Heterogeneous nuclear ribonucleoprotein,putative

Overview
NameHeterogeneous nuclear ribonucleoprotein,putative
Smed IDSMED30019597
Length (bp)1098
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Heterogeneous nuclear ribonucleoprotein,putative (SMED30019597) t-SNE clustered cells

Violin plots show distribution of expression levels for Heterogeneous nuclear ribonucleoprotein,putative (SMED30019597) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Heterogeneous nuclear ribonucleoprotein,putative (SMED30019597) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Heterogeneous nuclear ribonucleoprotein,putative (SMED30019597) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019597

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30019597 SmedASXL_008452SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30019597 SmedASXL_008452SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30019597 dd_Smed_v4_757_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30019597 dd_Smed_v4_757_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019597 dd_Smed_v4_757_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019597 dd_Smed_v4_757_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019597 dd_Smed_v4_757_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019597 dd_Smed_v4_757_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30019597 dd_Smed_v4_757_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019597 dd_Smed_v6_757_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Human
Match: HNRNPD (heterogeneous nuclear ribonucleoprotein D [Source:HGNC Symbol;Acc:HGNC:5036])

HSP 1 Score: 167.933 bits (424), Expect = 7.431e-50
Identity = 81/164 (49.39%), Postives = 117/164 (71.34%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP--TKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+F+GGLSW+TT++DLK+YF  +G+V  C +KLD +TG SRGFGFV  +  +++ KV++  EH+L  K IDPK AK   TKEP KKIFVGGLSPD  EE+I+EYF  +G VES++LP D    KR+ + F++F  E+  K  +  +  +V  SKC++++A+ K+
Sbjct:    2 KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKE 165          

HSP 2 Score: 55.4546 bits (132), Expect = 2.493e-8
Identity = 29/76 (38.16%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPA 479
            +K+FVGGLS +T EE ++ YF  +G+V    + +D  T   RGF F+T + E+ +KK++E   H +   K + K A
Sbjct:   86 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA 161          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Human
Match: HNRNPD (heterogeneous nuclear ribonucleoprotein D [Source:HGNC Symbol;Acc:HGNC:5036])

HSP 1 Score: 169.088 bits (427), Expect = 3.788e-49
Identity = 81/164 (49.39%), Postives = 117/164 (71.34%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP--TKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+F+GGLSW+TT++DLK+YF  +G+V  C +KLD +TG SRGFGFV  +  +++ KV++  EH+L  K IDPK AK   TKEP KKIFVGGLSPD  EE+I+EYF  +G VES++LP D    KR+ + F++F  E+  K  +  +  +V  SKC++++A+ K+
Sbjct:   98 KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKE 261          

HSP 2 Score: 55.8398 bits (133), Expect = 4.249e-8
Identity = 29/76 (38.16%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPA 479
            +K+FVGGLS +T EE ++ YF  +G+V    + +D  T   RGF F+T + E+ +KK++E   H +   K + K A
Sbjct:  182 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA 257          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Human
Match: HNRNPD (heterogeneous nuclear ribonucleoprotein D [Source:HGNC Symbol;Acc:HGNC:5036])

HSP 1 Score: 167.162 bits (422), Expect = 6.058e-49
Identity = 81/164 (49.39%), Postives = 117/164 (71.34%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP--TKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+F+GGLSW+TT++DLK+YF  +G+V  C +KLD +TG SRGFGFV  +  +++ KV++  EH+L  K IDPK AK   TKEP KKIFVGGLSPD  EE+I+EYF  +G VES++LP D    KR+ + F++F  E+  K  +  +  +V  SKC++++A+ K+
Sbjct:   31 KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKE 194          

HSP 2 Score: 55.4546 bits (132), Expect = 4.128e-8
Identity = 29/76 (38.16%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPA 479
            +K+FVGGLS +T EE ++ YF  +G+V    + +D  T   RGF F+T + E+ +KK++E   H +   K + K A
Sbjct:  115 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA 190          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Human
Match: HNRNPD (heterogeneous nuclear ribonucleoprotein D [Source:HGNC Symbol;Acc:HGNC:5036])

HSP 1 Score: 168.318 bits (425), Expect = 1.333e-48
Identity = 81/164 (49.39%), Postives = 117/164 (71.34%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP--TKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+F+GGLSW+TT++DLK+YF  +G+V  C +KLD +TG SRGFGFV  +  +++ KV++  EH+L  K IDPK AK   TKEP KKIFVGGLSPD  EE+I+EYF  +G VES++LP D    KR+ + F++F  E+  K  +  +  +V  SKC++++A+ K+
Sbjct:   79 KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKE 242          

HSP 2 Score: 55.8398 bits (133), Expect = 4.701e-8
Identity = 29/76 (38.16%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPA 479
            +K+FVGGLS +T EE ++ YF  +G+V    + +D  T   RGF F+T + E+ +KK++E   H +   K + K A
Sbjct:  163 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA 238          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Human
Match: HNRNPDL (heterogeneous nuclear ribonucleoprotein D like [Source:HGNC Symbol;Acc:HGNC:5037])

HSP 1 Score: 167.548 bits (423), Expect = 1.335e-48
Identity = 78/164 (47.56%), Postives = 113/164 (68.90%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP--TKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+F+GGLSW+T+++DL  Y   +G+V  C IK D +TG SRGFGFV  +   ++ KVLE+ EH+L  K IDPK AK    KEP KK+FVGGLSPD SEEQIKEYF  +G +E+++LP DT   +R+ + F+++T E+  K  + +    +   KC++++A PK+
Sbjct:   30 KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKE 193          

HSP 2 Score: 63.929 bits (154), Expect = 7.067e-11
Identity = 31/78 (39.74%), Postives = 51/78 (65.38%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            +K+FVGGLS +T+EE +K YF  +G++ +  + +D  T   RGF F+T   E+ +KK+LE   H++ + K + K A+P
Sbjct:  114 KKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQP 191          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Celegans
Match: sqd-1 (Homologous to Drosophila SQD (Squid) protein [Source:UniProtKB/TrEMBL;Acc:Q8MXR6])

HSP 1 Score: 128.642 bits (322), Expect = 2.366e-34
Identity = 64/162 (39.51%), Postives = 96/162 (59.26%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPK 737
            +K+FVGG+S E   EDL ++F  +G+V+   +K D+  G SRGF FV   T +  K  L   E  +K K ++ KPAK  +  NKK+FVGGL  D SE+ ++ +F Q+G V+ ++ PFD     R+ + F+ F  E++A  A    KQ     +CDV+ AVP+
Sbjct:   29 KKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPAKSRE--NKKVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTKQTFGTRECDVKKAVPQ 188          

HSP 2 Score: 65.855 bits (159), Expect = 6.866e-12
Identity = 28/81 (34.57%), Postives = 50/81 (61.73%), Query Frame = 3
Query:  498 NKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            +KKIFVGG+SP+V+ E +  +F+QYG V    + +D + G+ + + F+ FTT +  K A+   +Q + G   +V+ A  ++
Sbjct:   28 DKKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPAKSRE 108          

HSP 3 Score: 51.6026 bits (122), Expect = 3.386e-7
Identity = 35/110 (31.82%), Postives = 54/110 (49.09%), Query Frame = 3
Query:  156 DENVKDKSLLENHCKPEKNDINKMXXXXXXXSRKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            ++ +K KS+     KP K+  NK          K+FVGGL  + +E+DL+++FE +GKV       DK T   R F F+  E E++  K     +     ++ D K A P
Sbjct:   91 EQTIKGKSV---EVKPAKSRENK----------KVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTKQTFGTRECDVKKAVP 187          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Celegans
Match: sqd-1 (Homologous to Drosophila SQD (Squid) protein [Source:UniProtKB/TrEMBL;Acc:Q8MXR6])

HSP 1 Score: 128.642 bits (322), Expect = 2.366e-34
Identity = 64/162 (39.51%), Postives = 96/162 (59.26%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPK 737
            +K+FVGG+S E   EDL ++F  +G+V+   +K D+  G SRGF FV   T +  K  L   E  +K K ++ KPAK  +  NKK+FVGGL  D SE+ ++ +F Q+G V+ ++ PFD     R+ + F+ F  E++A  A    KQ     +CDV+ AVP+
Sbjct:   29 KKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPAKSRE--NKKVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTKQTFGTRECDVKKAVPQ 188          

