YFG D+T  FLEK+  +L++RSHECK  G+++ H
Sbjct:  253 RFQSVLRPPVNKGMESEKENSAVNVDEWKQMLDIMWSDPKQNKGCWPNVFRGGGSYFGADITASFLEKHGFRLLVRSHECKFEGYEFSH 341          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Celegans
Match: pef-1 (Serine/threonine-protein phosphatase with EF-hands pef-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EBX9])

HSP 1 Score: 91.2781 bits (225), Expect = 1.193e-19
Identity = 41/89 (46.07%), Postives = 61/89 (68.54%), Query Frame = 1
Query:  538 QFKSVLQ------YESDNMNEC-EINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCH 783
            +F+SVL+       ES+  N    ++EWKQ+L+++WSDP+   GC  N +RGGG YFG D+T  FLEK+  +L++RSHECK  G+++ H
Sbjct:  323 RFQSVLRPPVNKGMESEKENSAVNVDEWKQMLDIMWSDPKQNKGCWPNVFRGGGSYFGADITASFLEKHGFRLLVRSHECKFEGYEFSH 411          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Celegans
Match: pef-1 (Serine/threonine-protein phosphatase with EF-hands pef-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EBX9])

HSP 1 Score: 91.2781 bits (225), Expect = 1.220e-19
Identity = 41/89 (46.07%), Postives = 61/89 (68.54%), Query Frame = 1
Query:  538 QFKSVLQ------YESDNMNEC-EINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCH 783
            +F+SVL+       ES+  N    ++EWKQ+L+++WSDP+   GC  N +RGGG YFG D+T  FLEK+  +L++RSHECK  G+++ H
Sbjct:  388 RFQSVLRPPVNKGMESEKENSAVNVDEWKQMLDIMWSDPKQNKGCWPNVFRGGGSYFGADITASFLEKHGFRLLVRSHECKFEGYEFSH 476          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Celegans
Match: pph-5 (Serine/threonine-protein phosphatase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q9NES8])

HSP 1 Score: 62.3882 bits (150), Expect = 6.617e-12
Identity = 28/57 (49.12%), Postives = 41/57 (71.93%), Query Frame = 1
Query:  613 NLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCH 783
            +LLWSDP+P+NG +  + RG GC FGPDVT ++ E N ++ ++RSHE K  G++  H
Sbjct:    3 DLLWSDPQPING-RSPSKRGVGCQFGPDVTSKWCETNGIEYVVRSHEVKPEGYEMHH 58          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Celegans
Match: pph-5 (Serine/threonine-protein phosphatase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q9NES8])

HSP 1 Score: 63.929 bits (154), Expect = 6.254e-11
Identity = 28/57 (49.12%), Postives = 41/57 (71.93%), Query Frame = 1
Query:  613 NLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCH 783
            +LLWSDP+P+NG +  + RG GC FGPDVT ++ E N ++ ++RSHE K  G++  H
Sbjct:  382 DLLWSDPQPING-RSPSKRGVGCQFGPDVTSKWCETNGIEYVVRSHEVKPEGYEMHH 437          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Fly
Match: rdgC (gene:FBgn0265959 transcript:FBtr0473730)

HSP 1 Score: 85.5001 bits (210), Expect = 1.115e-17
Identity = 35/85 (41.18%), Postives = 57/85 (67.06%), Query Frame = 1
Query:  538 QFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK 792
            ++ S+L+    +    +  EW+Q+ +++WSDP+   GC  NT RG G +FGPDVT  FL+++ +  +IRSHECK NG ++ H++K
Sbjct:  306 KYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNK 390          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Fly
Match: rdgC (gene:FBgn0265959 transcript:FBtr0342946)

HSP 1 Score: 85.5001 bits (210), Expect = 1.180e-17
Identity = 35/85 (41.18%), Postives = 57/85 (67.06%), Query Frame = 1
Query:  538 QFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK 792
            ++ S+L+    +    +  EW+Q+ +++WSDP+   GC  NT RG G +FGPDVT  FL+++ +  +IRSHECK NG ++ H++K
Sbjct:  290 KYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNK 374          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Fly
Match: rdgC (gene:FBgn0265959 transcript:FBtr0342949)

HSP 1 Score: 85.5001 bits (210), Expect = 1.355e-17
Identity = 35/85 (41.18%), Postives = 57/85 (67.06%), Query Frame = 1
Query:  538 QFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK 792
            ++ S+L+    +    +  EW+Q+ +++WSDP+   GC  NT RG G +FGPDVT  FL+++ +  +IRSHECK NG ++ H++K
Sbjct:  375 KYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNK 459          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Fly
Match: rdgC (gene:FBgn0265959 transcript:FBtr0342947)

HSP 1 Score: 85.5001 bits (210), Expect = 1.355e-17
Identity = 35/85 (41.18%), Postives = 57/85 (67.06%), Query Frame = 1
Query:  538 QFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK 792
            ++ S+L+    +    +  EW+Q+ +++WSDP+   GC  NT RG G +FGPDVT  FL+++ +  +IRSHECK NG ++ H++K
Sbjct:  375 KYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNK 459          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Fly
Match: rdgC (gene:FBgn0265959 transcript:FBtr0342948)

HSP 1 Score: 85.5001 bits (210), Expect = 1.355e-17
Identity = 35/85 (41.18%), Postives = 57/85 (67.06%), Query Frame = 1
Query:  538 QFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK 792
            ++ S+L+    +    +  EW+Q+ +++WSDP+   GC  NT RG G +FGPDVT  FL+++ +  +IRSHECK NG ++ H++K
Sbjct:  375 KYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNK 459          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Zebrafish
Match: ppef1 (protein phosphatase, EF-hand calcium binding domain 1 [Source:ZFIN;Acc:ZDB-GENE-080303-27])

HSP 1 Score: 95.1301 bits (235), Expect = 1.133e-20
Identity = 38/63 (60.32%), Postives = 51/63 (80.95%), Query Frame = 1
Query:  595 EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCH 783
            EW+QV+++LWSDP+  NGC  N++RGGGCYFGPDVT   L+K+ + L+IRSHECK  G++ CH
Sbjct:  421 EWQQVVDILWSDPKHQNGCSPNSFRGGGCYFGPDVTQTLLQKHGLCLLIRSHECKQEGYELCH 483          

HSP 2 Score: 48.9062 bits (115), Expect = 8.559e-6
Identity = 23/51 (45.10%), Postives = 34/51 (66.67%), Query Frame = 2
Query:  194 LIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKVCVLLK 346
            +++L  + FSLLP+ATV+ N + +VHGGIS  TDL  +  + R KV   L+
Sbjct:  266 ILQLLQDVFSLLPVATVIDNKVLIVHGGISDKTDLDFLSTVERHKVKSALR 316          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Zebrafish
Match: ppef1 (protein phosphatase, EF-hand calcium binding domain 1 [Source:ZFIN;Acc:ZDB-GENE-080303-27])

