G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30019613
Length (bp)1406
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30019613) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30019613) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30019613) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30019613) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019613

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30019613SMESG000051173.1 SmedASXL_023991SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermal cellSMED30019613SMESG000051173.1 dd_Smed_v4_27197_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30019613SMESG000051173.1 dd_Smed_v6_27197_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-19 (FMRFamide Peptide Receptor family [Source:UniProtKB/TrEMBL;Acc:U4PC84])

HSP 1 Score: 77.0258 bits (188), Expect = 4.350e-15
Identity = 61/240 (25.42%), Postives = 125/240 (52.08%), Query Frame = 2
Query:  365 LYPLCLVSQTSAIYIIVGFTIERFIVIRYPLKNXXXX-XXXXXXXXXXXXXXXXXYNIPRMIEQVEIKICIN------MTS-KKIMLKDHILYKKIYFTYLYPIVMFILPFIVLLILNSCLLHTIKKSWKNHFHNTKGINSNLSTSSSQPNRRVTIQTSKETNLNVMIVGVVFTFLICQFLPMIDNIIIHYYGYPHTLEYYIFYTISSLFVVLNSAVNFLLYCFIGKKFRHVL-IYIYCN 1057
            +Y L + +QT ++++ VG ++ R+I + +P K++     K+    ++ ++  S+I+N  R  E     +C        M S +   L+ + LY++I+F + Y IVM+++PF +L+ LNS +L  +++S + H  +  G  S   +  ++          KE   ++M++ +V  F+ C  L  + N I+   G    + Y    T ++L V++N++ N  +Y     K+R +L  Y++C+
Sbjct:  145 MYGLMMTAQTCSVFMTVGVSVHRYIGVCHPYKSVEWLPKKRVTTFIIGLLTFSVIFNTTRFFEVHISNVCYRENIDYYMPSLQPTALRMNDLYRQIFFGWAYTIVMYVVPFTLLIALNSMVLSAVRRSRRMHMVSQCGAESEEFSKKAE---------RKERQTSIMLISIVLLFIACNTLAFVCN-IMENMGTEGAI-YQTLVTFNNLLVIINASCNICVYMLFSGKYRMLLRYYLFCD 373          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-19 (FMRFamide Peptide Receptor family [Source:UniProtKB/TrEMBL;Acc:U4PC84])

HSP 1 Score: 77.0258 bits (188), Expect = 4.983e-15
Identity = 61/240 (25.42%), Postives = 125/240 (52.08%), Query Frame = 2
Query:  365 LYPLCLVSQTSAIYIIVGFTIERFIVIRYPLKNXXXX-XXXXXXXXXXXXXXXXXYNIPRMIEQVEIKICIN------MTS-KKIMLKDHILYKKIYFTYLYPIVMFILPFIVLLILNSCLLHTIKKSWKNHFHNTKGINSNLSTSSSQPNRRVTIQTSKETNLNVMIVGVVFTFLICQFLPMIDNIIIHYYGYPHTLEYYIFYTISSLFVVLNSAVNFLLYCFIGKKFRHVL-IYIYCN 1057
            +Y L + +QT ++++ VG ++ R+I + +P K++     K+    ++ ++  S+I+N  R  E     +C        M S +   L+ + LY++I+F + Y IVM+++PF +L+ LNS +L  +++S + H  +  G  S   +  ++          KE   ++M++ +V  F+ C  L  + N I+   G    + Y    T ++L V++N++ N  +Y     K+R +L  Y++C+
Sbjct:  145 MYGLMMTAQTCSVFMTVGVSVHRYIGVCHPYKSVEWLPKKRVTTFIIGLLTFSVIFNTTRFFEVHISNVCYRENIDYYMPSLQPTALRMNDLYRQIFFGWAYTIVMYVVPFTLLIALNSMVLSAVRRSRRMHMVSQCGAESEEFSKKAE---------RKERQTSIMLISIVLLFIACNTLAFVCN-IMENMGTEGAI-YQTLVTFNNLLVIINASCNICVYMLFSGKYRMLLRYYLFCD 373          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-8 (FMRFamide Peptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q20686])

HSP 1 Score: 72.0182 bits (175), Expect = 2.037e-13
Identity = 52/231 (22.51%), Postives = 106/231 (45.89%), Query Frame = 2
Query:  371 PLCLVSQTSAIYIIVGFTIERFIVIRYPLKNXXXXXXXXXXXXXXXXXXXXXYNIPRMIEQVEIKICINMTSKKIMLKDHILYKKIYFTYLYPIVMFILPFIVLLILNSCLLHTIKKSWKNHFHNTKGINSNLSTSSSQPNRRVTIQTSKETNLNVMIVGVVFTFLICQFLPMIDNIIIHYYGYPHTLEYYIFYTISSLFVVLNSAVNFLLYCFIGKKFRHVLIYIYCNRN 1063
            P+  ++Q  +++  V  T++RF+ + YPL +      +    ++I +    I     M  ++    C  +  +   L+D+  YK+ Y T+ Y I + ++P+ V++ILN  ++  + K++K       G N+               Q  K+    +M + +V TFLI   +  ++N+    +     +    +  I +L + LNSA N ++Y   G +FR + + + C R 
Sbjct:  129 PISNIAQCGSVWTCVAVTVDRFLAVNYPLHSKIWCTPRRATTILIAITVFSILFKAPMFFELTNDDCGRL--RTSFLRDNKYYKEYYVTFGYLIALLLIPWTVMIILNVFVVKAVHKAYKIRRSMQGGKNN---------------QEEKDRRCTLMAIAMVLTFLIFNVVAAVNNLAETVF----EVSLGFWSPIGNLLICLNSASNIVIYSLFGARFRQMCVLMLCGRQ 338          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: daf-37 (G-protein coupled receptor daf-37 [Source:UniProtKB/Swiss-Prot;Acc:Q18321])