HSP 2 Score: 65.855 bits (159), Expect = 6.866e-12
Identity = 28/81 (34.57%), Postives = 50/81 (61.73%), Query Frame = 3
Query:  498 NKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            +KKIFVGG+SP+V+ E +  +F+QYG V    + +D + G+ + + F+ FTT +  K A+   +Q + G   +V+ A  ++
Sbjct:   28 DKKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPAKSRE 108          

HSP 3 Score: 51.6026 bits (122), Expect = 3.386e-7
Identity = 35/110 (31.82%), Postives = 54/110 (49.09%), Query Frame = 3
Query:  156 DENVKDKSLLENHCKPEKNDINKMXXXXXXXSRKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            ++ +K KS+     KP K+  NK          K+FVGGL  + +E+DL+++FE +GKV       DK T   R F F+  E E++  K     +     ++ D K A P
Sbjct:   91 EQTIKGKSV---EVKPAKSRENK----------KVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTKQTFGTRECDVKKAVP 187          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Celegans
Match: sqd-1 (Homologous to Drosophila SQD (Squid) protein [Source:UniProtKB/TrEMBL;Acc:Q8MXR6])

HSP 1 Score: 128.642 bits (322), Expect = 2.366e-34
Identity = 64/162 (39.51%), Postives = 96/162 (59.26%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPK 737
            +K+FVGG+S E   EDL ++F  +G+V+   +K D+  G SRGF FV   T +  K  L   E  +K K ++ KPAK  +  NKK+FVGGL  D SE+ ++ +F Q+G V+ ++ PFD     R+ + F+ F  E++A  A    KQ     +CDV+ AVP+
Sbjct:   29 KKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPAKSRE--NKKVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTKQTFGTRECDVKKAVPQ 188          

HSP 2 Score: 65.855 bits (159), Expect = 6.866e-12
Identity = 28/81 (34.57%), Postives = 50/81 (61.73%), Query Frame = 3
Query:  498 NKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            +KKIFVGG+SP+V+ E +  +F+QYG V    + +D + G+ + + F+ FTT +  K A+   +Q + G   +V+ A  ++
Sbjct:   28 DKKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPAKSRE 108          

HSP 3 Score: 51.6026 bits (122), Expect = 3.386e-7
Identity = 35/110 (31.82%), Postives = 54/110 (49.09%), Query Frame = 3
Query:  156 DENVKDKSLLENHCKPEKNDINKMXXXXXXXSRKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            ++ +K KS+     KP K+  NK          K+FVGGL  + +E+DL+++FE +GKV       DK T   R F F+  E E++  K     +     ++ D K A P
Sbjct:   91 EQTIKGKSV---EVKPAKSRENK----------KVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTKQTFGTRECDVKKAVP 187          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Celegans
Match: sqd-1 (Homologous to Drosophila SQD (Squid) protein [Source:UniProtKB/TrEMBL;Acc:Q8MXR6])

HSP 1 Score: 128.642 bits (322), Expect = 2.366e-34
Identity = 64/162 (39.51%), Postives = 96/162 (59.26%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPK 737
            +K+FVGG+S E   EDL ++F  +G+V+   +K D+  G SRGF FV   T +  K  L   E  +K K ++ KPAK  +  NKK+FVGGL  D SE+ ++ +F Q+G V+ ++ PFD     R+ + F+ F  E++A  A    KQ     +CDV+ AVP+
Sbjct:   29 KKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPAKSRE--NKKVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTKQTFGTRECDVKKAVPQ 188          

HSP 2 Score: 65.855 bits (159), Expect = 6.866e-12
Identity = 28/81 (34.57%), Postives = 50/81 (61.73%), Query Frame = 3
Query:  498 NKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            +KKIFVGG+SP+V+ E +  +F+QYG V    + +D + G+ + + F+ FTT +  K A+   +Q + G   +V+ A  ++
Sbjct:   28 DKKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPAKSRE 108          

HSP 3 Score: 51.6026 bits (122), Expect = 3.386e-7
Identity = 35/110 (31.82%), Postives = 54/110 (49.09%), Query Frame = 3
Query:  156 DENVKDKSLLENHCKPEKNDINKMXXXXXXXSRKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            ++ +K KS+     KP K+  NK          K+FVGGL  + +E+DL+++FE +GKV       DK T   R F F+  E E++  K     +     ++ D K A P
Sbjct:   91 EQTIKGKSV---EVKPAKSRENK----------KVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTKQTFGTRECDVKKAVP 187          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Celegans
Match: sqd-1 (Homologous to Drosophila SQD (Squid) protein [Source:UniProtKB/TrEMBL;Acc:Q8MXR6])

HSP 1 Score: 128.642 bits (322), Expect = 2.366e-34
Identity = 64/162 (39.51%), Postives = 96/162 (59.26%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPK 737
            +K+FVGG+S E   EDL ++F  +G+V+   +K D+  G SRGF FV   T +  K  L   E  +K K ++ KPAK  +  NKK+FVGGL  D SE+ ++ +F Q+G V+ ++ PFD     R+ + F+ F  E++A  A    KQ     +CDV+ AVP+
Sbjct:   29 KKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPAKSRE--NKKVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTKQTFGTRECDVKKAVPQ 188          

HSP 2 Score: 65.855 bits (159), Expect = 6.866e-12
Identity = 28/81 (34.57%), Postives = 50/81 (61.73%), Query Frame = 3
Query:  498 NKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            +KKIFVGG+SP+V+ E +  +F+QYG V    + +D + G+ + + F+ FTT +  K A+   +Q + G   +V+ A  ++
Sbjct:   28 DKKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPAKSRE 108          

HSP 3 Score: 51.6026 bits (122), Expect = 3.386e-7
Identity = 35/110 (31.82%), Postives = 54/110 (49.09%), Query Frame = 3
Query:  156 DENVKDKSLLENHCKPEKNDINKMXXXXXXXSRKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            ++ +K KS+     KP K+  NK          K+FVGGL  + +E+DL+++FE +GKV       DK T   R F F+  E E++  K     +     ++ D K A P
Sbjct:   91 EQTIKGKSV---EVKPAKSRENK----------KVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTKQTFGTRECDVKKAVP 187          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Fly
Match: sqd (gene:FBgn0263396 transcript:FBtr0082854)

HSP 1 Score: 150.214 bits (378), Expect = 3.542e-42
Identity = 70/162 (43.21%), Postives = 105/162 (64.81%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPK 737
            RKLFVGGLSWETTE++L+++F  +G++    +K D  TG SRGF F+     + + KV    EH + +KK+DPK AK     + KIFVGGL+ ++S+E+IK YF Q+G +  V++PFD  K +RK + F++F +E    + +   KQ + G + DV+ A PK
Sbjct:   56 RKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKAR---HGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPK 214          

HSP 2 Score: 53.9138 bits (128), Expect = 9.309e-8
Identity = 24/79 (30.38%), Postives = 49/79 (62.03%), Query Frame = 3
Query:  474 PAKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTED------AAKNAIVNEKQ 692
             A   ++ ++K+FVGGLS + +E++++++F +YG +ES+++  D   G+ + + F+ FT  +      AA   I+N K+
Sbjct:   47 AASGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKK 125          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Fly
Match: sqd (gene:FBgn0263396 transcript:FBtr0309094)

HSP 1 Score: 149.443 bits (376), Expect = 5.584e-42
Identity = 70/162 (43.21%), Postives = 105/162 (64.81%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPK 737
            RKLFVGGLSWETTE++L+++F  +G++    +K D  TG SRGF F+     + + KV    EH + +KK+DPK AK     + KIFVGGL+ ++S+E+IK YF Q+G +  V++PFD  K +RK + F++F +E    + +   KQ + G + DV+ A PK
Sbjct:   56 RKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKAR---HGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPK 214          