HSP 1 Score: 95.1301 bits (235), Expect = 1.133e-20
Identity = 38/63 (60.32%), Postives = 51/63 (80.95%), Query Frame = 1
Query:  595 EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCH 783
            EW+QV+++LWSDP+  NGC  N++RGGGCYFGPDVT   L+K+ + L+IRSHECK  G++ CH
Sbjct:  421 EWQQVVDILWSDPKHQNGCSPNSFRGGGCYFGPDVTQTLLQKHGLCLLIRSHECKQEGYELCH 483          

HSP 2 Score: 48.9062 bits (115), Expect = 8.559e-6
Identity = 23/51 (45.10%), Postives = 34/51 (66.67%), Query Frame = 2
Query:  194 LIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKVCVLLK 346
            +++L  + FSLLP+ATV+ N + +VHGGIS  TDL  +  + R KV   L+
Sbjct:  266 ILQLLQDVFSLLPVATVIDNKVLIVHGGISDKTDLDFLSTVERHKVKSALR 316          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Zebrafish
Match: ppef1 (protein phosphatase, EF-hand calcium binding domain 1 [Source:ZFIN;Acc:ZDB-GENE-080303-27])

HSP 1 Score: 95.1301 bits (235), Expect = 1.220e-20
Identity = 38/63 (60.32%), Postives = 51/63 (80.95%), Query Frame = 1
Query:  595 EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCH 783
            EW+QV+++LWSDP+  NGC  N++RGGGCYFGPDVT   L+K+ + L+IRSHECK  G++ CH
Sbjct:  432 EWQQVVDILWSDPKHQNGCSPNSFRGGGCYFGPDVTQTLLQKHGLCLLIRSHECKQEGYELCH 494          

HSP 2 Score: 48.9062 bits (115), Expect = 8.905e-6
Identity = 23/51 (45.10%), Postives = 34/51 (66.67%), Query Frame = 2
Query:  194 LIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKVCVLLK 346
            +++L  + FSLLP+ATV+ N + +VHGGIS  TDL  +  + R KV   L+
Sbjct:  277 ILQLLQDVFSLLPVATVIDNKVLIVHGGISDKTDLDFLSTVERHKVKSALR 327          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Zebrafish
Match: CU695117.1 (protein phosphatase with EF-hand domain 2a [Source:NCBI gene;Acc:100537120])

HSP 1 Score: 93.9745 bits (232), Expect = 2.337e-20
Identity = 38/67 (56.72%), Postives = 53/67 (79.10%), Query Frame = 1
Query:  592 NEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK 792
            +EWKQ+L+LLWSDP   +GC  N  RGGGCY+GP++T  FL ++ ++LIIRSHECK +G+++CH  K
Sbjct:  386 DEWKQILDLLWSDPMSQDGCVPNEVRGGGCYWGPNITEDFLNRHNLQLIIRSHECKQDGYEFCHNRK 452          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Zebrafish
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-050327-75])

HSP 1 Score: 65.4698 bits (158), Expect = 4.231e-11
Identity = 30/60 (50.00%), Postives = 41/60 (68.33%), Query Frame = 1
Query:  613 NLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK 792
            +LLWSDP+  NG  ++  RG  C FGPDVT +FLE+N ++ I+RSHE K  G++  H  K
Sbjct:  373 DLLWSDPQLQNGRSISK-RGVSCQFGPDVTERFLEQNKLEYIVRSHEVKAEGYEVTHSGK 431          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Xenopus
Match: PPEF2 (protein phosphatase, EF-hand calcium binding domain 2 [Source:NCBI gene;Acc:100496073])

HSP 1 Score: 106.686 bits (265), Expect = 2.166e-24
Identity = 46/81 (56.79%), Postives = 64/81 (79.01%), Query Frame = 1
Query:  562 ESDNMNECEIN--EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKQL 798
            ES  M+EC+I+  E KQ++++LWSDP P +GCK NT RGGGCYFGPDVT + L+K+ ++++IRSHECK  G+++CH  K L
Sbjct:  394 ESGEMHECDIDDEEKKQIVDILWSDPIPQDGCKSNTVRGGGCYFGPDVTEKILQKHGLQMLIRSHECKQEGYEFCHSGKVL 474          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Xenopus
Match: usp43 (ubiquitin specific peptidase 43 [Source:Xenbase;Acc:XB-GENE-940625])

HSP 1 Score: 97.0561 bits (240), Expect = 3.701e-21
Identity = 40/66 (60.61%), Postives = 51/66 (77.27%), Query Frame = 1
Query:  595 EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK 792
            EWKQV+++LWSDPR  NGC  N++RGGGCYFGP+VT + L K   K++IRSHECK  G++ CH  K
Sbjct:  367 EWKQVVDILWSDPRNQNGCTPNSFRGGGCYFGPNVTKKLLAKYNFKMLIRSHECKQEGYELCHNGK 432          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Xenopus
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:NCBI gene;Acc:493275])

HSP 1 Score: 68.1662 bits (165), Expect = 7.532e-12
Identity = 30/57 (52.63%), Postives = 41/57 (71.93%), Query Frame = 1
Query:  613 NLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCH 783
            +LLWSDP+P +G + ++ RG  C FGPDVT +FLE+N +  IIRSHE K  G++  H
Sbjct:  395 DLLWSDPQPQDG-RSSSKRGVSCQFGPDVTRRFLEENGLDYIIRSHEVKPEGYEVSH 450          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Xenopus
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:NCBI gene;Acc:493275])

HSP 1 Score: 67.0106 bits (162), Expect = 1.804e-11
Identity = 30/57 (52.63%), Postives = 41/57 (71.93%), Query Frame = 1
Query:  613 NLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCH 783
            +LLWSDP+P +G + ++ RG  C FGPDVT +FLE+N +  IIRSHE K  G++  H
Sbjct:  359 DLLWSDPQPQDG-RSSSKRGVSCQFGPDVTRRFLEENGLDYIIRSHEVKPEGYEVSH 414          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Xenopus
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:NCBI gene;Acc:493275])

HSP 1 Score: 51.9878 bits (123), Expect = 1.039e-6
Identity = 22/44 (50.00%), Postives = 30/44 (68.18%), Query Frame = 1
Query:  652 KMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCH 783
            + ++ RG  C FGPDVT +FLE+N +  IIRSHE K  G++  H
Sbjct:  409 RSSSKRGVSCQFGPDVTRRFLEENGLDYIIRSHEVKPEGYEVSH 452          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Mouse
Match: Ppef2 (protein phosphatase, EF hand calcium-binding domain 2 [Source:MGI Symbol;Acc:MGI:1342304])

HSP 1 Score: 99.3673 bits (246), Expect = 5.333e-22
Identity = 42/73 (57.53%), Postives = 53/73 (72.60%), Query Frame = 1
Query:  580 ECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKQL 798
            E    EWKQV+++LWSDP    GCK N  RGGGCYFGPDVT + +EK  ++L+IRSHECK  G+++CH  K L
Sbjct:  436 EPTPEEWKQVVDILWSDPAAQEGCKANAVRGGGCYFGPDVTERLMEKYKLQLLIRSHECKPEGYEFCHNRKVL 508          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Mouse
Match: Ppef2 (protein phosphatase, EF hand calcium-binding domain 2 [Source:MGI Symbol;Acc:MGI:1342304])