HSP 1 Score: 71.633 bits (174), Expect = 3.430e-13
Identity = 85/337 (25.22%), Postives = 166/337 (49.26%), Query Frame = 2
Query:  122 LEIFQFAVFGIMGCLICILGFIGNILTLTVLGNSAMRRLNSSXXXXXXXXXXXXXXXXXXXXXXXPMLKPGFRRQELNDYLLY-----PLCLVSQTSAIYIIVGFTIERFIVIRYPLKNXXX-XXXXXXXXXXXXXXXXXXYNIPRMIE-QVEIK-ICINMTSKKI------MLKDHILYKKIYFTYLYPIVMFILPFIVLLILNSCLLHTIKKSWKNH-FHNTKGINSNLSTSSSQP-------NRRVTIQTSKETNLNVMIVGVVFTFLICQFLPMIDNIIIHYYGYPHTL-EYYIFYTIS----SLFVVLNSAVNFLLYCFIGKKFRHVLIYIY 1051
            LE+ +F +  ++G LI + G  GN  T  +L   +MR  N+            L++  FF+     +++          +L Y      L  +SQT ++YI V  TIER++ + +P  + ++     +   ++ +   ++++N  +  E QV +   C + ++ +        +  + +Y+++Y  ++   VM   PF+ LL+ N+ + +TI++S + + FHN K + + LS S + P       +R    + S+E  L ++I+  VF FL C F   +  ++    G    + E++IFYT S    +   ++NS++NF++Y   GK FR  L+ +Y
Sbjct:   29 LEV-KFFLISVVGTLIGLFGLFGNATTALILTRPSMRNPNNLFLTALAVFDSCLLITAFFIYAMEYIIEYTAAFDLYVAWLTYLRFAFALSHISQTGSVYITVAVTIERYLAVCHPKSSKNMCGPGGAAWTILGVTTFAVVFNCTKFFELQVTVNPSCPDGSNWQSYILLPSAMASNPIYQQVYSLWVTNFVMVFFPFLTLLLFNAIIAYTIRQSLEKYDFHNQKSVVAALSASVNLPRNIAGISSRNELKEKSREATLVLVII--VFIFLGCNFWGFVLTLLERIMGQETLMVEHHIFYTFSREAINFLAIINSSINFVIYLLFGKDFRKELVVVY 362          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-10 (FMRFamide Peptide Receptor family [Source:UniProtKB/TrEMBL;Acc:O45096])

HSP 1 Score: 70.0922 bits (170), Expect = 4.105e-13
Identity = 56/230 (24.35%), Postives = 113/230 (49.13%), Query Frame = 2
Query:  365 LYPLCLVSQTSAIYIIVGFTIERFIVIRYPLKNXXXXXXX-XXXXXXXXXXXXXXYNIPRMIEQVEIKICINMTSKKIMLKDHILYKKIYFTYLYPIVMFILPFIVLLILNSCLLHTIKKSWKNH---FHNTKGINSNLSTSSSQPNRRVTIQTSKETNLNVMIVGVVFTFLICQFLPMIDNIIIHYYGYPHTLEYYIFYTISSLFVVLNSAVNFLLYCFIGKKFRHVLI 1042
            ++PL L++Q  +++  V  T++RFI + +P+K    S +  ++ ++ +I   S I+ +P      E+++  N   +   L+ +  Y + Y  YLY   + ++P+ +++ LN+ ++H ++ +++      HN+  +N    T      R+VT          VM   +   F+IC   P I N ++  Y  P      I   +S++ V +NSA N ++YC    +FR   +
Sbjct:   34 IFPLSLIAQAGSVWTYVAVTVDRFIAVCFPIKRRVWSTRSNTITVLFVITFISAIFKLPSFF---EVRLDHNGEVEPTELRKNEFYIEFYLFYLYVTFIQLIPWTLIIFLNAIIIHKVRLAYRAQEAMVHNSGKLN----TKREDAERKVT----------VMATVMTMIFIICNIPPGI-NYLVDRYSNPTVYRQRI--PLSNVLVCVNSASNMMIYCVFNSRFRRAAL 243          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: FMRFaR (gene:FBgn0035385 transcript:FBtr0340706)

HSP 1 Score: 83.1889 bits (204), Expect = 1.096e-16
Identity = 67/239 (28.03%), Postives = 124/239 (51.88%), Query Frame = 2
Query:  365 LYPLCLVSQTSAIYIIVGFTIERFIVIRYPLKNXXXXXXXXXXXXXXXXX-XXXXYNIPRMIEQVEI------KICINMTSKKIMLKDHILYKKIYFTYLYPIVMFILPFIVLLILNSCLLHTIKKSWKNHFHNTKGINSNLSTSSSQPNRRVTIQTSKETNLNVMIVGVVFTFLICQFLPMIDNIIIHYYGYPHTLEYYIFYTISSLFVVLNSAVNFLLYCFIGKKFRHVLIYIYCNR 1060
            ++P+ +++QT++IY+    T+ER++ + +PLK  +L      +I  I+ +  S+ YN+PR  E + +      K  I    +   L+    Y  IY  + Y IV +I+PF+ L ILN  +   +K++                   ++  +R++    +E  L  M++ VV  F +  FLP++ NI   +Y    T+++ I   IS+L + +NS+VNFL+Y   G+KF+ + + I+  R
Sbjct:  196 VFPIGMIAQTASIYMTFTVTLERYVAVCHPLKARALCTYGRAKIYFIVCVCFSLAYNMPRFWEVLTVTYPEPGKDVILHCVRPSRLRRSETYINIYIHWCYLIVNYIIPFLTLAILNCLIYRQVKRA-------------------NRERQRLSRSEKREIGLATMLLCVVIVFFMLNFLPLVLNISEAFYS---TIDHKI-TKISNLLITINSSVNFLIYIIFGEKFKRIFLLIFFKR 411          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: FMRFaR (gene:FBgn0035385 transcript:FBtr0332085)

HSP 1 Score: 83.1889 bits (204), Expect = 1.096e-16
Identity = 67/239 (28.03%), Postives = 124/239 (51.88%), Query Frame = 2
Query:  365 LYPLCLVSQTSAIYIIVGFTIERFIVIRYPLKNXXXXXXXXXXXXXXXXX-XXXXYNIPRMIEQVEI------KICINMTSKKIMLKDHILYKKIYFTYLYPIVMFILPFIVLLILNSCLLHTIKKSWKNHFHNTKGINSNLSTSSSQPNRRVTIQTSKETNLNVMIVGVVFTFLICQFLPMIDNIIIHYYGYPHTLEYYIFYTISSLFVVLNSAVNFLLYCFIGKKFRHVLIYIYCNR 1060
            ++P+ +++QT++IY+    T+ER++ + +PLK  +L      +I  I+ +  S+ YN+PR  E + +      K  I    +   L+    Y  IY  + Y IV +I+PF+ L ILN  +   +K++                   ++  +R++    +E  L  M++ VV  F +  FLP++ NI   +Y    T+++ I   IS+L + +NS+VNFL+Y   G+KF+ + + I+  R
Sbjct:  196 VFPIGMIAQTASIYMTFTVTLERYVAVCHPLKARALCTYGRAKIYFIVCVCFSLAYNMPRFWEVLTVTYPEPGKDVILHCVRPSRLRRSETYINIYIHWCYLIVNYIIPFLTLAILNCLIYRQVKRA-------------------NRERQRLSRSEKREIGLATMLLCVVIVFFMLNFLPLVLNISEAFYS---TIDHKI-TKISNLLITINSSVNFLIYIIFGEKFKRIFLLIFFKR 411          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: FMRFaR (gene:FBgn0035385 transcript:FBtr0072980)