HSP 2 Score: 53.5286 bits (127), Expect = 1.101e-7
Identity = 24/78 (30.77%), Postives = 49/78 (62.82%), Query Frame = 3
Query:  477 AKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTED------AAKNAIVNEKQ 692
            A   ++ ++K+FVGGLS + +E++++++F +YG +ES+++  D   G+ + + F+ FT  +      AA   I+N K+
Sbjct:   48 ASGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKK 125          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Fly
Match: sqd (gene:FBgn0263396 transcript:FBtr0082856)

HSP 1 Score: 149.443 bits (376), Expect = 5.584e-42
Identity = 70/162 (43.21%), Postives = 105/162 (64.81%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPK 737
            RKLFVGGLSWETTE++L+++F  +G++    +K D  TG SRGF F+     + + KV    EH + +KK+DPK AK     + KIFVGGL+ ++S+E+IK YF Q+G +  V++PFD  K +RK + F++F +E    + +   KQ + G + DV+ A PK
Sbjct:   56 RKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKAR---HGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPK 214          

HSP 2 Score: 53.5286 bits (127), Expect = 1.101e-7
Identity = 24/78 (30.77%), Postives = 49/78 (62.82%), Query Frame = 3
Query:  477 AKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTED------AAKNAIVNEKQ 692
            A   ++ ++K+FVGGLS + +E++++++F +YG +ES+++  D   G+ + + F+ FT  +      AA   I+N K+
Sbjct:   48 ASGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKK 125          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Fly
Match: sqd (gene:FBgn0263396 transcript:FBtr0082855)

HSP 1 Score: 149.058 bits (375), Expect = 1.515e-41
Identity = 70/162 (43.21%), Postives = 105/162 (64.81%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPK 737
            RKLFVGGLSWETTE++L+++F  +G++    +K D  TG SRGF F+     + + KV    EH + +KK+DPK AK     + KIFVGGL+ ++S+E+IK YF Q+G +  V++PFD  K +RK + F++F +E    + +   KQ + G + DV+ A PK
Sbjct:   56 RKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKAR---HGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPK 214          

HSP 2 Score: 53.5286 bits (127), Expect = 1.366e-7
Identity = 24/78 (30.77%), Postives = 49/78 (62.82%), Query Frame = 3
Query:  477 AKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTED------AAKNAIVNEKQ 692
            A   ++ ++K+FVGGLS + +E++++++F +YG +ES+++  D   G+ + + F+ FT  +      AA   I+N K+
Sbjct:   48 ASGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKK 125          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Fly
Match: msi (gene:FBgn0011666 transcript:FBtr0333665)

HSP 1 Score: 132.109 bits (331), Expect = 8.217e-34
Identity = 70/170 (41.18%), Postives = 97/170 (57.06%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTKEP-----NKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKDQVN 749
            KLFVGGLSW+T+ + LK YF  +G V+  +I  D +T  SRGFGF+T +    ++KVL++P H L  KKIDPK A P   P      KKIFVGG+S D S E++K YFSQ+G VE   +  D    + + + F++F  ED            +   K + + A PK+ V 
Sbjct:  137 KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTLDGKKIDPKHATPKNRPRQANKTKKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPKEAVT 306          

HSP 2 Score: 78.9518 bits (193), Expect = 1.212e-15
Identity = 37/79 (46.84%), Postives = 55/79 (69.62%), Query Frame = 3
Query:  249 SRKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            ++K+FVGG+S +T+ E++K YF  +G V   V+ +D+ T   RGFGFVT E ED + +V EI  H +KNKK++ K A+P
Sbjct:  223 TKKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQP 301          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Zebrafish
Match: hnrnpabb (heterogeneous nuclear ribonucleoprotein A/Bb [Source:ZFIN;Acc:ZDB-GENE-040426-2516])

HSP 1 Score: 172.17 bits (435), Expect = 1.388e-50
Identity = 79/163 (48.47%), Postives = 118/163 (72.39%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPT-KEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+FVGGLSW+T+++DLK+YF  +G+V  C IK+D  TG SRGFGF+  +  D++ +VL+  EHRL  ++IDPK A    KEP KKIFVGGL+P+ +EE+I+EYF  +G +E+++LP D    KR+ +VF++F  E A K  +  +  +V GSKC++++A PK+
Sbjct:   46 KMFVGGLSWDTSKKDLKDYFSKFGEVMDCTIKMDSNTGRSRGFGFILFKESDSVDRVLQQKEHRLDGRQIDPKRAMAIKKEPVKKIFVGGLNPETTEEKIREYFGSFGEIETIELPTDPKTSKRRGFVFITFKEEFAVKKILEKKYHNVCGSKCEIKIAQPKE 208          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Zebrafish
Match: hnrnpabb (heterogeneous nuclear ribonucleoprotein A/Bb [Source:ZFIN;Acc:ZDB-GENE-040426-2516])

HSP 1 Score: 172.17 bits (435), Expect = 1.388e-50
Identity = 79/163 (48.47%), Postives = 118/163 (72.39%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPT-KEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+FVGGLSW+T+++DLK+YF  +G+V  C IK+D  TG SRGFGF+  +  D++ +VL+  EHRL  ++IDPK A    KEP KKIFVGGL+P+ +EE+I+EYF  +G +E+++LP D    KR+ +VF++F  E A K  +  +  +V GSKC++++A PK+
Sbjct:   46 KMFVGGLSWDTSKKDLKDYFSKFGEVMDCTIKMDSNTGRSRGFGFILFKESDSVDRVLQQKEHRLDGRQIDPKRAMAIKKEPVKKIFVGGLNPETTEEKIREYFGSFGEIETIELPTDPKTSKRRGFVFITFKEEFAVKKILEKKYHNVCGSKCEIKIAQPKE 208          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Zebrafish
Match: hnrnpdl (heterogeneous nuclear ribonucleoprotein D-like [Source:ZFIN;Acc:ZDB-GENE-040426-2717])

HSP 1 Score: 169.474 bits (428), Expect = 1.220e-49
Identity = 76/164 (46.34%), Postives = 115/164 (70.12%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTK--EPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+F+GGLSW+T+++DL +Y   +G+V  C IK D +TG SRGFGFV  +  +++ +VLE+ EH+L  K IDPK AK  K  EP KK+FVGGLSPD++EEQ++EYF  YG +ES++LP DT   +R+ + F++F  E+  +  + N    +   KC++++A PK+
Sbjct:   31 KMFIGGLSWDTSKKDLTDYLSRFGEVLDCTIKTDPLTGRSRGFGFVLFKDAESVDRVLELTEHKLDGKLIDPKRAKAIKGKEPPKKVFVGGLSPDITEEQLREYFGVYGEIESIELPTDTKTNERRGFCFVTFALEEPVQKLLENRYHQIGSGKCEIKVAQPKE 194          

HSP 2 Score: 62.003 bits (149), Expect = 1.811e-10
Identity = 31/78 (39.74%), Postives = 48/78 (61.54%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            +K+FVGGLS + TEE L+ YF  +G++    +  D  T   RGF FVT   E+ ++K+LE   H++ + K + K A+P
Sbjct:  115 KKVFVGGLSPDITEEQLREYFGVYGEIESIELPTDTKTNERRGFCFVTFALEEPVQKLLENRYHQIGSGKCEIKVAQP 192          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Zebrafish
Match: hnrnpdl (heterogeneous nuclear ribonucleoprotein D-like [Source:ZFIN;Acc:ZDB-GENE-040426-2717])

HSP 1 Score: 169.474 bits (428), Expect = 1.220e-49
Identity = 76/164 (46.34%), Postives = 115/164 (70.12%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTK--EPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+F+GGLSW+T+++DL +Y   +G+V  C IK D +TG SRGFGFV  +  +++ +VLE+ EH+L  K IDPK AK  K  EP KK+FVGGLSPD++EEQ++EYF  YG +ES++LP DT   +R+ + F++F  E+  +  + N    +   KC++++A PK+
Sbjct:   31 KMFIGGLSWDTSKKDLTDYLSRFGEVLDCTIKTDPLTGRSRGFGFVLFKDAESVDRVLELTEHKLDGKLIDPKRAKAIKGKEPPKKVFVGGLSPDITEEQLREYFGVYGEIESIELPTDTKTNERRGFCFVTFALEEPVQKLLENRYHQIGSGKCEIKVAQPKE 194          