HSP 1 Score: 99.3673 bits (246), Expect = 5.333e-22
Identity = 42/73 (57.53%), Postives = 53/73 (72.60%), Query Frame = 1
Query:  580 ECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKQL 798
            E    EWKQV+++LWSDP    GCK N  RGGGCYFGPDVT + +EK  ++L+IRSHECK  G+++CH  K L
Sbjct:  436 EPTPEEWKQVVDILWSDPAAQEGCKANAVRGGGCYFGPDVTERLMEKYKLQLLIRSHECKPEGYEFCHNRKVL 508          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Mouse
Match: Ppef1 (protein phosphatase with EF hand calcium-binding domain 1 [Source:MGI Symbol;Acc:MGI:1097157])

HSP 1 Score: 96.2857 bits (238), Expect = 4.228e-21
Identity = 39/66 (59.09%), Postives = 52/66 (78.79%), Query Frame = 1
Query:  595 EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK 792
            EW+Q++++LWSDPR   GC  NT RGGGCYFGPDVT + L KN +K++IRSHECK +G++  H+ K
Sbjct:  353 EWEQIVDILWSDPRGKKGCYPNTSRGGGCYFGPDVTSKVLSKNQLKMLIRSHECKPDGYEVSHDGK 418          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Mouse
Match: Ppp5c (protein phosphatase 5, catalytic subunit [Source:MGI Symbol;Acc:MGI:102666])

HSP 1 Score: 68.9366 bits (167), Expect = 3.236e-12
Identity = 37/76 (48.68%), Postives = 45/76 (59.21%), Query Frame = 1
Query:  613 NLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKQLRCVCNHR*VSKCPN 840
            +LLWSDP+P NG  ++  RG  C FGPDVT  FLE+N +  IIRSHE K  G++  H     RCV     V   PN
Sbjct:  383 DLLWSDPQPQNGRSVSK-RGVSCQFGPDVTKAFLEENQLDYIIRSHEVKAEGYEVAHGG---RCVT----VFSAPN 450          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Mouse
Match: Ppp5c (protein phosphatase 5, catalytic subunit [Source:MGI Symbol;Acc:MGI:102666])

HSP 1 Score: 68.5514 bits (166), Expect = 3.637e-12
Identity = 37/76 (48.68%), Postives = 45/76 (59.21%), Query Frame = 1
Query:  613 NLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKQLRCVCNHR*VSKCPN 840
            +LLWSDP+P NG  ++  RG  C FGPDVT  FLE+N +  IIRSHE K  G++  H     RCV     V   PN
Sbjct:  360 DLLWSDPQPQNGRSVSK-RGVSCQFGPDVTKAFLEENQLDYIIRSHEVKAEGYEVAHGG---RCVT----VFSAPN 427          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. UniProt/SwissProt
Match: sp|O14830|PPE2_HUMAN (Serine/threonine-protein phosphatase with EF-hands 2 OS=Homo sapiens OX=9606 GN=PPEF2 PE=1 SV=2)

HSP 1 Score: 101.293 bits (251), Expect = 7.642e-22
Identity = 44/84 (52.38%), Postives = 57/84 (67.86%), Query Frame = 1
Query:  547 SVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKQL 798
            S    E+  + +    EW+QV+++LWSDP    GCK NT RGGGCYFGPDVT Q L+K  M+ +IRSHECK  G+++CH  K L
Sbjct:  421 SEADSEAGELRKPTQEEWRQVVDILWSDPMAQEGCKANTIRGGGCYFGPDVTQQLLQKYNMQFLIRSHECKPEGYEFCHNRKVL 504          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. UniProt/SwissProt
Match: sp|Q3SWT6|PPE1_RAT (Serine/threonine-protein phosphatase with EF-hands 1 OS=Rattus norvegicus OX=10116 GN=Ppef1 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.208e-21
Identity = 41/66 (62.12%), Postives = 53/66 (80.30%), Query Frame = 1
Query:  595 EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK 792
            EW+Q+++LLWSDPR   GC  NT RGGGCYFGPDVT + L KN +K++IRSHECK +G++ CH+ K
Sbjct:  342 EWEQIIDLLWSDPRGKKGCYPNTSRGGGCYFGPDVTSKVLNKNQLKMVIRSHECKPDGYEICHDGK 407          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. UniProt/SwissProt
Match: sp|O35385|PPE2_MOUSE (Serine/threonine-protein phosphatase with EF-hands 2 OS=Mus musculus OX=10090 GN=Ppef2 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 3.731e-21
Identity = 42/73 (57.53%), Postives = 53/73 (72.60%), Query Frame = 1
Query:  580 ECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKQL 798
            E    EWKQV+++LWSDP    GCK N  RGGGCYFGPDVT + +EK  ++L+IRSHECK  G+++CH  K L
Sbjct:  436 EPTPEEWKQVVDILWSDPAAQEGCKANAVRGGGCYFGPDVTERLMEKYKLQLLIRSHECKPEGYEFCHNRKVL 508          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. UniProt/SwissProt
Match: sp|O35655|PPE1_MOUSE (Serine/threonine-protein phosphatase with EF-hands 1 OS=Mus musculus OX=10090 GN=Ppef1 PE=2 SV=2)

HSP 1 Score: 96.2857 bits (238), Expect = 2.958e-20
Identity = 39/66 (59.09%), Postives = 52/66 (78.79%), Query Frame = 1
Query:  595 EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK 792
            EW+Q++++LWSDPR   GC  NT RGGGCYFGPDVT + L KN +K++IRSHECK +G++  H+ K
Sbjct:  353 EWEQIVDILWSDPRGKKGCYPNTSRGGGCYFGPDVTSKVLSKNQLKMLIRSHECKPDGYEVSHDGK 418          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. UniProt/SwissProt
Match: sp|O14829|PPE1_HUMAN (Serine/threonine-protein phosphatase with EF-hands 1 OS=Homo sapiens OX=9606 GN=PPEF1 PE=1 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 6.243e-20
Identity = 40/66 (60.61%), Postives = 52/66 (78.79%), Query Frame = 1
Query:  595 EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK 792
            EW+Q++++LWSDPR  NGC  NT RGGGCYFGPDVT + L K  +K++IRSHECK  G++ CH+ K
Sbjct:  352 EWEQIIDILWSDPRGKNGCFPNTCRGGGCYFGPDVTSKILNKYQLKMLIRSHECKPEGYEICHDGK 417          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. TrEMBL
Match: G3VEN7 (Serine/threonine-protein phosphatase OS=Sarcophilus harrisii OX=9305 GN=PPEF1 PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.081e-23
Identity = 48/115 (41.74%), Postives = 67/115 (58.26%), Query Frame = 1
Query:  448 VVNKQLLHEYNLFKYTFRFHGIFCNLFTIIQFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK 792
            ++ K++ H+Y      F+   + C    ++  + + +YE           W Q++N+LWSDPR   GC  NT RGGGCYFGPDVT   L K  +K+IIRSHECK  G+D CH+ K
Sbjct:  297 IIPKEMKHDYKSQNEKFQRMNLTCRSPAMLAMEQLTKYE-----------WDQIVNILWSDPRSRKGCYPNTSRGGGCYFGPDVTENILTKFGLKMIIRSHECKPEGFDICHDGK 400          