HSP 1 Score: 83.1889 bits (204), Expect = 1.096e-16
Identity = 67/239 (28.03%), Postives = 124/239 (51.88%), Query Frame = 2
Query:  365 LYPLCLVSQTSAIYIIVGFTIERFIVIRYPLKNXXXXXXXXXXXXXXXXX-XXXXYNIPRMIEQVEI------KICINMTSKKIMLKDHILYKKIYFTYLYPIVMFILPFIVLLILNSCLLHTIKKSWKNHFHNTKGINSNLSTSSSQPNRRVTIQTSKETNLNVMIVGVVFTFLICQFLPMIDNIIIHYYGYPHTLEYYIFYTISSLFVVLNSAVNFLLYCFIGKKFRHVLIYIYCNR 1060
            ++P+ +++QT++IY+    T+ER++ + +PLK  +L      +I  I+ +  S+ YN+PR  E + +      K  I    +   L+    Y  IY  + Y IV +I+PF+ L ILN  +   +K++                   ++  +R++    +E  L  M++ VV  F +  FLP++ NI   +Y    T+++ I   IS+L + +NS+VNFL+Y   G+KF+ + + I+  R
Sbjct:  196 VFPIGMIAQTASIYMTFTVTLERYVAVCHPLKARALCTYGRAKIYFIVCVCFSLAYNMPRFWEVLTVTYPEPGKDVILHCVRPSRLRRSETYINIYIHWCYLIVNYIIPFLTLAILNCLIYRQVKRA-------------------NRERQRLSRSEKREIGLATMLLCVVIVFFMLNFLPLVLNISEAFYS---TIDHKI-TKISNLLITINSSVNFLIYIIFGEKFKRIFLLIFFKR 411          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: Proc-R (gene:FBgn0029723 transcript:FBtr0100552)

HSP 1 Score: 48.9062 bits (115), Expect = 8.423e-6
Identity = 37/151 (24.50%), Postives = 72/151 (47.68%), Query Frame = 2
Query:  617 YKKIYFTYLYPI----VMFILPFIVLLILNSCLLHTIKKSWKNHFHNTKGINSNLSTSSS------QPNRRVTIQTSKETNLNVMIVGVVFTFLICQFLPMIDNIIIHYYGYPHTLEYYIFYTISSLFVVLNSAVNFLLYCFIGKKFRHVL 1039
            Y ++Y +YL+ +    V  + P ++L   NS L+  +        H +K +  +L+ +SS      + N  +    S+E  + + ++ VV  F++CQ LP    +I++ Y         +   + +L   L++A NF LYC +  K+R  +
Sbjct:  348 YDELY-SYLWNLFTLLVFVVFPLLLLATFNSILILLV--------HRSKNLRGDLTNASSIRRTKRKSNSGLKGSVSQENRVTITLIAVVLMFIVCQ-LPWAIYLIVNQYMEIQIGTQVVAGNVCNLLASLHAASNFFLYCVLSDKYRKTV 488          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: Proc-R (gene:FBgn0029723 transcript:FBtr0070713)

HSP 1 Score: 48.9062 bits (115), Expect = 8.423e-6
Identity = 37/151 (24.50%), Postives = 72/151 (47.68%), Query Frame = 2
Query:  617 YKKIYFTYLYPI----VMFILPFIVLLILNSCLLHTIKKSWKNHFHNTKGINSNLSTSSS------QPNRRVTIQTSKETNLNVMIVGVVFTFLICQFLPMIDNIIIHYYGYPHTLEYYIFYTISSLFVVLNSAVNFLLYCFIGKKFRHVL 1039
            Y ++Y +YL+ +    V  + P ++L   NS L+  +        H +K +  +L+ +SS      + N  +    S+E  + + ++ VV  F++CQ LP    +I++ Y         +   + +L   L++A NF LYC +  K+R  +
Sbjct:  348 YDELY-SYLWNLFTLLVFVVFPLLLLATFNSILILLV--------HRSKNLRGDLTNASSIRRTKRKSNSGLKGSVSQENRVTITLIAVVLMFIVCQ-LPWAIYLIVNQYMEIQIGTQVVAGNVCNLLASLHAASNFFLYCVLSDKYRKTV 488          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9VZW5|FMAR_DROME (FMRFamide receptor OS=Drosophila melanogaster OX=7227 GN=FMRFaR PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.099e-15
Identity = 67/239 (28.03%), Postives = 124/239 (51.88%), Query Frame = 2
Query:  365 LYPLCLVSQTSAIYIIVGFTIERFIVIRYPLKNXXXXXXXXXXXXXXXXX-XXXXYNIPRMIEQVEI------KICINMTSKKIMLKDHILYKKIYFTYLYPIVMFILPFIVLLILNSCLLHTIKKSWKNHFHNTKGINSNLSTSSSQPNRRVTIQTSKETNLNVMIVGVVFTFLICQFLPMIDNIIIHYYGYPHTLEYYIFYTISSLFVVLNSAVNFLLYCFIGKKFRHVLIYIYCNR 1060
            ++P+ +++QT++IY+    T+ER++ + +PLK  +L      +I  I+ +  S+ YN+PR  E + +      K  I    +   L+    Y  IY  + Y IV +I+PF+ L ILN  +   +K++                   ++  +R++    +E  L  M++ VV  F +  FLP++ NI   +Y    T+++ I   IS+L + +NS+VNFL+Y   G+KF+ + + I+  R
Sbjct:  196 VFPIGMIAQTASIYMTFTVTLERYVAVCHPLKARALCTYGRAKIYFIVCVCFSLAYNMPRFWEVLTVTYPEPGKDVILHCVRPSRLRRSETYINIYIHWCYLIVNYIIPFLTLAILNCLIYRQVKRA-------------------NRERQRLSRSEKREIGLATMLLCVVIVFFMLNFLPLVLNISEAFYS---TIDHKI-TKISNLLITINSSVNFLIYIIFGEKFKRIFLLIFFKR 411          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q18321|DAF37_CAEEL (G-protein coupled receptor daf-37 OS=Caenorhabditis elegans OX=6239 GN=daf-37 PE=1 SV=2)

HSP 1 Score: 71.633 bits (174), Expect = 4.363e-12
Identity = 85/337 (25.22%), Postives = 166/337 (49.26%), Query Frame = 2
Query:  122 LEIFQFAVFGIMGCLICILGFIGNILTLTVLGNSAMRRLNSSXXXXXXXXXXXXXXXXXXXXXXXPMLKPGFRRQELNDYLLY-----PLCLVSQTSAIYIIVGFTIERFIVIRYPLKNXXX-XXXXXXXXXXXXXXXXXXYNIPRMIE-QVEIK-ICINMTSKKI------MLKDHILYKKIYFTYLYPIVMFILPFIVLLILNSCLLHTIKKSWKNH-FHNTKGINSNLSTSSSQP-------NRRVTIQTSKETNLNVMIVGVVFTFLICQFLPMIDNIIIHYYGYPHTL-EYYIFYTIS----SLFVVLNSAVNFLLYCFIGKKFRHVLIYIY 1051
            LE+ +F +  ++G LI + G  GN  T  +L   +MR  N+            L++  FF+     +++          +L Y      L  +SQT ++YI V  TIER++ + +P  + ++     +   ++ +   ++++N  +  E QV +   C + ++ +        +  + +Y+++Y  ++   VM   PF+ LL+ N+ + +TI++S + + FHN K + + LS S + P       +R    + S+E  L ++I+  VF FL C F   +  ++    G    + E++IFYT S    +   ++NS++NF++Y   GK FR  L+ +Y
Sbjct:   29 LEV-KFFLISVVGTLIGLFGLFGNATTALILTRPSMRNPNNLFLTALAVFDSCLLITAFFIYAMEYIIEYTAAFDLYVAWLTYLRFAFALSHISQTGSVYITVAVTIERYLAVCHPKSSKNMCGPGGAAWTILGVTTFAVVFNCTKFFELQVTVNPSCPDGSNWQSYILLPSAMASNPIYQQVYSLWVTNFVMVFFPFLTLLLFNAIIAYTIRQSLEKYDFHNQKSVVAALSASVNLPRNIAGISSRNELKEKSREATLVLVII--VFIFLGCNFWGFVLTLLERIMGQETLMVEHHIFYTFSREAINFLAIINSSINFVIYLLFGKDFRKELVVVY 362          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q11095|FRPR1_CAEEL (Probable G-protein coupled receptor frpr-1 OS=Caenorhabditis elegans OX=6239 GN=frpr-1 PE=3 SV=3)