HSP 2 Score: 62.003 bits (149), Expect = 1.811e-10
Identity = 31/78 (39.74%), Postives = 48/78 (61.54%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            +K+FVGGLS + TEE L+ YF  +G++    +  D  T   RGF FVT   E+ ++K+LE   H++ + K + K A+P
Sbjct:  115 KKVFVGGLSPDITEEQLREYFGVYGEIESIELPTDTKTNERRGFCFVTFALEEPVQKLLENRYHQIGSGKCEIKVAQP 192          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Zebrafish
Match: hnrnpdl (heterogeneous nuclear ribonucleoprotein D-like [Source:ZFIN;Acc:ZDB-GENE-040426-2717])

HSP 1 Score: 169.474 bits (428), Expect = 1.220e-49
Identity = 76/164 (46.34%), Postives = 115/164 (70.12%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTK--EPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+F+GGLSW+T+++DL +Y   +G+V  C IK D +TG SRGFGFV  +  +++ +VLE+ EH+L  K IDPK AK  K  EP KK+FVGGLSPD++EEQ++EYF  YG +ES++LP DT   +R+ + F++F  E+  +  + N    +   KC++++A PK+
Sbjct:   31 KMFIGGLSWDTSKKDLTDYLSRFGEVLDCTIKTDPLTGRSRGFGFVLFKDAESVDRVLELTEHKLDGKLIDPKRAKAIKGKEPPKKVFVGGLSPDITEEQLREYFGVYGEIESIELPTDTKTNERRGFCFVTFALEEPVQKLLENRYHQIGSGKCEIKVAQPKE 194          

HSP 2 Score: 62.003 bits (149), Expect = 1.811e-10
Identity = 31/78 (39.74%), Postives = 48/78 (61.54%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            +K+FVGGLS + TEE L+ YF  +G++    +  D  T   RGF FVT   E+ ++K+LE   H++ + K + K A+P
Sbjct:  115 KKVFVGGLSPDITEEQLREYFGVYGEIESIELPTDTKTNERRGFCFVTFALEEPVQKLLENRYHQIGSGKCEIKVAQP 192          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Xenopus
Match: adam17 (ADAM metallopeptidase domain 17 [Source:Xenbase;Acc:XB-GENE-492534])

HSP 1 Score: 169.474 bits (428), Expect = 1.766e-49
Identity = 81/164 (49.39%), Postives = 116/164 (70.73%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP--TKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+F+GGLSW+TT++DLK+YF  +G+V  C +KLD +TG SRGFGFV  +  + + KV+E  EH+L  K IDPK AK   TKEP KKIFVGGLSPD  EE+I+EYF  +G +E+++LP D    KR+ + F++F  ED  K  +  +  +V  SKC++++A+ K+
Sbjct:   39 KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESEGVDKVMEQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGTFGEIEAIELPMDNKTNKRRGFCFITFKEEDPVKKIMEKKYHNVGLSKCEIKVALSKE 202          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Xenopus
Match: cep112 (centrosomal protein 112kDa [Source:Xenbase;Acc:XB-GENE-6047288])

HSP 1 Score: 167.162 bits (422), Expect = 4.680e-49
Identity = 78/163 (47.85%), Postives = 116/163 (71.17%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPT-KEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+FVGGLSW+T+++DLK+YF  +G+VS C IK+D  TG SRGFGF+  +   ++ KVLE  EHRL  + IDPK A    K+P KKIFVGGL+P+  E++I+EYF  +G +E+++LP D    KR+ +VF++F  E+  K  +  +  +V GSKC++++A PK+
Sbjct:   53 KMFVGGLSWDTSKKDLKDYFSKFGEVSDCTIKMDPNTGRSRGFGFILFKDAASVDKVLEQKEHRLDGRLIDPKKAMAMKKDPIKKIFVGGLNPEAGEDKIREYFETFGEIEAIELPMDPKTNKRRGFVFITFKEEEPVKKILEKKFHNVSGSKCEIKIAQPKE 215          

HSP 2 Score: 62.7734 bits (151), Expect = 1.287e-10
Identity = 30/78 (38.46%), Postives = 49/78 (62.82%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            +K+FVGGL+ E  E+ ++ YFET+G++    + +D  T   RGF F+T + E+ +KK+LE   H +   K + K A+P
Sbjct:  136 KKIFVGGLNPEAGEDKIREYFETFGEIEAIELPMDPKTNKRRGFVFITFKEEEPVKKILEKKFHNVSGSKCEIKIAQP 213          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Xenopus
Match: cep112 (centrosomal protein 112kDa [Source:Xenbase;Acc:XB-GENE-6047288])

HSP 1 Score: 166.392 bits (420), Expect = 5.567e-48
Identity = 78/163 (47.85%), Postives = 116/163 (71.17%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPT-KEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+FVGGLSW+T+++DLK+YF  +G+VS C IK+D  TG SRGFGF+  +   ++ KVLE  EHRL  + IDPK A    K+P KKIFVGGL+P+  E++I+EYF  +G +E+++LP D    KR+ +VF++F  E+  K  +  +  +V GSKC++++A PK+
Sbjct:   66 KMFVGGLSWDTSKKDLKDYFSKFGEVSDCTIKMDPNTGRSRGFGFILFKDAASVDKVLEQKEHRLDGRLIDPKKAMAMKKDPIKKIFVGGLNPEAGEDKIREYFETFGEIEAIELPMDPKTNKRRGFVFITFKEEEPVKKILEKKFHNVSGSKCEIKIAQPKE 228          

HSP 2 Score: 62.003 bits (149), Expect = 3.399e-10
Identity = 30/78 (38.46%), Postives = 49/78 (62.82%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            +K+FVGGL+ E  E+ ++ YFET+G++    + +D  T   RGF F+T + E+ +KK+LE   H +   K + K A+P
Sbjct:  149 KKIFVGGLNPEAGEDKIREYFETFGEIEAIELPMDPKTNKRRGFVFITFKEEEPVKKILEKKFHNVSGSKCEIKIAQP 226          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Xenopus
Match: h2bc21 (H2B clustered histone 21 [Source:Xenbase;Acc:XB-GENE-6452473])

HSP 1 Score: 159.073 bits (401), Expect = 1.067e-45
Identity = 75/164 (45.73%), Postives = 112/164 (68.29%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP--TKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+F+GGLSW+T+++DL  Y   +G+V  C IK D +TG SRGFGFV  +   ++ KVLE  EH+L  K IDPK AK    KEP KK+FVGGLSP+ +EEQIK+YF  +G +E+++LP DT   +R+ + F+++T E+  K  + +    +   KC++++A PK+
Sbjct:   27 KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAVSVDKVLETKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPETTEEQIKQYFGGFGEIENIELPMDTKTNERRGFCFVTYTGEEPVKKLLESRFHQIGTGKCEIKVAQPKE 190          

HSP 2 Score: 65.855 bits (159), Expect = 1.281e-11
Identity = 34/78 (43.59%), Postives = 50/78 (64.10%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            +K+FVGGLS ETTEE +K YF  +G++ +  + +D  T   RGF FVT   E+ +KK+LE   H++   K + K A+P
Sbjct:  111 KKVFVGGLSPETTEEQIKQYFGGFGEIENIELPMDTKTNERRGFCFVTYTGEEPVKKLLESRFHQIGTGKCEIKVAQP 188          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Xenopus
Match: h2bc21 (H2B clustered histone 21 [Source:Xenbase;Acc:XB-GENE-6452473])

HSP 1 Score: 159.073 bits (401), Expect = 1.589e-45
Identity = 75/164 (45.73%), Postives = 112/164 (68.29%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP--TKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+F+GGLSW+T+++DL  Y   +G+V  C IK D +TG SRGFGFV  +   ++ KVLE  EH+L  K IDPK AK    KEP KK+FVGGLSP+ +EEQIK+YF  +G +E+++LP DT   +R+ + F+++T E+  K  + +    +   KC++++A PK+
Sbjct:   27 KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAVSVDKVLETKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPETTEEQIKQYFGGFGEIENIELPMDTKTNERRGFCFVTYTGEEPVKKLLESRFHQIGTGKCEIKVAQPKE 190          