HSP 2 Score: 39.2762 bits (90), Expect = 1.081e-23
Identity = 14/45 (31.11%), Postives = 30/45 (66.67%), Query Frame = 2
Query:  194 LIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREK 328
            ++ L  E ++ LP+ T++   + V+HGGI+ +TDL ++  ++R +
Sbjct:  247 ILHLLEEVYTWLPIGTLIDKKVLVIHGGIADNTDLTVLEQMKRNR 291          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. TrEMBL
Match: A0A2K5K5S8 (Serine/threonine-protein phosphatase OS=Colobus angolensis palliatus OX=336983 GN=PPEF1 PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.590e-23
Identity = 40/66 (60.61%), Postives = 52/66 (78.79%), Query Frame = 1
Query:  595 EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK 792
            EW+Q++++LWSDPR  NGC  NT RGGGCYFGPDVT + L K  +K++IRSHECK  G++ CH+ K
Sbjct:  351 EWEQIIDILWSDPRGKNGCFPNTGRGGGCYFGPDVTSKILNKYQLKMLIRSHECKPEGYEICHDGK 416          

HSP 2 Score: 43.1282 bits (100), Expect = 2.590e-23
Identity = 32/101 (31.68%), Postives = 52/101 (51.49%), Query Frame = 3
Query:  873 SGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKVMS*FHILGLIGKSI*KKISTLGEIDSRFDSNVEEMFHVLDSKYS 1175
            SG +S+ QW   M  I+ ++LPWR L      ++LV  D        N  ++Y    MS F  +  I K + +  STL E   R+ S++E +F+ +D+ +S
Sbjct:  451 SGKLSLSQWAFCMENILGLNLPWRSLS-----SNLVNID-------KNGNVEY----MSSFQNIH-IEKPVQEAHSTLVETLYRYRSDLEIIFNAIDTDHS 534          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. TrEMBL
Match: A0A1I8IY93 (Serine/threonine-protein phosphatase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 8.257e-23
Identity = 44/80 (55.00%), Postives = 62/80 (77.50%), Query Frame = 1
Query:  547 SVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHE 786
            S L+   ++  + +  EW+QVL+LLWSDP+P  GC+ NT+RGGGCYFGPDVT  FL KN + L++RSHECK +G+++CH+
Sbjct:  448 SALRPPGNDGEKVDYLEWRQVLDLLWSDPKPQAGCRPNTFRGGGCYFGPDVTESFLRKNKLTLLVRSHECKQDGYEFCHD 527          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. TrEMBL
Match: A0A1I8IXH3 (Serine/threonine-protein phosphatase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 9.117e-23
Identity = 45/84 (53.57%), Postives = 63/84 (75.00%), Query Frame = 1
Query:  547 SVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKQL 798
            S L+   ++  + +  EW+QVL+LLWSDP+P  GC+ NT+RGGGCYFGPDVT  FL KN + L++RSHECK +G+++CH+   L
Sbjct:  386 SALRPPGNDGEKVDYLEWRQVLDLLWSDPKPQAGCRPNTFRGGGCYFGPDVTESFLRKNKLTLLVRSHECKQDGYEFCHDGAVL 469          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. TrEMBL
Match: A0A1I8IWN3 (Serine/threonine-protein phosphatase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 1.090e-22
Identity = 45/84 (53.57%), Postives = 63/84 (75.00%), Query Frame = 1
Query:  547 SVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKQL 798
            S L+   ++  + +  EW+QVL+LLWSDP+P  GC+ NT+RGGGCYFGPDVT  FL KN + L++RSHECK +G+++CH+   L
Sbjct:  481 SALRPPGNDGEKVDYLEWRQVLDLLWSDPKPQAGCRPNTFRGGGCYFGPDVTESFLRKNKLTLLVRSHECKQDGYEFCHDGAVL 564          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Cavefish
Match: PPEF2 (protein phosphatase with EF-hand domain 2 [Source:HGNC Symbol;Acc:HGNC:9244])

HSP 1 Score: 99.3673 bits (246), Expect = 4.088e-22
Identity = 43/69 (62.32%), Postives = 55/69 (79.71%), Query Frame = 1
Query:  592 NEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKQL 798
            NEWKQ+L+LLWSDP   +GC  N  RGGGCY+GP+VT +FL K+ M+LIIRSHECK +G+++CH  K L
Sbjct:  440 NEWKQILDLLWSDPMIPDGCVPNEVRGGGCYWGPNVTEEFLNKHSMQLIIRSHECKQDGYEFCHNRKVL 508          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Cavefish
Match: ppef1 (serine/threonine-protein phosphatase with EF-hands 1 [Source:NCBI gene;Acc:103021363])

HSP 1 Score: 94.3597 bits (233), Expect = 1.588e-20
Identity = 37/63 (58.73%), Postives = 51/63 (80.95%), Query Frame = 1
Query:  595 EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCH 783
            EW+Q++++LWSDP+  NGC  N++RGGGCYFGPDVT   L+K+ + L+IRSHECK  G++ CH
Sbjct:  420 EWRQIVDVLWSDPKIQNGCSPNSFRGGGCYFGPDVTQNLLKKHGLCLLIRSHECKQEGYELCH 482          

HSP 2 Score: 48.9062 bits (115), Expect = 7.187e-6
Identity = 22/51 (43.14%), Postives = 35/51 (68.63%), Query Frame = 2
Query:  194 LIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKVCVLLK 346
            +++L  + FSLLP+AT++ N + +VHGGIS  TDL  +  + R+KV   L+
Sbjct:  266 ILQLLQDVFSLLPIATIIDNKVLIVHGGISDKTDLEFLASVERQKVKSALR 316          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Cavefish
Match: ppef1 (serine/threonine-protein phosphatase with EF-hands 1 [Source:NCBI gene;Acc:103021363])

HSP 1 Score: 94.3597 bits (233), Expect = 1.589e-20
Identity = 37/63 (58.73%), Postives = 51/63 (80.95%), Query Frame = 1
Query:  595 EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCH 783
            EW+Q++++LWSDP+  NGC  N++RGGGCYFGPDVT   L+K+ + L+IRSHECK  G++ CH
Sbjct:  431 EWRQIVDVLWSDPKIQNGCSPNSFRGGGCYFGPDVTQNLLKKHGLCLLIRSHECKQEGYELCH 493          

HSP 2 Score: 48.9062 bits (115), Expect = 7.349e-6
Identity = 22/51 (43.14%), Postives = 35/51 (68.63%), Query Frame = 2
Query:  194 LIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKVCVLLK 346
            +++L  + FSLLP+AT++ N + +VHGGIS  TDL  +  + R+KV   L+
Sbjct:  277 ILQLLQDVFSLLPIATIIDNKVLIVHGGISDKTDLEFLASVERQKVKSALR 327          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Cavefish
Match: ENSAMXT00000016118.2 (pep primary_assembly:Astyanax_mexicanus-2.0:14:38271079:38284894:-1 gene:ENSAMXG00000015666.2 transcript:ENSAMXT00000016118.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.5893 bits (231), Expect = 3.213e-20
Identity = 37/79 (46.84%), Postives = 57/79 (72.15%), Query Frame = 1
Query:  562 ESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKQL 798
            +S  + E +  EWKQ++++LWSDP   +GC  N  RGGGCY+GPD+T   L ++ ++L+IRSHECK +G+++CH  + L
Sbjct:  392 DSGEVLETDAEEWKQIVDMLWSDPMSQDGCIPNEVRGGGCYWGPDITEDVLNRHNLRLLIRSHECKQDGYEFCHNRRVL 470          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Cavefish
Match: ppp5c (protein phosphatase 5 catalytic subunit [Source:NCBI gene;Acc:103034548])