HSP 1 Score: 60.077 bits (144), Expect = 1.482e-8
Identity = 89/337 (26.41%), Postives = 145/337 (43.03%), Query Frame = 2
Query:  125 EIFQFAVFGIMGCLICILGFIGNILTLTVLGNSAMRRLNSSXXXXXXXXXXXXXXXXXXXXXXXPMLKPGFRRQELNDY-------LLYPLCLVSQTSAIYIIVGFTIERFIVIRYPLK-----------------NXXXXXXXXXXXXXXXXXXXXXYNIPRMIEQVEIKICINM---TSKKI---MLKDHILYKKIYFTYLYPIVMFILPFIVLLILNSCLLHTIKKSWKNHFHNTKGINSNLSTSSSQPNRRVTIQTSKETNLNVMIVGVVFTFLICQFLPMIDNIIIHYYGYPHTLEYYIFYTISSLFVVLNSAVNFLLYCFIGKKFRHVLIY 1045
            E F   V G+M  LI  LG IGN L+      +  RR   S   + L       ++     F    L+   +R E   Y       +++PL L +QT +++I V    +  +++    K                 N   +V   ++I+V I +  I YN P M E   I     M    SK +    L+ ++ Y +IY+ Y+Y IVM + P ++L+++N+ ++ ++++                   SS PN    I T         +V VV  F+ C  LP+  N +   +G  ++  Y I   +S+L VV+NS+ NFL+Y   G  FR  L Y
Sbjct:   43 EQFNLVVIGLMLPLIGCLGLIGNALS----AFTYSRREMISSLNVYLFALACSDIVIILTAFFLFFLENMRKRSEWATYYFAVLSPVMFPLGLTAQTMSVFITVASAFDCLVLVAASEKFKSKFCSVNTSILVGNFNDFKNVIVCLKIIVKIFLLGIFYNSPHMYEIYVIDCWSTMYNTASKDVCPTALRSNVDYVRIYYVYMYTIVMAVGPVLLLIVINTAIVISMRR-------------------SSSPNSESDIIT---------LVLVVCLFISCNVLPLTVNFLELLFGIINS--YLI--DLSNLMVVVNSSCNFLIYYTFGSNFRRTLRY 343          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q11082|YT66_CAEEL (Probable G-protein coupled receptor B0563.6 OS=Caenorhabditis elegans OX=6239 GN=B0563.6 PE=3 SV=2)