HSP 2 Score: 65.855 bits (159), Expect = 1.477e-11
Identity = 34/78 (43.59%), Postives = 50/78 (64.10%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            +K+FVGGLS ETTEE +K YF  +G++ +  + +D  T   RGF FVT   E+ +KK+LE   H++   K + K A+P
Sbjct:  111 KKVFVGGLSPETTEEQIKQYFGGFGEIENIELPMDTKTNERRGFCFVTYTGEEPVKKLLESRFHQIGTGKCEIKVAQP 188          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Mouse
Match: Hnrnpd (heterogeneous nuclear ribonucleoprotein D [Source:MGI Symbol;Acc:MGI:101947])

HSP 1 Score: 167.933 bits (424), Expect = 5.914e-50
Identity = 81/164 (49.39%), Postives = 117/164 (71.34%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP--TKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+F+GGLSW+TT++DLK+YF  +G+V  C +KLD +TG SRGFGFV  +  +++ KV++  EH+L  K IDPK AK   TKEP KKIFVGGLSPD  EE+I+EYF  +G VES++LP D    KR+ + F++F  E+  K  +  +  +V  SKC++++A+ K+
Sbjct:    8 KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKE 171          

HSP 2 Score: 55.0694 bits (131), Expect = 2.224e-8
Identity = 29/76 (38.16%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPA 479
            +K+FVGGLS +T EE ++ YF  +G+V    + +D  T   RGF F+T + E+ +KK++E   H +   K + K A
Sbjct:   92 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA 167          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Mouse
Match: Hnrnpab (heterogeneous nuclear ribonucleoprotein A/B [Source:MGI Symbol;Acc:MGI:1330294])

HSP 1 Score: 169.859 bits (429), Expect = 7.103e-50
Identity = 79/163 (48.47%), Postives = 117/163 (71.78%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTK-EPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+FVGGLSW+T+++DLK+YF  +G+V  C IK+D  TG SRGFGF+  +   +++KVL+  EHRL  + IDPK A   K +P KKIFVGGL+P+ +EE+I+EYF Q+G +E+++LP D    KR+ +VF++F  ED  K  +  +   V GSKC++++A PK+
Sbjct:   76 KMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDSSSVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGQFGEIEAIELPIDPKLNKRRGFVFITFKEEDPVKKVLEKKFHTVSGSKCEIKVAQPKE 238          

HSP 2 Score: 61.6178 bits (148), Expect = 2.747e-10
Identity = 31/78 (39.74%), Postives = 47/78 (60.26%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            +K+FVGGL+ E TEE ++ YF  +G++    + +D      RGF F+T + ED +KKVLE   H +   K + K A+P
Sbjct:  159 KKIFVGGLNPEATEEKIREYFGQFGEIEAIELPIDPKLNKRRGFVFITFKEEDPVKKVLEKKFHTVSGSKCEIKVAQP 236          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Mouse
Match: Hnrnpd (heterogeneous nuclear ribonucleoprotein D [Source:MGI Symbol;Acc:MGI:101947])

HSP 1 Score: 168.703 bits (426), Expect = 1.854e-49
Identity = 81/164 (49.39%), Postives = 117/164 (71.34%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP--TKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+F+GGLSW+TT++DLK+YF  +G+V  C +KLD +TG SRGFGFV  +  +++ KV++  EH+L  K IDPK AK   TKEP KKIFVGGLSPD  EE+I+EYF  +G VES++LP D    KR+ + F++F  E+  K  +  +  +V  SKC++++A+ K+
Sbjct:   79 KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKE 242          

HSP 2 Score: 55.8398 bits (133), Expect = 2.429e-8
Identity = 29/76 (38.16%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPA 479
            +K+FVGGLS +T EE ++ YF  +G+V    + +D  T   RGF F+T + E+ +KK++E   H +   K + K A
Sbjct:  163 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA 238          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Mouse
Match: Hnrnpab (heterogeneous nuclear ribonucleoprotein A/B [Source:MGI Symbol;Acc:MGI:1330294])

HSP 1 Score: 169.474 bits (428), Expect = 2.298e-49
Identity = 79/163 (48.47%), Postives = 117/163 (71.78%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTK-EPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+FVGGLSW+T+++DLK+YF  +G+V  C IK+D  TG SRGFGF+  +   +++KVL+  EHRL  + IDPK A   K +P KKIFVGGL+P+ +EE+I+EYF Q+G +E+++LP D    KR+ +VF++F  ED  K  +  +   V GSKC++++A PK+
Sbjct:   76 KMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDSSSVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGQFGEIEAIELPIDPKLNKRRGFVFITFKEEDPVKKVLEKKFHTVSGSKCEIKVAQPKE 238          

HSP 2 Score: 60.8474 bits (146), Expect = 5.274e-10
Identity = 31/78 (39.74%), Postives = 47/78 (60.26%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            +K+FVGGL+ E TEE ++ YF  +G++    + +D      RGF F+T + ED +KKVLE   H +   K + K A+P
Sbjct:  159 KKIFVGGLNPEATEEKIREYFGQFGEIEAIELPIDPKLNKRRGFVFITFKEEDPVKKVLEKKFHTVSGSKCEIKVAQP 236          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Mouse
Match: Hnrnpd (heterogeneous nuclear ribonucleoprotein D [Source:MGI Symbol;Acc:MGI:101947])

HSP 1 Score: 169.088 bits (427), Expect = 2.493e-49
Identity = 81/164 (49.39%), Postives = 117/164 (71.34%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP--TKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+F+GGLSW+TT++DLK+YF  +G+V  C +KLD +TG SRGFGFV  +  +++ KV++  EH+L  K IDPK AK   TKEP KKIFVGGLSPD  EE+I+EYF  +G VES++LP D    KR+ + F++F  E+  K  +  +  +V  SKC++++A+ K+
Sbjct:   98 KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKE 261          

HSP 2 Score: 55.8398 bits (133), Expect = 2.813e-8
Identity = 29/76 (38.16%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPA 479
            +K+FVGGLS +T EE ++ YF  +G+V    + +D  T   RGF F+T + E+ +KK++E   H +   K + K A
Sbjct:  182 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA 257          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. UniProt/SwissProt
Match: sp|Q99020|ROAA_MOUSE (Heterogeneous nuclear ribonucleoprotein A/B OS=Mus musculus OX=10090 GN=Hnrnpab PE=1 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 4.968e-49
Identity = 79/163 (48.47%), Postives = 117/163 (71.78%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTK-EPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+FVGGLSW+T+++DLK+YF  +G+V  C IK+D  TG SRGFGF+  +   +++KVL+  EHRL  + IDPK A   K +P KKIFVGGL+P+ +EE+I+EYF Q+G +E+++LP D    KR+ +VF++F  ED  K  +  +   V GSKC++++A PK+
Sbjct:   76 KMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDSSSVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGQFGEIEAIELPIDPKLNKRRGFVFITFKEEDPVKKVLEKKFHTVSGSKCEIKVAQPKE 238          

HSP 2 Score: 61.6178 bits (148), Expect = 1.921e-9
Identity = 31/78 (39.74%), Postives = 47/78 (60.26%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            +K+FVGGL+ E TEE ++ YF  +G++    + +D      RGF F+T + ED +KKVLE   H +   K + K A+P
Sbjct:  159 KKIFVGGLNPEATEEKIREYFGQFGEIEAIELPIDPKLNKRRGFVFITFKEEDPVKKVLEKKFHTVSGSKCEIKVAQP 236          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. UniProt/SwissProt
Match: sp|Q5ZI72|HNRDL_CHICK (Heterogeneous nuclear ribonucleoprotein D-like OS=Gallus gallus OX=9031 GN=HNRNPDL PE=2 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 5.183e-48
Identity = 78/164 (47.56%), Postives = 114/164 (69.51%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP--TKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+F+GGLSW+T+++DL  Y   +G+V  C IK D +TG SRGFGFV  +   +++KVLE+ EH+L  K IDPK AK    KEP KK+FVGGLSPD SEEQIKEYF  +G +E+++LP DT   +R+ + F+++T E+  K  + +    +   KC++++A PK+
Sbjct:   31 KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVEKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKE 194          