HSP 1 Score: 70.0922 bits (170), Expect = 9.874e-13
Identity = 31/60 (51.67%), Postives = 42/60 (70.00%), Query Frame = 1
Query:  613 NLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK 792
            +LLWSDP+P NG  ++  RG  C FGPDVT +FLE+N ++ I+RSHE K  G++  H  K
Sbjct:  376 DLLWSDPQPQNGRSISK-RGVSCQFGPDVTQRFLEQNKLQYIVRSHEVKAEGYEVTHSGK 434          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Sea Lamprey
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-050327-75])

HSP 1 Score: 63.5438 bits (153), Expect = 2.673e-11
Identity = 35/76 (46.05%), Postives = 48/76 (63.16%), Query Frame = 1
Query:  613 NLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKQLRCVCNHR*VSKCPN 840
            +LLWSDP+P  G  ++  RG  C FGPDV+  F+E+N ++LIIRSHE K +G++  H+    RCV     V   PN
Sbjct:  345 DLLWSDPQPQPGRSVSK-RGVSCQFGPDVSRAFMEQNNLELIIRSHE-KPDGYEVAHDG---RCVT----VFSAPN 411          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Yeast
Match: PPT1 (Protein serine/threonine phosphatase; regulates Hsp90 chaperone by affecting its ATPase and cochaperone binding activities; has similarity to human phosphatase PP5; present in both the nucleus and cytoplasm; expressed during logarithmic growth [Source:SGD;Acc:S000003355])

HSP 1 Score: 54.299 bits (129), Expect = 1.652e-8
Identity = 26/61 (42.62%), Postives = 37/61 (60.66%), Query Frame = 1
Query:  610 LNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK 792
            + LLW+DP+  NG    + RG G  FGPD+T +FL  N ++ I RSHE +M G  +  + K
Sbjct:  389 MELLWADPQEANGMGP-SQRGLGHAFGPDITDRFLRNNKLRKIFRSHELRMGGVQFEQKGK 448          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Yeast
Match: PPH21 (Catalytic subunit of protein phosphatase 2A (PP2A); functionally redundant with Pph22p; methylated at C terminus; forms alternate complexes with several regulatory subunits; involved in signal transduction and regulation of mitosis; forms nuclear foci upon DNA replication stress; PPH21 has a paralog, PPH22, that arose from the whole genome duplication [Source:SGD;Acc:S000002292])

HSP 1 Score: 48.521 bits (114), Expect = 8.318e-7
Identity = 24/58 (41.38%), Postives = 34/58 (58.62%), Query Frame = 1
Query:  613 NLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHE 786
            +LLWSDP    G  ++  RG G  FG DV+ QF   N + LI R+H+  M G+ + H+
Sbjct:  257 DLLWSDPDDRGGWGISP-RGAGFTFGQDVSEQFNHTNDLSLIARAHQLVMEGYAWSHQ 313          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Yeast
Match: PPH22 (Catalytic subunit of protein phosphatase 2A (PP2A); functionally redundant with Pph21p; methylated at C terminus; forms alternate complexes with several regulatory subunits; involved in signal transduction and regulation of mitosis; protein abundance increases in response to DNA replication stress; dephosphorylates Tel1p/Mec1p-phosphorylated Cdc13p to promote telomerase release from telomeres at G2/M; PPH22 has a paralog, PPH21, that arose from the whole genome duplication [Source:SGD;Acc:S000002347])

HSP 1 Score: 48.521 bits (114), Expect = 9.934e-7
Identity = 23/58 (39.66%), Postives = 34/58 (58.62%), Query Frame = 1
Query:  613 NLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHE 786
            +LLWSDP    G  ++  RG G  FG D++ QF   N + LI R+H+  M G+ + H+
Sbjct:  265 DLLWSDPDDRGGWGISP-RGAGFTFGQDISEQFNHTNDLSLIARAHQLVMEGYSWSHQ 321          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Yeast
Match: PPH3 (Catalytic subunit of protein phosphatase PP4 complex; Pph3p and Psy2p form active complex, Psy4p may provide substrate specificity; regulates recovery from the DNA damage checkpoint, the gene conversion- and single-strand annealing-mediated pathways of meiotic double-strand break repair and efficient Non-Homologous End-Joining (NHEJ) pathway; involved in activation of Gln3p to alleviate nitrogen catabolite repression; Pph3p and Psy2p localize to foci on meiotic chromosomes [Source:SGD;Acc:S000002482])

HSP 1 Score: 46.595 bits (109), Expect = 3.289e-6
Identity = 26/88 (29.55%), Postives = 48/88 (54.55%), Query Frame = 1
Query:  508 GIFCNLFTIIQFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGW 771
            G+  ++ T+ + +++ + +       E+     + +LLWSDP  ++   ++  RG G  FG     QFLEKN ++LI R+H+  M G+
Sbjct:  163 GLSPDMTTVDEIRTIDRKQ-------EVPHEGAMCDLLWSDPEDVDTWSLSP-RGAGFLFGKREVDQFLEKNNVELIARAHQLVMEGY 242          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Yeast
Match: GLC7 (Type 1 S/T protein phosphatase (PP1) catalytic subunit; involved in glycogen metabolism, sporulation and mitotic progression; interacts with multiple regulatory subunits; regulates actomyosin ring formation; subunit of CPF; recruited to mating projections by Afr1p interaction; regulates nucleocytoplasmic shuttling of Hxk2p; import into the nucleus is inhibited during spindle assembly checkpoint arrest; involved in dephosphorylating Rps6a/b and Bnr1p [Source:SGD;Acc:S000000935])

HSP 1 Score: 45.8246 bits (107), Expect = 5.032e-6
Identity = 26/69 (37.68%), Postives = 41/69 (59.42%), Query Frame = 1
Query:  574 MNECEINEWKQVLNLLWSDP-RPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDY 777
            M   +I +   + +LLWSDP + + G   N  RG    FGPDV  +FL+K  M+LI R+H+   +G+++
Sbjct:  189 MRPTDIPDVGLLCDLLWSDPDKDIVGWSEND-RGVSFTFGPDVVNRFLQKQDMELICRAHQVVEDGYEF 256          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Nematostella
Match: EDO47034 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RNB7])

HSP 1 Score: 107.071 bits (266), Expect = 2.903e-25
Identity = 45/75 (60.00%), Postives = 57/75 (76.00%), Query Frame = 1
Query:  568 DNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK 792
            DN +   + EW+QVL+LLWSDP+P  GCK NT+RGGGCYFGPDVT Q L K+  +L++RSHECK  G++Y H  K
Sbjct:  341 DNPSLSSLKEWRQVLDLLWSDPKPTPGCKPNTFRGGGCYFGPDVTSQVLRKHNFELLVRSHECKYEGYEYMHNKK 415          