HSP 1 Score: 53.9138 bits (128), Expect = 1.926e-6
Identity = 69/303 (22.77%), Postives = 130/303 (42.90%), Query Frame = 2
Query:  167 ICILGFIGNILTLTVLGNSAMRRLNSSXXXXXXXXXXXXXXXXXXXXXXXPMLKPGFRRQELNDYLLYP-------LCLVSQT--SAIYIIVGFTIERFIVIRYPLK-NXXXXXXXXXXXXXXXXXXXXXYNIPRMIEQVEIKICINMTSKKIM--LKDHILYKKIY---FTYLYPIVMFILPFIVLLILNSCLLHTIKKSWKNHFHNTKGINSNLSTSSSQPNRRVTIQTSKETNLNVMIVGVVFTFLICQFLPMIDNIIIHYYGYPHTLEYYIFYTISSLFVVLNSAVNFLLYCFIGKKFR 1030
            IC +G +GNI  L VL +  +R ++            + +L       T  + K G     +N Y LY        L L++    + +Y++V  ++ER+I I +P+      S +++ R +VI  +   I+ +P  I + + K   ++     +  + DH +Y   Y   + +    ++  LP I+L +LN  ++   +K  K     T              N+R    T K+  L  M+ G V   L+C  +P   N+++        L+Y IF  ++++  + N A  F ++C     +R
Sbjct:   34 ICAIGIVGNITNLMVLASRRLRAVSYMYLRALAVADLLCMLFVLVFVSTEYLAKNG---SSINQYKLYQIYQCHLMLTLINWALGAGVYVVVALSLERYISIVFPMHFRTWNSPQRATRAIVIAFLIPAIFYVPYAITRYKGKQRFDLLQNVTIYSMDDHPIYTTFYWQIYKWTREAILRFLPIIILTVLNIQIMIAFRKRQKMFQQLT--------------NKRKEQGTQKDDTLMYMLGGTVLMSLVCN-IPAAINLLLIDETLKKRLDYQIFRAVANILEITNHASQFYVFCACSTDYR 318          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: R7US11 (G_PROTEIN_RECEP_F1_2 domain-containing protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_24430 PE=4 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 7.814e-32
Identity = 113/326 (34.66%), Postives = 162/326 (49.69%), Query Frame = 2
Query:  131 FQFAVFGIMGCLICILGFIGNILTLTVLGNSAMRRLNSSXXXXXXXXXXXXXXXXXXXXXXXPML----KPGFRR------QELNDYLLYPLCLVSQTSAIYIIVGFTIERFIVIRYPLKNXXX-XXXXXXXXXXXXXXXXXXYNIPRMIEQ---VEIKICINMTSKKIMLKDHIL---YKKIYFTYLYPIVMFILPFIVLLILNSCLLHTIKKSWKNHFHNTKGINSNLSTSSSQPNRRVTIQTSKETNLNVMIVGVVFTFLICQFLPMIDNIIIHYYGYPHTLEYYIFYTISSLFVVLNSAVNFLLYCFIGKKFRHVLIYIYCN 1057
            FQF  +G++G  I +LG IGNIL++ VL +   RR+ SS      A+     ++       F M     + G+ R        L  Y  YPL L +QT++IY  VGFT+ER+I +  PL      ++ ++ + V++I++ SIIYNIPR  E     +     N T    M  D  L   Y+ +Y   +    M +LPF VL++LN+ LL  + +S       T+G              R+T +   E NL VM++ VV  FL CQ LP++DNI I  Y         +   +S L V LNSA NF LYC  G+KFR V   I+C 
Sbjct:   10 FQFIAWGVVGTCIAVLGLIGNILSICVLCH---RRMRSSTSCYLTALSIYDCIVLMSQIVFFGMFSIERQTGWPRNYKVFFAYLQPYA-YPLALTAQTASIYTTVGFTVERYIAVCLPLTAAKTCTISRARKTVLLILVVSIIYNIPRAFENYTLAQFDSTTNKTHVAYMHTDFGLNHAYRFVYVVLMNFGFMLLLPFTVLIVLNALLLRAVNQS-----ACTQG--------------RITSRQRHENNLTVMLLSVVIVFLACQILPIVDNICIVMYPNGSQQAMLVLTVVSCLMVTLNSATNFYLYCVFGRKFRQVFCLIFCR 312          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0L8H1H8 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22024573mg PE=4 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 2.454e-30
Identity = 91/244 (37.30%), Postives = 134/244 (54.92%), Query Frame = 2
Query:  362 LLYPLCLVSQTSAIYIIVGFTIERFIVIRYPLKNXXXXXXXXXXXXXX-XXXXXXXYNIPRMIEQVEIKICINM-------TSKKIMLKDHILYKKIYFTYLYPIVMFILPFIVLLILNSCLLHTIKKSWKNHFHNTKGINSNLSTSSSQPNRRVTIQTSKETNLNVMIVGVVFTFLICQFLPMIDNI---IIHYYGYPHTLEYYIFYTISSLFVVLNSAVNFLLYCFIGKKFRHVLIYIYCNR 1060
            + YP+ L++QT  IY  VGFT+ER++ +  PL+  ++      +  V+ I++ SI+YNIPRM E  E K   N        T     L  + +YK++YF YL  +VMF++PF +L  LN+CL++ I+ S K          S +  SSS           KE N+ +M++ VV  FL+CQ   + DNI   ++       +  Y  F TIS+L VV NSA NF+LYC  GKKFR V   ++C+R
Sbjct:   30 IAYPIALIAQTGTIYTTVGFTVERYVAVCRPLQAANICTMNRSKKAVLCILLGSIMYNIPRMFE-FETKTEWNSQYNHTRPTYSTTELGKNKIYKEVYFIYLNLLVMFLMPFTLLTYLNTCLINAIRTSRK----------SRMQMSSS---------AVKENNMTIMLISVVVVFLVCQLPSIADNILWTVLKNNQQNCSAAYIKFTTISNLMVVFNSACNFVLYCLFGKKFRRVFSKLFCSR 253          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0K0PUJ4 (Orphan G-protein coupled receptor 44 OS=Platynereis dumerilii OX=6359 PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 7.625e-30
Identity = 100/324 (30.86%), Postives = 177/324 (54.63%), Query Frame = 2
Query:  101 TDSNETILEIFQFAVFGIMGCLICILGFIGNILTLTVLGNSAMRRLNSSXXXXXXXXXXXXXXXXXXXXXXXPMLKPGFRRQELNDYL---LYPLCLVSQTSAIYIIVGFTIERFIVIRYPLKNXXX-XXXXXXXXXXXXXXXXXXYNIPRMIEQVEIKICINMTSKKIMLKDHILYKKIYFTYLYPIVMFILPFIVLLILNSCLLHTIKKSWKNHFHNTKGINSNLSTSSSQPNRRVTIQTSKETNLNVMIVGVVFTFLICQFLPMIDNIIIHYYGYPHTLEYYIFYTISSLFVVLNSAVNFLLYCFIGKKFRHVLIYIYCNR 1060
            +D+++ +LE F+F + GIM  ++ +LG IGN LT  +L    MR  +++IYL+ALA  D ++LI        P +   +    L  Y+   +YPL L++QT+ I++ V FT+ER+I + +PLK  ++ ++ ++  ++  +   +I+YNIPR  E     +      +      +  Y+KIY+  LY IVM I P ++L ILNS L+  +++S                    Q    + ++ S+E N+ +M+V VV  F+ICQ   ++ N+I +     H+    +   I +  V  NS++NF+LYC +G+KFR + ++ +C +
Sbjct:   39 SDNSQEVLEHFRFFINGIMTNIVVLLGLIGNFLTTIILSQKVMRS-STNIYLLALAAWDSVVLINTACLIGLPEIS-QYYTHHLFPYMVAYIYPLALIAQTATIWLTVSFTVERYIAVCHPLKAATMCTISRAKMVIFGVSFGAILYNIPRWFENTLRTVNNRAEIESTEFSWNANYRKIYYVGLYLIVMCITPVLLLCILNSFLILAVRRS-------------------RQQQMNMNVRQSRENNITIMLVSVVIVFIICQVPALVYNLI-YAVSETHSFSMQVLSDIRNFLVTFNSSINFILYCALGQKFRRIFLHTFCKQ 340          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: R7TUJ1 (G_PROTEIN_RECEP_F1_2 domain-containing protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_24477 PE=4 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 6.366e-28
Identity = 99/328 (30.18%), Postives = 174/328 (53.05%), Query Frame = 2
Query:  119 ILEIFQFAVFGIMGCLICILGFIGNILTLTVLGNSAMRRLNSSXXXXXXXXXXXXXXXXXXXXXXXPMLKPGFRRQELNDY-------LLYPLCLVSQTSAIYIIVGFTIERFIVIRYPLKNXXX-XXXXXXXXXXXXXXXXXXYNIPRMIEQVEIKICINMTSKKIMLK-------DHILYKKIYFTYLYPIVMFILPFIVLLILNSCLLHTIKKSWKNHFHNTKGINSNLSTSSSQPNRRVTIQTSKETNLNVMIVGVVFTFLICQFLPMIDNII--IHYYGYPHTLEYYIFYTISSLFVVLNSAVNFLLYCFIGKKFRHVLIYIY 1051
            IL++  + + GI+  L+ ILG +GN+LT+ +L   AMR   SS      A+     ++     F   +  PG   Q   ++        +YPL LV+QT+ I++ V FT+ER+I + +PLK  S+ ++ ++  I+  +   S +YNIPR  +    ++ +N ++ + M+         + LY K+YF++LY  +M I+P ++L  LN+ L+  +++S +      K +N               ++ S+E N+ +M+V VV  F+ICQ   ++ N+   I+         Y +   I +  V LNSAVNFLLYC +G+KFR + ++I+
Sbjct:    1 ILKLLSYWIDGIVTNLVVILGLVGNLLTIIILSQRAMR---SSTNYYLCALAVWDSIVLVSTCFLIGL--PGANIQSYTNHGHAYVVSYVYPLALVAQTATIWLTVSFTVERYIAVCHPLKAASMCTISRAKIIIAGVSFGSALYNIPRWFD-FRPRVFLNPSTNQTMVSIIRTRFSQNPLYLKVYFSWLYVPMMVIVPLLLLSFLNTFLILAVRRSRRQR----KDMN---------------VKQSRENNITIMLVSVVIVFIICQVPALVYNLAFAINNRYVEIDFGYQVLSKIRNFLVTLNSAVNFLLYCALGQKFRRIFLHIF 303          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0K0PUU4 (Orphan G-protein coupled receptor 28 OS=Platynereis dumerilii OX=6359 PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 3.784e-27
Identity = 108/335 (32.24%), Postives = 162/335 (48.36%), Query Frame = 2
Query:  122 LEIFQFAVFGIMGCLICILGFIGNILTLTVLGNSAMRRLNSSXXXXXXXXXXXXXXXXXXXXXXXPM---------LKPGFRRQELNDYLLYPLCLVSQTSAIYIIVGFTIERFIVIRYPLKNXXXXXXXXXXXXXXXXXX-XXXYNIPRMIEQVEIK------ICINMTSKKIMLKDHILYKKIYFTYLYPIVMFILPFIVLLILNSCLLHTIKKSWKNHFHNTKGINSNLSTSSSQPNRRVTIQTSKETNLNVMIVGVVFTFLICQFLPMIDNIIIHYYGYPHTLEYYIFY--------TISSLFVVLNSAVNFLLYCFIGKKFRHVLIYIYC 1054
            L  FQ+  +GI G +I +LG IGN+ ++ VLGN   RR+ SS     +A+     ++   L   F +         L+  +R         YP  L++QT +IY  V FT+ER+I +  PL+   +      R  ++I++  SI+YNIPRM+E               +T+ K  L     ++ IYF Y++  VM ++PF  L +LN  L+  +K+S                        +V+ +T +E +L VM++ VV  FLICQ   ++DNI      +  TL   I Y        TIS L V+ NSA NF LYC  G+KFR V   I+C
Sbjct:   44 LARFQYYAWGITGNIIAVLGLIGNVFSIIVLGN---RRMMSSTSCYLIALGVFDSVVLISLVLFFSLPTFYIATGKLESYYRAYPYMHPYAYPTALIAQTCSIYTTVAFTVERWIAVCRPLRAAKMCTISRARKSILIIMFCSIVYNIPRMLEYRTTHEFDPNTNTTRVTNTKTALGADPTFQHIYFIYMHIFVMLLIPFTTLAVLNILLIRAVKQS-------------------EHATGKVSNKTKRENSLTVMLISVVVVFLICQVPSIVDNI------FTATLNDNILYQPPFVKLTTISGLMVIANSATNFYLYCVFGRKFRRVFCRIFC 350          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000051173.1 (SMESG000051173.1)