HSP 2 Score: 63.929 bits (154), Expect = 4.045e-10
Identity = 31/78 (39.74%), Postives = 51/78 (65.38%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            +K+FVGGLS +T+EE +K YF  +G++ +  + +D  T   RGF F+T   E+ +KK+LE   H++ + K + K A+P
Sbjct:  115 KKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQP 192          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. UniProt/SwissProt
Match: sp|Q9Z130|HNRDL_MOUSE (Heterogeneous nuclear ribonucleoprotein D-like OS=Mus musculus OX=10090 GN=Hnrnpdl PE=1 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 6.547e-48
Identity = 78/164 (47.56%), Postives = 113/164 (68.90%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP--TKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+F+GGLSW+T+++DL  Y   +G+V  C IK D +TG SRGFGFV  +   ++ KVLE+ EH+L  K IDPK AK    KEP KK+FVGGLSPD SEEQIKEYF  +G +E+++LP DT   +R+ + F+++T E+  K  + +    +   KC++++A PK+
Sbjct:   30 KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKE 193          

HSP 2 Score: 63.929 bits (154), Expect = 3.489e-10
Identity = 31/78 (39.74%), Postives = 51/78 (65.38%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            +K+FVGGLS +T+EE +K YF  +G++ +  + +D  T   RGF F+T   E+ +KK+LE   H++ + K + K A+P
Sbjct:  114 KKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQP 191          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. UniProt/SwissProt
Match: sp|Q14103|HNRPD_HUMAN (Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD PE=1 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 8.348e-48
Identity = 81/164 (49.39%), Postives = 117/164 (71.34%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP--TKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+F+GGLSW+TT++DLK+YF  +G+V  C +KLD +TG SRGFGFV  +  +++ KV++  EH+L  K IDPK AK   TKEP KKIFVGGLSPD  EE+I+EYF  +G VES++LP D    KR+ + F++F  E+  K  +  +  +V  SKC++++A+ K+
Sbjct:   98 KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKE 261          

HSP 2 Score: 55.8398 bits (133), Expect = 2.530e-7
Identity = 29/76 (38.16%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPA 479
            +K+FVGGLS +T EE ++ YF  +G+V    + +D  T   RGF F+T + E+ +KK++E   H +   K + K A
Sbjct:  182 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA 257          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. UniProt/SwissProt
Match: sp|Q60668|HNRPD_MOUSE (Heterogeneous nuclear ribonucleoprotein D0 OS=Mus musculus OX=10090 GN=Hnrnpd PE=1 SV=2)

HSP 1 Score: 168.703 bits (426), Expect = 8.989e-48
Identity = 81/164 (49.39%), Postives = 117/164 (71.34%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP--TKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+F+GGLSW+TT++DLK+YF  +G+V  C +KLD +TG SRGFGFV  +  +++ KV++  EH+L  K IDPK AK   TKEP KKIFVGGLSPD  EE+I+EYF  +G VES++LP D    KR+ + F++F  E+  K  +  +  +V  SKC++++A+ K+
Sbjct:   98 KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKE 261          

HSP 2 Score: 55.4546 bits (132), Expect = 2.599e-7
Identity = 29/76 (38.16%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPA 479
            +K+FVGGLS +T EE ++ YF  +G+V    + +D  T   RGF F+T + E+ +KK++E   H +   K + K A
Sbjct:  182 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA 257          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. TrEMBL
Match: A4V6K2 (PRM10 protein (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 379.022 bits (972), Expect = 1.005e-127
Identity = 195/232 (84.05%), Postives = 213/232 (91.81%), Query Frame = 3
Query:   81 TNFCEDIENVNEEKEINDNFCQEDDDENVKD-KSLLENHCKP-EKNDINKMXXXXXXXSRKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKDQVNKNKMAAW 770
            +NF E+ +NV+E  E + NF QED++E +KD  SLLENH K  +K D    + DEDDDSRKLFVGGLSWETTEEDLKNYFETWGKV+HCVIKLDKMTGNSRGFGFVTM+TED+LKKVLE+PEHRLKNKKIDPKPAKPTKEPNKKIFVGGLSP+V+EEQIKEYFSQYG+VESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAI+NEKQDVLGSKCDVRMAVPKDQVNKNKMAAW
Sbjct:   13 SNFNENTDNVHEPSENDTNFIQEDENEIIKDDGSLLENHEKSNDKADSINNKVDEDDDSRKLFVGGLSWETTEEDLKNYFETWGKVAHCVIKLDKMTGNSRGFGFVTMDTEDSLKKVLEVPEHRLKNKKIDPKPAKPTKEPNKKIFVGGLSPEVTEEQIKEYFSQYGSVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIINEKQDVLGSKCDVRMAVPKDQVNKNKMAAW 244          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. TrEMBL
Match: G4LYB6 (Heterogeneous nuclear ribonucleoprotein,putative OS=Schistosoma mansoni OX=6183 GN=Smp_056810.2 PE=4 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 1.694e-80
Identity = 118/172 (68.60%), Postives = 145/172 (84.30%), Query Frame = 3
Query:  249 SRKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKDQVNKNKMA 764
            SRKLFVGGLSWET E DLK YF  WGKV+ C+IKLD+ TGNSRGFGFVT+E+ED + KVL +PEH LKNKKIDPK AKP++EP KKIFVGG+ P+V+E+QI+EYFS +G VES+DLP+DT KGKRK Y+F+SF+TE AAK AI  E+QD+ G +CDVR+AV +DQ N+ K+A
Sbjct:   50 SRKLFVGGLSWETNENDLKEYFSRWGKVTQCIIKLDRFTGNSRGFGFVTLESEDCVSKVLSVPEHWLKNKKIDPKKAKPSREPLKKIFVGGIDPEVTEDQIREYFSSFGKVESLDLPYDTQKGKRKHYIFVSFSTEAAAKKAISKERQDIFGRQCDVRVAVTRDQANRQKVA 221          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. TrEMBL
Match: G4LYB8 (Heterogeneous nuclear ribonucleoprotein,putative OS=Schistosoma mansoni OX=6183 GN=Smp_056810.3 PE=4 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 1.336e-79
Identity = 117/170 (68.82%), Postives = 143/170 (84.12%), Query Frame = 3
Query:  249 SRKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKDQVNKNK 758
            SRKLFVGGLSWET E DLK YF  WGKV+ C+IKLD+ TGNSRGFGFVT+E+ED + KVL +PEH LKNKKIDPK AKP++EP KKIFVGG+ P+V+E+QI+EYFS +G VES+DLP+DT KGKRK Y+F+SF+TE AAK AI  E+QD+ G +CDVR+AV +DQ N+ K
Sbjct:   50 SRKLFVGGLSWETNENDLKEYFSRWGKVTQCIIKLDRFTGNSRGFGFVTLESEDCVSKVLSVPEHWLKNKKIDPKKAKPSREPLKKIFVGGIDPEVTEDQIREYFSSFGKVESLDLPYDTQKGKRKHYIFVSFSTEAAAKKAISKERQDIFGRQCDVRVAVTRDQANRQK 219          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. TrEMBL
Match: A0A4Z2CMJ4 (Heterogeneous nuclear ribonucleoprotein A/B isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_009235 PE=4 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 6.780e-79
Identity = 114/172 (66.28%), Postives = 145/172 (84.30%), Query Frame = 3
Query:  249 SRKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKDQVNKNKMA 764
            SRKLFVGGLSWET E DLK YF  WGKV+ C+IKLD+ TGNSRGFGFVT+E+ED + KVL + EH LKNKKIDPK AKP++EP +KIFVGG+ P+V+E+QI+EYFS +G VES+DLP+DT KGKRK Y+F+SF+TE AA+ AI  E+Q++ G +CDVR+AV +DQ N++K+A
Sbjct:   58 SRKLFVGGLSWETNESDLKEYFSRWGKVTQCIIKLDRFTGNSRGFGFVTLESEDCVSKVLSVSEHWLKNKKIDPKKAKPSREPLRKIFVGGIDPEVTEDQIREYFSSFGKVESLDLPYDTQKGKRKHYIFVSFSTEAAARKAISKERQEIFGRQCDVRVAVTRDQANRHKVA 229          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. TrEMBL
Match: A0A4Z2CMS8 (Heterogeneous nuclear ribonucleoprotein A/B isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_009235 PE=4 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 3.600e-78
Identity = 114/172 (66.28%), Postives = 145/172 (84.30%), Query Frame = 3
Query:  249 SRKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKDQVNKNKMA 764
            SRKLFVGGLSWET E DLK YF  WGKV+ C+IKLD+ TGNSRGFGFVT+E+ED + KVL + EH LKNKKIDPK AKP++EP +KIFVGG+ P+V+E+QI+EYFS +G VES+DLP+DT KGKRK Y+F+SF+TE AA+ AI  E+Q++ G +CDVR+AV +DQ N++K+A
Sbjct:   58 SRKLFVGGLSWETNESDLKEYFSRWGKVTQCIIKLDRFTGNSRGFGFVTLESEDCVSKVLSVSEHWLKNKKIDPKKAKPSREPLRKIFVGGIDPEVTEDQIREYFSSFGKVESLDLPYDTQKGKRKHYIFVSFSTEAAARKAISKERQEIFGRQCDVRVAVTRDQANRHKVA 229          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Cavefish
Match: hnrnpabb (heterogeneous nuclear ribonucleoprotein A/B [Source:NCBI gene;Acc:103033389])