HSP 2 Score: 52.7582 bits (125), Expect = 1.780e-7
Identity = 25/51 (49.02%), Postives = 34/51 (66.67%), Query Frame = 2
Query:  194 LIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKVCVLLK 346
            +I+LF + F  LPLAT++ N +FV HGGIS  TDL +I  + R K   +LK
Sbjct:  284 IIRLFEDIFGWLPLATIVNNKIFVAHGGISNITDLDIIERIDRHKYVSVLK 334          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Nematostella
Match: EDO29151 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4G2])

HSP 1 Score: 47.7506 bits (112), Expect = 8.849e-7
Identity = 23/60 (38.33%), Postives = 37/60 (61.67%), Query Frame = 1
Query:  613 NLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK 792
            +L+WSDP  ++   ++  RG G  FGP VT +F+  N +KLI R+H+    G+ Y  ++K
Sbjct:   34 DLVWSDPEEVDTWAISP-RGAGWLFGPKVTQEFVNINNLKLICRAHQLVHEGYKYMFDEK 92          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Nematostella
Match: EDO29759 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7T2Q5])

HSP 1 Score: 49.6766 bits (117), Expect = 1.012e-6
Identity = 23/58 (39.66%), Postives = 35/58 (60.34%), Query Frame = 1
Query:  613 NLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHE 786
            +LLWSDP    G  ++  RG G  FG D++  F   N + LI R+H+  M G+++CH+
Sbjct:  198 DLLWSDPDDRGGWGISP-RGAGYTFGQDISETFNHTNGLTLITRAHQLVMEGYNWCHD 254          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Nematostella
Match: EDO49936 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RFC7])

HSP 1 Score: 46.9802 bits (110), Expect = 6.509e-6
Identity = 27/88 (30.68%), Postives = 46/88 (52.27%), Query Frame = 1
Query:  508 GIFCNLFTIIQFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGW 771
            G+  ++ T+ Q +S+ + +       E+     + +LLWSDP  + G  ++  RG G  FG DV  Q+   N + LI R+H+  M G+
Sbjct:  166 GLSPSISTLDQIRSIDRKQ-------EVPHDGPMCDLLWSDPEDIQGWGVSP-RGAGYLFGSDVVAQYNAANDIDLICRAHQLVMEGY 245          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Medaka
Match: ENSORLT00000036394.1 (serine/threonine-protein phosphatase with EF-hands 2-like [Source:NCBI gene;Acc:101171918])

HSP 1 Score: 102.834 bits (255), Expect = 2.833e-23
Identity = 47/84 (55.95%), Postives = 59/84 (70.24%), Query Frame = 1
Query:  547 SVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKQL 798
            S     SDN NE    EW+Q+L+LLWSDP   NGCK N  RGGGCY+GPD+T  FL ++ M+LIIRSHECK  G+++CH  + L
Sbjct:  407 STDSVRSDNSNE----EWRQILDLLWSDPMTQNGCKPNEVRGGGCYWGPDITEDFLNRHNMQLIIRSHECKQEGYEFCHNRRVL 486          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Medaka
Match: ENSORLT00000000429.2 (serine/threonine-protein phosphatase with EF-hands 2-like [Source:NCBI gene;Acc:101171918])

HSP 1 Score: 102.449 bits (254), Expect = 2.996e-23
Identity = 47/84 (55.95%), Postives = 59/84 (70.24%), Query Frame = 1
Query:  547 SVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKQL 798
            S     SDN NE    EW+Q+L+LLWSDP   NGCK N  RGGGCY+GPD+T  FL ++ M+LIIRSHECK  G+++CH  + L
Sbjct:  370 STDSVRSDNSNE----EWRQILDLLWSDPMTQNGCKPNEVRGGGCYWGPDITEDFLNRHNMQLIIRSHECKQEGYEFCHNRRVL 449          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Medaka
Match: ENSORLT00000039311.1 (serine/threonine-protein phosphatase with EF-hands 2-like [Source:NCBI gene;Acc:101171918])

HSP 1 Score: 102.449 bits (254), Expect = 4.200e-23
Identity = 47/84 (55.95%), Postives = 59/84 (70.24%), Query Frame = 1
Query:  547 SVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKQL 798
            S     SDN NE    EW+Q+L+LLWSDP   NGCK N  RGGGCY+GPD+T  FL ++ M+LIIRSHECK  G+++CH  + L
Sbjct:  407 STDSVRSDNSNE----EWRQILDLLWSDPMTQNGCKPNEVRGGGCYWGPDITEDFLNRHNMQLIIRSHECKQEGYEFCHNRRVL 486          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Medaka
Match: PPEF2 (serine/threonine-protein phosphatase with EF-hands 2 [Source:NCBI gene;Acc:101170112])

HSP 1 Score: 96.6709 bits (239), Expect = 2.547e-21
Identity = 39/68 (57.35%), Postives = 54/68 (79.41%), Query Frame = 1
Query:  595 EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKQL 798
            +WKQ++NLLWSDP P NGC  N  RGGGCY+GPDVT + L ++ ++L+IRSHECK +G+++CH  + L
Sbjct:  424 DWKQIVNLLWSDPMPQNGCISNEVRGGGCYWGPDVTEEVLGRHNLQLLIRSHECKQDGYEFCHNRRVL 491          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Medaka
Match: ppef1 (protein phosphatase with EF-hand domain 1 [Source:NCBI gene;Acc:101174574])

HSP 1 Score: 92.4337 bits (228), Expect = 6.791e-20
Identity = 36/67 (53.73%), Postives = 51/67 (76.12%), Query Frame = 1
Query:  592 NEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK 792
             EWKQ++++LWSDP+   GC  N +RGGGCYFGPDVT + L ++ ++++IRSHECK  G++ CH  K
Sbjct:  439 QEWKQIVDILWSDPKTQEGCSPNLFRGGGCYFGPDVTQKLLLQHGLQMLIRSHECKQEGYEICHGGK 505          

HSP 2 Score: 50.447 bits (119), Expect = 2.304e-6
Identity = 22/46 (47.83%), Postives = 34/46 (73.91%), Query Frame = 2
Query:  194 LIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKV 331
            +++LF + FSLLP+ATV+   + +VHGGIS  TDL ++  ++R KV
Sbjct:  275 ILQLFQDVFSLLPIATVIDGKVLIVHGGISDQTDLNLLSSIKRHKV 320          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Planmine SMEST
Match: SMESG000003989.1 (SMESG000003989.1)

HSP 1 Score: 190.274 bits (482), Expect = 8.963e-103
Identity = 88/98 (89.80%), Postives = 90/98 (91.84%), Query Frame = 1
Query:  505 HGIFCNLFTIIQFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKQL 798
            +G F  L    +FKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK L
Sbjct:  323 YGFFKELNNKYKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVL 420          

HSP 2 Score: 164.851 bits (416), Expect = 8.963e-103
Identity = 83/101 (82.18%), Postives = 84/101 (83.17%), Query Frame = 3
Query:  873 SGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKVMS*FHILGLIGKSI*KKISTLGEIDSRFDSNVEEMFHVLDSKYS 1175
            SGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTN                 KKIS+LGEIDSRFDSNVEEMFHVLDSKYS
Sbjct:  498 SGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTN-----------------KKISSLGEIDSRFDSNVEEMFHVLDSKYS 581          