HSP 1 Score: 577.015 bits (1486), Expect = 0.000e+0
Identity = 359/360 (99.72%), Postives = 359/360 (99.72%), Query Frame = 2
Query:   89 MSNNTDSNETILEIFQFAVFGIMGCLICILGFIGNILTLTVLGNSAMRRLNSSXXXXXXXXXXXXXXXXXXXXXXXPMLKPGFRRQELNDYLLYPLCLVSQTSAIYIIVGFTIERFIVIRYPLKNXXXXXXXXXXXXXXXXXXXXXYNIPRMIEQVEIKICINMTSKKIMLKDHILYKKIYFTYLYPIVMFILPFIVLLILNSCLLHTIKKSWKNHFHNTKGINSNLSTSSSQPNRRVTIQTSKETNLNVMIVGVVFTFLICQFLPMIDNIIIHYYGYPHTLEYYIFYTISSLFVVLNSAVNFLLYCFIGKKFRHVLIYIYCNRNXXXXXXXXXXXXXXXXXXXSPTRSCHELLLKQTLQ 1168
            MSNNTDSNETILEIFQFAVFGIMGCLICILGFIGNILTLTVLGNSAMRRLNSSIYLIALAICDILILIGFFLTFTFPMLKPGFRRQELNDYLLYPLCLVSQTSAIYIIVGFTIERFIVIRYPLKNLSLSVKKSVRIVVIIVISSIIYNIPRMIEQVEIKICINMTSKKIMLKDHILYKKIYFTYLYPIVMFILPFIVLLILNSCLLHTIKKSWKNHFHNTKGINSNLSTSSSQPNRRVTIQTSKETNLNVMIVGVVFTFLICQFLPMIDNIIIHYYGYPHTLEYYIFYTISSLFVVLNSAVNFLLYCFIGKKFRHVLIYIYCNRNKCLSKGNK KKMETTLMKESPTRSCHELLLKQTLQ
Sbjct:    1 MSNNTDSNETILEIFQFAVFGIMGCLICILGFIGNILTLTVLGNSAMRRLNSSIYLIALAICDILILIGFFLTFTFPMLKPGFRRQELNDYLLYPLCLVSQTSAIYIIVGFTIERFIVIRYPLKNLSLSVKKSVRIVVIIVISSIIYNIPRMIEQVEIKICINMTSKKIMLKDHILYKKIYFTYLYPIVMFILPFIVLLILNSCLLHTIKKSWKNHFHNTKGINSNLSTSSSQPNRRVTIQTSKETNLNVMIVGVVFTFLICQFLPMIDNIIIHYYGYPHTLEYYIFYTISSLFVVLNSAVNFLLYCFIGKKFRHVLIYIYCNRNKCLSKGNKNKKMETTLMKESPTRSCHELLLKQTLQ 360          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000013112.1 (SMESG000013112.1)