HSP 1 Score: 171.4 bits (433), Expect = 3.140e-50
Identity = 79/163 (48.47%), Postives = 118/163 (72.39%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPT-KEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+FVGGLSW+T+++DLK+YF  +G+V+ C IK+D  TG SRGFGF+  +   +++KVL+  EHRL  ++IDPK A    K+P KKIFVGGL+P+ +EE+I+EYF  +G +ES++LP D    KR+ +VF++F  E A K  +  +   V GSKC++++A PK+
Sbjct:   54 KMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDSNTGRSRGFGFILFKEAASVEKVLQQKEHRLDGRQIDPKKAMAMKKDPVKKIFVGGLNPETTEEKIREYFGAFGEIESIELPTDPKTNKRRGFVFITFKEESAVKKIMEKKYHTVNGSKCEIKIAQPKE 216          

HSP 2 Score: 61.2326 bits (147), Expect = 3.244e-10
Identity = 30/78 (38.46%), Postives = 47/78 (60.26%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            +K+FVGGL+ ETTEE ++ YF  +G++    +  D  T   RGF F+T + E  +KK++E   H +   K + K A+P
Sbjct:  137 KKIFVGGLNPETTEEKIREYFGAFGEIESIELPTDPKTNKRRGFVFITFKEESAVKKIMEKKYHTVNGSKCEIKIAQP 214          

HSP 3 Score: 52.7582 bits (125), Expect = 2.093e-7
Identity = 33/95 (34.74%), Postives = 57/95 (60.00%), Query Frame = 3
Query:  477 AKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVL-GSKCDVR--MAVPKDQVNK 752
            A  ++E   K+FVGGLS D S++ +K+YFS++G V    +  D++ G+ + + F+ F  E A+   ++ +K+  L G + D +  MA+ KD V K
Sbjct:   45 ASKSEEDAGKMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDSNTGRSRGFGFILF-KEAASVEKVLQQKEHRLDGRQIDPKKAMAMKKDPVKK 138          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Cavefish
Match: hnrnpabb (heterogeneous nuclear ribonucleoprotein A/B [Source:NCBI gene;Acc:103033389])

HSP 1 Score: 170.629 bits (431), Expect = 1.059e-49
Identity = 79/163 (48.47%), Postives = 118/163 (72.39%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPT-KEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+FVGGLSW+T+++DLK+YF  +G+V+ C IK+D  TG SRGFGF+  +   +++KVL+  EHRL  ++IDPK A    K+P KKIFVGGL+P+ +EE+I+EYF  +G +ES++LP D    KR+ +VF++F  E A K  +  +   V GSKC++++A PK+
Sbjct:   54 KMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDSNTGRSRGFGFILFKEAASVEKVLQQKEHRLDGRQIDPKKAMAMKKDPVKKIFVGGLNPETTEEKIREYFGAFGEIESIELPTDPKTNKRRGFVFITFKEESAVKKIMEKKYHTVNGSKCEIKIAQPKE 216          

HSP 2 Score: 60.8474 bits (146), Expect = 6.357e-10
Identity = 30/78 (38.46%), Postives = 47/78 (60.26%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            +K+FVGGL+ ETTEE ++ YF  +G++    +  D  T   RGF F+T + E  +KK++E   H +   K + K A+P
Sbjct:  137 KKIFVGGLNPETTEEKIREYFGAFGEIESIELPTDPKTNKRRGFVFITFKEESAVKKIMEKKYHTVNGSKCEIKIAQP 214          

HSP 3 Score: 53.1434 bits (126), Expect = 1.626e-7
Identity = 33/95 (34.74%), Postives = 57/95 (60.00%), Query Frame = 3
Query:  477 AKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVL-GSKCDVR--MAVPKDQVNK 752
            A  ++E   K+FVGGLS D S++ +K+YFS++G V    +  D++ G+ + + F+ F  E A+   ++ +K+  L G + D +  MA+ KD V K
Sbjct:   45 ASKSEEDAGKMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDSNTGRSRGFGFILF-KEAASVEKVLQQKEHRLDGRQIDPKKAMAMKKDPVKK 138          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Cavefish
Match: hnrnpd (heterogeneous nuclear ribonucleoprotein D0 [Source:NCBI gene;Acc:103022948])

HSP 1 Score: 169.474 bits (428), Expect = 1.400e-49
Identity = 81/164 (49.39%), Postives = 119/164 (72.56%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP--TKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+FVGGLSW+TT++DLK+YF  +G+V  C +KLD MTG SRGFGFV  +  ++++KV++  EH+L  K IDPK AK   +KEP KKIFVGGLSPD  EE+I+EYF+ YG VES++LP +    KR+ + F++F  E+  K  +  +  ++  SKC++++A+ K+
Sbjct:   51 KMFVGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPMTGRSRGFGFVLFKEAESVEKVIQQKEHKLNGKVIDPKKAKAMKSKEPVKKIFVGGLSPDTPEEKIREYFNAYGEVESIELPMENKTNKRRGFCFITFKEEEPVKKIMEKKYHNIGLSKCEIKVAMSKE 214          

HSP 2 Score: 55.8398 bits (133), Expect = 2.012e-8
Identity = 28/76 (36.84%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPA 479
            +K+FVGGLS +T EE ++ YF  +G+V    + ++  T   RGF F+T + E+ +KK++E   H +   K + K A
Sbjct:  135 KKIFVGGLSPDTPEEKIREYFNAYGEVESIELPMENKTNKRRGFCFITFKEEEPVKKIMEKKYHNIGLSKCEIKVA 210          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Cavefish
Match: hnrnpdl (heterogeneous nuclear ribonucleoprotein D like [Source:NCBI gene;Acc:103023995])

HSP 1 Score: 164.466 bits (415), Expect = 8.492e-48
Identity = 74/164 (45.12%), Postives = 112/164 (68.29%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPT--KEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+F+GGLSW+T+++DL +Y   +G+V  C IK D MTG SRGFGFV     +++ +VLE+ EH+L  K IDPK AK    KEP KK+FVGGL P+ +EEQ++EYF  YGT+E+++LP D    +R+ + F+++  E+  +  + N    +   KC+V++A PK+
Sbjct:   32 KMFIGGLSWDTSKKDLTDYLSKFGEVLDCTIKTDPMTGRSRGFGFVLFRDAESVDRVLELKEHKLDGKLIDPKRAKAMKGKEPPKKVFVGGLHPETTEEQVREYFGNYGTIENIELPVDGKTNERRGFCFVTYVEEEPVQKLLENRYHQIGSGKCEVKVAQPKE 195          