HSP 3 Score: 60.077 bits (144), Expect = 8.963e-103
Identity = 28/28 (100.00%), Postives = 28/28 (100.00%), Query Frame = 2
Query:  794 NYGAFAIIDKSANVRITQYKSQEGVDFR 877
            NYGAFAIIDKSANVRITQYKSQEGVDFR
Sbjct:  434 NYGAFAIIDKSANVRITQYKSQEGVDFR 461          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Planmine SMEST
Match: SMESG000003989.1 (SMESG000003989.1)

HSP 1 Score: 189.889 bits (481), Expect = 3.140e-94
Identity = 88/98 (89.80%), Postives = 90/98 (91.84%), Query Frame = 1
Query:  505 HGIFCNLFTIIQFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKQL 798
            +G F  L    +FKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK L
Sbjct:  323 YGFFKELNNKYKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVL 420          

HSP 2 Score: 134.806 bits (338), Expect = 3.140e-94
Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 2
Query:  794 NYGAFAIIDKSANVRITQYKSQEGVDFRSYIHWSMGYCYVDDHEYGSPLETAQMVSHPYQP 976
            NYGAFAIIDKSANVRITQYKSQEGVDFRSYIHWSMGYCYVDDHEYGSPLETAQMVSHPYQP
Sbjct:  434 NYGAFAIIDKSANVRITQYKSQEGVDFRSYIHWSMGYCYVDDHEYGSPLETAQMVSHPYQP 494          

HSP 3 Score: 62.003 bits (149), Expect = 3.140e-94
Identity = 34/52 (65.38%), Postives = 35/52 (67.31%), Query Frame = 3
Query: 1020 EIQYTNKVMS*FHILGLIGKSI*KKISTLGEIDSRFDSNVEEMFHVLDSKYS 1175
            EIQYTNK                 KIS+LGEIDSRFDSNVEEMFHVLDSKYS
Sbjct:  495 EIQYTNK-----------------KISSLGEIDSRFDSNVEEMFHVLDSKYS 529          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Planmine SMEST
Match: SMESG000042202.1 (SMESG000042202.1)

HSP 1 Score: 107.842 bits (268), Expect = 3.997e-25
Identity = 48/86 (55.81%), Postives = 66/86 (76.74%), Query Frame = 1
Query:  538 QFKSVLQYESDNM-NECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK 792
            +F SVLQ   +++ NE +  EW Q+L+LLWSDPR   GC +N YRGGGCYFGPD+T   L+K  + L+IRSHECK++G+++CHE+K
Sbjct:  347 KFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENK 432          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Planmine SMEST
Match: SMESG000042202.1 (SMESG000042202.1)

HSP 1 Score: 107.457 bits (267), Expect = 4.227e-25
Identity = 48/86 (55.81%), Postives = 66/86 (76.74%), Query Frame = 1
Query:  538 QFKSVLQYESDNM-NECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK 792
            +F SVLQ   +++ NE +  EW Q+L+LLWSDPR   GC +N YRGGGCYFGPD+T   L+K  + L+IRSHECK++G+++CHE+K
Sbjct:  321 KFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENK 406          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Planmine SMEST
Match: SMESG000076282.1 (SMESG000076282.1)