HSP 1 Score: 108.227 bits (269), Expect = 4.895e-26
Identity = 102/312 (32.69%), Postives = 161/312 (51.60%), Query Frame = 2
Query:  152 IMGCLICILGFIGNILTLTVLGNSAMRRLNSSXXXXXXXXXXXXXXXXXXXXXXXPMLKPGFRRQELNDY-LLYPLCLVSQTSAIYIIVGFTIERFIVIRYPLKNXXXXXXXXXXX-XXXXXXXXXXYNIPRMIEQVEIKICINMTSKKIM--LKDHILYKKIYFTYLYPIVMFILPFIVLLILNSCLLHTIKKSWKNHFHNTKGINSNLSTSSSQPNRRVTIQTSKETNLNVMIVGVVFTFLICQFLPMIDNIIIHYYGY--PHTLEYYIFYTISSLFVVLNSAVNFLLYCFIGKKFRHVLIYIY--CNRN 1063
            I+  ++   G IGN L++ VL N  MR   SS+ +  LA+     ++     F  P+++  F    +  + + YP  LV+QT+ I+I VG T ER+  + +PLK       K     V++I + SI YN+PR +E  EI + IN +    +      I + K Y++Y Y ++MF +P +VL  +N  L+  +K S     +     N +L +S S   RR+      + N+  MIV VV  F+ CQF  +I NI    +G    + + + I   I +  V+LNSAVNF+LYC  G+KFR   +++   CN N
Sbjct:   10 IITIIVISFGIIGNFLSVIVLKNKVMR---SSVSIYLLALTLWDTVLLICALFIGPLMR--FENLRVIFFKIFYPPALVAQTATIWITVGLTCERYFAVCFPLKAQFFISMKKSFWCVILISLFSIFYNVPRWLE--EIPMSINNSEHTFVNHSDSTIGFHKFYYSYAYIVIMFFIPLLVLSSMNYMLIRELKNS---QLYVLNDTNKSLISSKS---RRI----RSDNNVTRMIVVVVSIFIFCQFPALIYNI---KFGIQPANDISWEIISEIRNFLVILNSAVNFILYCAFGQKFRRTFVHVIIPCNEN 301          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000059705.1 (SMESG000059705.1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.019e-14
Identity = 90/342 (26.32%), Postives = 163/342 (47.66%), Query Frame = 2
Query:  125 EIFQFAVFGIMGCLICILGFIGNILTLTVLGNSAMRRLNSSXXXXXXXXXXXXXXXX----XXXXXXXPMLKPGFRRQELNDYL---LYPLCLVSQTSAIYIIVGFTIERFIVIRYP-LKNXXXXXXXXXXXXXXXXXXXXXYNIPRMIE----QVEIKICINMT---SKKIMLKDHILYKKIYFTYLYPIVMFILPFIVLLILNSCLLHTIKKSWKNHFHNTKGINSNLSTSSSQ-------------PNRRVTIQTS-------KETNLNVMIVGVVFTFLICQFLPMIDNIIIHYYGYPHTLEYYIFYTIS--SLFVVLNSAVNFLLYCFIGKKFRHVL 1039
             +F F +  ++  LIC+ GFIGNI+++TVL   +    + SI L  L + D L LI       L   +PM     +  ++  YL   L+ L +  Q +  +++V  T+ER+  +++P +     +      I ++ +  ++++NIPR  E       I  C N +   +    L+++ +Y  +Y +  Y +++ I P   +L LN  L+  IK +  N        N+++S SS Q             P    +I T+       K  ++N +I+ +V  F+IC+ +P + +  +  +    + +  + YT+S  +  V L S+ NFL+YC  GKKFR  L
Sbjct:   64 HVFMFLLESVILGLICVFGFIGNIISITVLIMESHASQSPSIILRLLCVSDTLFLITYFFYSSLRHVYPMTSYLVQYHDIYPYLVPYLWSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKLISILSIALAVVFNIPRFYEWDVINFRIDPCFNYSVIRADNSHLRENAIYSILYRSVFYAVLVAIGPVACVLWLNVSLIKLIKSAGNNLIIRNVSANTSISHSSRQRNQVNGPTYQLFQPAASTSISTAYGQCIQEKNRSVNRLIILLVSVFIICE-IPALIHQFLAVFVTSTSHDSPMIYTVSLSNALVTLKSSSNFLIYCLGGKKFRFTL 404          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000007759.1 (SMESG000007759.1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.513e-13
Identity = 96/347 (27.67%), Postives = 162/347 (46.69%), Query Frame = 2
Query:  125 EIFQFAVFGIMGCLICILGFIGNILTLTVLGNSAMRRLNSSXXXXXXXXXXXXXXXXXXXXXXXPMLKPGFRRQEL---NDYLL----YPLC----LVSQTSAIYIIVGFTIERFIVIRYPLKNXXX-XXXXXXXXXXXXXXXXXXYNIPRMIEQV---------------EIKICINMTSKKIMLKDHILYK----------KIYFT-YLYPIVMFILPFIVLLILNSCLLHTIKKSWKNHFHNTKGINSNLSTSSSQPNRRVTIQTSKETNLNVMIVGVVFTFLICQFLPMIDNIIIHY-YGYPHTLEYYIFYTISSLFVVLNSAVNFLLYCFIGKKFRHVLIYI 1048
            EI  F + GI G +   LG IGN+++L++L       + + IYLI L + D+L+LI F L       KP  +  +     D  +    +P+C    L  Q S+I++    ++ERF +I YP K   + S+K +     ++V +S++YNIPR  E +                     N T+ + +   +  Y           +I++T Y + +++F+ P I ++I NS LL  IK+       N +   +N +           +  +++TN   M++GV+F FL+ Q    I ++I  Y  G      Y+I   I +  V+LNSA+N + Y    K+FR   I I
Sbjct:   11 EIVTFFIMGIAGTVTASLGVIGNLISLSILFRRRRNWITTDIYLIGLTMSDLLLLIFFILIALKDTRKPNLKVAQWLMWQDVAMVPKVFPVCHALLLFFQVSSIWLTTFLSVERFFIICYPFKAERICSLKIASINTTLVVAASLVYNIPRFFEYILWSADWSQPVLSDYLNTTSIYNFTNTQFLKMQYTWYDISEFGKSPSFRIWYTLYSWIVLVFLGPIITIVITNSLLLIEIKRV------NRRAKRNNFNV----------VDVNQDTN--KMLIGVIFFFLLTQIPASISHVIWAYMAGDKFQQWYFIINEIGNYLVILNSAINIVSYLIFSKRFRKEFIKI 339          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000012917.1 (SMESG000012917.1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.688e-12
Identity = 79/283 (27.92%), Postives = 129/283 (45.58%), Query Frame = 2
Query:  362 LLYPLCLVSQTSAIYIIVGFTIERFIVIRYPLKNXXXXXXXXXXXXXX--XXXXXXXYNIPRMIEQV--------------------EIK-----ICIN----------------MTSKKIMLKDHILYKKIYFTYLYPIVMFILPFIVLLILNSCLLHTIKKSWKNHFHNTKGINSNLSTSSSQPNRRVTIQTSKETNLNVMIVGVVFTF----LICQFLPMID--NIIIHYYGYPHTLEYYIFYTISSLFVVLNSAVNFLLYCFIGKKFRHVLIYIYCNRN 1063
            + +PL L +Q S+IY+ V  + ER++ +  PLK           I+VI  I+  S++YNIPR  E V                    E+K     I IN                ++  K  + + + Y+  Y   LY +VMF++PFI++  +N  L+  +KKS K  +          + S SQ          KE  L+ + + +V  F    L    +  +D  N+I    G    + + +   +S+ F+++NS++NFL+YCF+G+KFR  LI   C RN
Sbjct:  112 VFWPLLLGAQMSSIYLTVLVSYERWMAVVKPLKASQRGWSMRKLILVIGGIIGLSLLYNIPRWWEYVPKEDNLHEVILLLTPVYFCNEVKYNKTAIQINTQFYADLLETKCNLTVLSFSKSDIGNSLWYRYGYCATLYILVMFLIPFIMITYMNVALVKCLKKS-KEKWG---------TMSRSQ---------RKEVRLSYVPLAIVALFYLLGLPAVIINFVDSLNVIPQNTGSREFVLWQVALNVSNFFIIVNSSINFLIYCFLGQKFRTTLINFCCCRN 375          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frpr-194.350e-1525.42FMRFamide Peptide Receptor family [Source:UniProt... [more]
frpr-194.983e-1525.42FMRFamide Peptide Receptor family [Source:UniProt... [more]
frpr-82.037e-1322.51FMRFamide Peptide Receptor family [Source:UniProt... [more]
daf-373.430e-1325.22G-protein coupled receptor daf-37 [Source:UniProt... [more]
frpr-104.105e-1324.35FMRFamide Peptide Receptor family [Source:UniProt... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FMRFaR1.096e-1628.03gene:FBgn0035385 transcript:FBtr0340706[more]
FMRFaR1.096e-1628.03gene:FBgn0035385 transcript:FBtr0332085[more]
FMRFaR1.096e-1628.03gene:FBgn0035385 transcript:FBtr0072980[more]
Proc-R8.423e-624.50gene:FBgn0029723 transcript:FBtr0100552[more]
Proc-R8.423e-624.50gene:FBgn0029723 transcript:FBtr0070713[more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q9VZW5|FMAR_DROME1.099e-1528.03FMRFamide receptor OS=Drosophila melanogaster OX=7... [more]
sp|Q18321|DAF37_CAEEL4.363e-1225.22G-protein coupled receptor daf-37 OS=Caenorhabditi... [more]
sp|Q11095|FRPR1_CAEEL1.482e-826.41Probable G-protein coupled receptor frpr-1 OS=Caen... [more]
sp|Q11082|YT66_CAEEL1.926e-622.77Probable G-protein coupled receptor B0563.6 OS=Cae... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7US117.814e-3234.66G_PROTEIN_RECEP_F1_2 domain-containing protein (Fr... [more]
A0A0L8H1H82.454e-3037.30G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A0K0PUJ47.625e-3030.86Orphan G-protein coupled receptor 44 OS=Platynerei... [more]
R7TUJ16.366e-2830.18G_PROTEIN_RECEP_F1_2 domain-containing protein (Fr... [more]
A0A0K0PUU43.784e-2732.24Orphan G-protein coupled receptor 28 OS=Platynerei... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051173.10.000e+099.72SMESG000051173.1[more]
SMESG000013112.14.895e-2632.69SMESG000013112.1[more]
SMESG000059705.11.019e-1426.32SMESG000059705.1[more]
SMESG000007759.11.513e-1327.67SMESG000007759.1[more]
SMESG000012917.13.688e-1227.92SMESG000012917.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019613 ID=SMED30019613|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1406bp
TATTAATAAGTGATGATGCAAATTCTATAACACCATGATTGCATATTATT
TATTATTTACTCAATTTCAAGCCAAATTCTCCTGAATCATGTCAAATAAC
ACTGATTCAAACGAAACGATTTTAGAAATTTTCCAATTTGCAGTTTTTGG
AATAATGGGATGTCTGATTTGCATTCTTGGATTCATTGGAAACATTCTAA
CGCTAACCGTACTCGGTAATTCCGCAATGAGACGGCTGAATTCTTCAATC
TATCTAATCGCTTTGGCCATTTGTGATATACTTATCCTAATTGGATTTTT
CCTAACATTCACCTTTCCAATGTTGAAACCGGGATTTCGAAGGCAGGAGC
TGAACGATTATTTGCTTTATCCTCTATGTCTCGTGTCACAAACCTCAGCA
ATTTATATCATAGTCGGATTCACTATAGAAAGGTTTATTGTCATTAGGTA
TCCATTGAAAAATCTTTCTCTTTCGGTGAAAAAATCAGTCAGAATTGTCG
TTATTATCGTTATTAGTTCCATCATATACAATATACCCCGAATGATTGAA
CAAGTAGAAATTAAAATATGTATAAACATGACTTCAAAAAAAATTATGTT
GAAAGATCACATCTTATACAAAAAAATCTATTTCACTTACCTTTATCCTA
TAGTGATGTTTATTTTGCCATTTATTGTTCTATTAATCCTAAATTCATGT
TTATTACATACAATAAAAAAGTCATGGAAAAATCACTTTCATAATACCAA
AGGAATTAACAGTAATTTGTCGACTTCATCCTCTCAACCGAACCGTCGGG
TCACAATACAGACTAGCAAAGAAACCAACCTAAATGTAATGATTGTCGGA
GTAGTTTTTACGTTCTTAATATGTCAGTTTTTACCAATGATTGACAACAT
TATAATTCACTATTATGGCTACCCTCATACATTGGAATATTATATTTTCT
ACACGATCTCTAGTTTATTTGTCGTTTTAAATTCGGCTGTTAATTTCCTA
CTTTACTGTTTCATCGGAAAGAAATTTCGGCATGTTTTAATCTACATTTA
CTGCAATCGAAACAAGTGTTTGAGTAAAGGAAATAAAAAAAAAAAAATGG
AAACAACTCTAATGAAAGAAAGCCCTACCCGAAGTTGTCATGAGCTTCTT
TTGAAGCAAACATTACAATAGGTGATTTGTACGTAATTATTTATGTGGAA
TTTCTGTATTTATTATGAATTTATTCCATAAGAAAACGTAAATCATGATA
AACGTATGATGATTGTTTTGTTGAAATCATTTCACTTACTATTATTTTTA
GAATATTGCCAAAAGAGAAAACTTCAGAAAGAAATACTATAATTACTTAA
AAAGTGTTAACATATGTAATTATTCTAACAGCTGTAACTTAATTAAATTT
TGTGAG
back to top

protein sequence of SMED30019613-orf-1

>SMED30019613-orf-1 ID=SMED30019613-orf-1|Name=SMED30019613-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=361bp
MSNNTDSNETILEIFQFAVFGIMGCLICILGFIGNILTLTVLGNSAMRRL
NSSIYLIALAICDILILIGFFLTFTFPMLKPGFRRQELNDYLLYPLCLVS
QTSAIYIIVGFTIERFIVIRYPLKNLSLSVKKSVRIVVIIVISSIIYNIP
RMIEQVEIKICINMTSKKIMLKDHILYKKIYFTYLYPIVMFILPFIVLLI
LNSCLLHTIKKSWKNHFHNTKGINSNLSTSSSQPNRRVTIQTSKETNLNV
MIVGVVFTFLICQFLPMIDNIIIHYYGYPHTLEYYIFYTISSLFVVLNSA
VNFLLYCFIGKKFRHVLIYIYCNRNKCLSKGNKKKKMETTLMKESPTRSC
HELLLKQTLQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 183..206
score: 19.26
coord: 97..119
score: 19.77
coord: 288..314
score: 27.58
coord: 19..43
score: 22.67
coord: 52..73
score: 24.71
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 34..306
e-value: 9.2E-13
score: 48.1
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 103..119
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 2..331
e-value: 9.0E-45
score: 155.0
NoneNo IPR availablePANTHERPTHR46641FAMILY NOT NAMEDcoord: 2..347
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 19..317
e-value: 1.94473E-50
score: 168.58
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 14..337
NoneNo IPR availableTMHMMTMhelixcoord: 246..268
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 91..113
NoneNo IPR availableTMHMMTMhelixcoord: 134..153
NoneNo IPR availableTMHMMTMhelixcoord: 180..202
NoneNo IPR availableTMHMMTMhelixcoord: 54..76
NoneNo IPR availableTMHMMTMhelixcoord: 288..310
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 34..306
score: 25.688