HSP 1 Score: 105.531 bits (262), Expect = 1.989e-24
Identity = 48/87 (55.17%), Postives = 65/87 (74.71%), Query Frame = 1
Query:  538 QFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKQL 798
            ++ S L   SD+  E +  EW QVL++LWSDP+P  GC+ N +RGGGCYFGPD+T QFLEK   +L+IRSHECK  G+++CH+D+ L
Sbjct:  319 KYISALNCPSDS--ELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVL 403          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPEF28.208e-2354.43protein phosphatase with EF-hand domain 2 [Source:... [more]
PPEF21.591e-2252.38protein phosphatase with EF-hand domain 2 [Source:... [more]
PPEF11.300e-2060.61protein phosphatase with EF-hand domain 1 [Source:... [more]
PPP5C4.012e-1248.68protein phosphatase 5 catalytic subunit [Source:HG... [more]
PPP5C4.049e-1248.68protein phosphatase 5 catalytic subunit [Source:HG... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pef-11.055e-1946.07Serine/threonine-protein phosphatase with EF-hands... [more]
pef-11.193e-1946.07Serine/threonine-protein phosphatase with EF-hands... [more]
pef-11.220e-1946.07Serine/threonine-protein phosphatase with EF-hands... [more]
pph-56.617e-1249.12Serine/threonine-protein phosphatase 5 [Source:Un... [more]
pph-56.254e-1149.12Serine/threonine-protein phosphatase 5 [Source:Un... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rdgC1.115e-1741.18gene:FBgn0265959 transcript:FBtr0473730[more]
rdgC1.180e-1741.18gene:FBgn0265959 transcript:FBtr0342946[more]
rdgC1.355e-1741.18gene:FBgn0265959 transcript:FBtr0342949[more]
rdgC1.355e-1741.18gene:FBgn0265959 transcript:FBtr0342947[more]
rdgC1.355e-1741.18gene:FBgn0265959 transcript:FBtr0342948[more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppef11.133e-2060.32protein phosphatase, EF-hand calcium binding domai... [more]
ppef11.133e-2060.32protein phosphatase, EF-hand calcium binding domai... [more]
ppef11.220e-2060.32protein phosphatase, EF-hand calcium binding domai... [more]
CU695117.12.337e-2056.72protein phosphatase with EF-hand domain 2a [Source... [more]
ppp5c4.231e-1150.00protein phosphatase 5, catalytic subunit [Source:Z... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPEF22.166e-2456.79protein phosphatase, EF-hand calcium binding domai... [more]
usp433.701e-2160.61ubiquitin specific peptidase 43 [Source:Xenbase;Ac... [more]
ppp5c7.532e-1252.63protein phosphatase 5, catalytic subunit [Source:N... [more]
ppp5c1.804e-1152.63protein phosphatase 5, catalytic subunit [Source:N... [more]
ppp5c1.039e-650.00protein phosphatase 5, catalytic subunit [Source:N... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppef25.333e-2257.53protein phosphatase, EF hand calcium-binding domai... [more]
Ppef25.333e-2257.53protein phosphatase, EF hand calcium-binding domai... [more]
Ppef14.228e-2159.09protein phosphatase with EF hand calcium-binding d... [more]
Ppp5c3.236e-1248.68protein phosphatase 5, catalytic subunit [Source:M... [more]
Ppp5c3.637e-1248.68protein phosphatase 5, catalytic subunit [Source:M... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O14830|PPE2_HUMAN7.642e-2252.38Serine/threonine-protein phosphatase with EF-hands... [more]
sp|Q3SWT6|PPE1_RAT1.208e-2162.12Serine/threonine-protein phosphatase with EF-hands... [more]
sp|O35385|PPE2_MOUSE3.731e-2157.53Serine/threonine-protein phosphatase with EF-hands... [more]
sp|O35655|PPE1_MOUSE2.958e-2059.09Serine/threonine-protein phosphatase with EF-hands... [more]
sp|O14829|PPE1_HUMAN6.243e-2060.61Serine/threonine-protein phosphatase with EF-hands... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G3VEN71.081e-2341.74Serine/threonine-protein phosphatase OS=Sarcophilu... [more]
A0A2K5K5S82.590e-2360.61Serine/threonine-protein phosphatase OS=Colobus an... [more]
A0A1I8IY938.257e-2355.00Serine/threonine-protein phosphatase OS=Macrostomu... [more]
A0A1I8IXH39.117e-2353.57Serine/threonine-protein phosphatase OS=Macrostomu... [more]
A0A1I8IWN31.090e-2253.57Serine/threonine-protein phosphatase OS=Macrostomu... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPEF24.088e-2262.32protein phosphatase with EF-hand domain 2 [Source:... [more]
ppef11.588e-2058.73serine/threonine-protein phosphatase with EF-hands... [more]
ppef11.589e-2058.73serine/threonine-protein phosphatase with EF-hands... [more]
ENSAMXT00000016118.23.213e-2046.84pep primary_assembly:Astyanax_mexicanus-2.0:14:382... [more]
ppp5c9.874e-1351.67protein phosphatase 5 catalytic subunit [Source:NC... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ppp5c2.673e-1146.05protein phosphatase 5, catalytic subunit [Source:Z... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PPT11.652e-842.62Protein serine/threonine phosphatase; regulates Hs... [more]
PPH218.318e-741.38Catalytic subunit of protein phosphatase 2A (PP2A)... [more]
PPH229.934e-739.66Catalytic subunit of protein phosphatase 2A (PP2A)... [more]
PPH33.289e-629.55Catalytic subunit of protein phosphatase PP4 compl... [more]
GLC75.032e-637.68Type 1 S/T protein phosphatase (PP1) catalytic sub... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO470342.903e-2560.00Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO291518.849e-738.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297591.012e-639.66Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO499366.509e-630.68Serine/threonine-protein phosphatase [Source:UniP... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000036394.12.833e-2355.95serine/threonine-protein phosphatase with EF-hands... [more]
ENSORLT00000000429.22.996e-2355.95serine/threonine-protein phosphatase with EF-hands... [more]
ENSORLT00000039311.14.200e-2355.95serine/threonine-protein phosphatase with EF-hands... [more]
PPEF22.547e-2157.35serine/threonine-protein phosphatase with EF-hands... [more]
ppef16.791e-2053.73protein phosphatase with EF-hand domain 1 [Source:... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003989.18.963e-10389.80SMESG000003989.1[more]
SMESG000003989.13.140e-9489.80SMESG000003989.1[more]
SMESG000042202.13.997e-2555.81SMESG000042202.1[more]
SMESG000042202.14.227e-2555.81SMESG000042202.1[more]
SMESG000076282.11.989e-2455.17SMESG000076282.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019620 ID=SMED30019620|Name=Serine/threonine-protein phosphatase with EF-hands|organism=Schmidtea mediterranea sexual|type=transcript|length=1175bp
TGATGAAAATAATTTCGCGAAACATATTTTGTTTATTTGACTTCCTCGTG
TCTTTCATTATTAATATCATCATCATCATCTTCGTTATTTTTATCATTAT
TATTATTTTTATTGTGTTAGTTAATTAATGTTAGTTAAATAAGTTAATAA
TAACAACAAAAATGTTTCATAAATGTAGGAAATTTCTGAAATTCTTATCA
AATTATTTACTGAAACATTTTCGCTTCTTCCATTGGCAACTGTTTTGAGA
AATTCCATGTTTGTTGTCCACGGCGGAATCTCTCTCGACACAGACCTCGC
CATGATAAGAATTTTGCGTCGCGAGAAAGTTTGTGTTTTATTAAAAGATG
CATGAGGTGATGGGTGAGCGTTTTGAGTCTGCCCTGTATACATTGTAATA
CACACACATTTTCGTACATACATTTACACTGTAAAATGCATCCATTTGTT
GTGAATAAGCAATTATTGCATGAATATAATCTGTTCAAATATACATTTCG
TTTCCATGGAATTTTTTGTAATTTGTTCACCATTATCCAGTTCAAATCAG
TGCTACAATACGAGTCCGATAATATGAATGAGTGTGAGATCAACGAATGG
AAACAGGTCCTCAATTTGTTATGGAGTGACCCAAGGCCTCTAAATGGCTG
CAAGATGAATACATATCGCGGTGGCGGATGCTATTTTGGTCCAGATGTGA
CACTTCAATTTCTGGAGAAAAATTTTATGAAATTGATAATTCGTTCTCAT
GAATGCAAAATGAACGGATGGGATTATTGTCATGAAGATAAACAATTACG
GTGCGTTTGCAATCATCGATAAGTCAGCAAATGTCCGAATAACTCAGTAT
AAAAGTCAAGAAGGTGTTGATTTCAGGAGTTATATCCATTGGTCAATGGG
TTACTGCTATGTCGACGATCATGAATATGGATCTCCCTTGGAGACAGCTC
AAATGGTATCTCATCCCTACCAGCCTGGTGGAAACTGATGTCCCTTATCT
GACCATGATTAATAATGCAGAAATTCAGTACACTAATAAGGTAATGTCAT
AATTTCATATTCTGGGATTAATTGGGAAATCTATCTGAAAGAAAATTTCT
ACACTTGGAGAAATTGATTCTAGATTTGACTCAAATGTTGAGGAAATGTT
TCATGTTCTGGATTCCAAATATTCG
back to top

protein sequence of SMED30019620-orf-1

>SMED30019620-orf-1 ID=SMED30019620-orf-1|Name=SMED30019620-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=101bp
MYVRKCVCITMYTGQTQNAHPSPHASFNKTQTFSRRKILIMARSVSREIP
PWTTNMEFLKTVANGRSENVSVNNLIRISEISYIYETFLLLLLTYLTNIN
*
back to top

protein sequence of SMED30019620-orf-2

>SMED30019620-orf-2 ID=SMED30019620-orf-2|Name=SMED30019620-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=129bp
MHPFVVNKQLLHEYNLFKYTFRFHGIFCNLFTIIQFKSVLQYESDNMNEC
EINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKL
IIRSHECKMNGWDYCHEDKQLRCVCNHR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005506iron ion binding
GO:0030145manganese ion binding
GO:0046872metal ion binding
GO:0004721phosphoprotein phosphatase activity
GO:0005509calcium ion binding
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0050906detection of stimulus involved in sensory perception
GO:0006470protein dephosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR029052Metallo-depent_PP-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029052Metallo-dependent phosphatase-likeGENE3DG3DSA:3.60.21.10coord: 1..80
e-value: 1.2E-21
score: 78.6
NoneNo IPR availablePANTHERPTHR45668FAMILY NOT NAMEDcoord: 3..74
NoneNo IPR availablePANTHERPTHR45668:SF3SERINE/THREONINE-PROTEIN PHOSPHATASE RDGCcoord: 3..74
NoneNo IPR availableSUPERFAMILYSSF56300Metallo-dependent phosphatasescoord: 4..76