HSP 2 Score: 62.003 bits (149), Expect = 2.102e-10
Identity = 31/78 (39.74%), Postives = 49/78 (62.82%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            +K+FVGGL  ETTEE ++ YF  +G + +  + +D  T   RGF FVT   E+ ++K+LE   H++ + K + K A+P
Sbjct:  116 KKVFVGGLHPETTEEQVREYFGNYGTIENIELPVDGKTNERRGFCFVTYVEEEPVQKLLENRYHQIGSGKCEVKVAQP 193          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Cavefish
Match: hnrnpaba (heterogeneous nuclear ribonucleoprotein A/B-like [Source:NCBI gene;Acc:103028658])

HSP 1 Score: 163.31 bits (412), Expect = 4.695e-47
Identity = 88/234 (37.61%), Postives = 140/234 (59.83%), Query Frame = 3
Query:   66 VNDVSTNFCEDIENVNEEKEINDNFCQEDDDENVKDKSLLENHCKPEKNDINKMXXXXXXXSRKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPT-KEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSK--------CDVRMAVPKD 740
            ++D    F E  EN +E  + N     ++   +       + +   E   I       ++D+ K+FVGGLSW+T+++DLK+YF  +G+V+ C IK+D  TG SRGFGF+  +   +++KVL   EHRL  ++IDPK A    KEP KKIFVGGL+P+ +EE+I+EYF  +G +E+++LP D    KR+ +VF+SF  E+  K  +  +  +V G+K        C++++A PK+
Sbjct:    1 MSDAEQQFMETSENGHEGDDFNGAEGYDEASADADKDGAGDQNGAGEGGQIE--ASKGEEDAGKMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDPNTGRSRGFGFILFKDSASVEKVLTQKEHRLDGRQIDPKKAMAMKKEPVKKIFVGGLNPETTEERIREYFGAFGEIETIELPMDPKTNKRRGFVFISFKEEEPVKKILEKKYHNVSGTKDSNGKEGLCEIKIAQPKE 232          

HSP 2 Score: 48.9062 bits (115), Expect = 4.139e-6
Identity = 28/94 (29.79%), Postives = 52/94 (55.32%), Query Frame = 3
Query:  477 AKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVR--MAVPKDQVNK 752
            A   +E   K+FVGGLS D S++ +K+YFS++G V    +  D + G+ + + F+ F    + +  +  ++  + G + D +  MA+ K+ V K
Sbjct:   53 ASKGEEDAGKMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDPNTGRSRGFGFILFKDSASVEKVLTQKEHRLDGRQIDPKKAMAMKKEPVKK 146          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004893.1 (pep scaffold:Pmarinus_7.0:GL479484:4:2056:-1 gene:ENSPMAG00000004449.1 transcript:ENSPMAT00000004893.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 136.732 bits (343), Expect = 1.099e-38
Identity = 64/174 (36.78%), Postives = 102/174 (58.62%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPA-------KPTKEPN-KKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKDQVN 749
            RKLFVGGLS+ETTEE L+ YFE WG ++ CV+  D  +  SRGFGFVT  +   +   +    H++  + ++PK A       +P    + KKIFVGG+  D  EE +++YF +YG +E V++  +   GK++ + F++F   D     +V +   + G  C++R A+PK ++ 
Sbjct:   11 RKLFVGGLSFETTEEGLRQYFEQWGSLTDCVVMKDTQSKRSRGFGFVTFSSMSEVDAAMSARPHKIDGRMVEPKRAVSREDSMRPGAHLSVKKIFVGGIKDDTDEEHLRDYFEKYGRIEIVEVMTERESGKKRGFAFVTFNDHDPVDKIVVQKYHTINGHNCEIRKALPKQELQ 184          

HSP 2 Score: 48.1358 bits (113), Expect = 8.491e-7
Identity = 26/87 (29.89%), Postives = 47/87 (54.02%), Query Frame = 3
Query:  492 EPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKDQVNK 752
            E  +K+FVGGLS + +EE +++YF Q+G++    +  DT   + + + F++F++      A+          K D RM  PK  V++
Sbjct:    8 EQFRKLFVGGLSFETTEEGLRQYFEQWGSLTDCVVMKDTQSKRSRGFGFVTFSSMSEVDAAMSARPH-----KIDGRMVEPKRAVSR 89          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 139.043 bits (349), Expect = 3.451e-38
Identity = 69/174 (39.66%), Postives = 106/174 (60.92%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPA-------KPTKEPN-KKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKDQVN 749
            RKLF+GGLS+ETTEE ++ +FE WG ++ CV+  D  T  SRGFGFVT  + + +   +E+  H L  + ++ K A       KP      KKIFVGG+  +  E+ +++YFS+YG VESVD+  D   GK++ + F++F+  DA    +V +   + G K +VR A+ K ++N
Sbjct:   33 RKLFIGGLSFETTEESMQKHFEQWGTLTDCVVMRDPHTKRSRGFGFVTYMSAEEVDAAMEVRPHHLDGRVVEAKRAISREDSLKPGAHLKVKKIFVGGIKDNTDEDHLRDYFSEYGMVESVDVMEDRQSGKKRGFGFVTFSDHDAVDKVVVQKYHTINGHKAEVRKALSKQEMN 206          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 134.42 bits (337), Expect = 5.777e-38
Identity = 67/174 (38.51%), Postives = 102/174 (58.62%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPA-------KPTKEPN-KKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKDQVN 749
            RKLF+GGLS+ETTE+ ++ +FE WG ++ CV+  D  T  SRGFGFVT    + +   ++   H L N+ ++ K A       KP      KKIFVGG+  D  E+ ++EYF  YG VE+ ++  D S GK++ + F++F+  D     IV +   + G K +VR A+ K ++N
Sbjct:    9 RKLFIGGLSFETTEDSMRKHFEQWGTLTDCVVMRDPHTKRSRGFGFVTYTCPEEVDAAMDARPHHLDNRVVEAKRAISREDSLKPGAHLKVKKIFVGGIRDDTDEQHLREYFQVYGDVEAAEVMEDRSTGKKRGFGFVTFSDHDTVDKVIVQKYHTINGHKAEVRKALSKQEMN 182          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Sea Lamprey
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 123.25 bits (308), Expect = 2.705e-33
Identity = 59/177 (33.33%), Postives = 99/177 (55.93%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTKEPN-------KKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKDQVNKNKM 761
            RKLF+GGLS+ETTEE L+ Y+E WG +  CV+  D  +  SRGFGF+T    + +   ++   H +  + ++ K A P  +         KK+FVGG+  +  E  +++YFS++G VESVD+  D   GK++ + F++F   D     +  +   +   K +VR A+ + ++   +M
Sbjct:   14 RKLFIGGLSFETTEESLREYYEQWGTIVDCVVMKDPSSKRSRGFGFITYSVMEEVNSAMQARPHTVDGRVVEAKRAVPRDDSRPGIQVTVKKLFVGGIKDNTDESHLRDYFSKFGRVESVDMVTDKQTGKKRGFAFVTFDDYDPVDQIVFQKFHTINCHKLEVRKALSRHEMETMQM 190          

HSP 2 Score: 53.5286 bits (127), Expect = 1.804e-8
Identity = 26/89 (29.21%), Postives = 51/89 (57.30%), Query Frame = 3
Query:  474 PAKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            P +P  E  +K+F+GGLS + +EE ++EY+ Q+GT+    +  D S  + + + F++++  +   +A+      V G   + + AVP+D
Sbjct:    7 PKEP--EQMRKLFIGGLSFETTEESLREYYEQWGTIVDCVVMKDPSSKRSRGFGFITYSVMEEVNSAMQARPHTVDGRVVEAKRAVPRD 93          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Sea Lamprey
Match: TARDBP (TAR DNA binding protein [Source:HGNC Symbol;Acc:HGNC:11571])

HSP 1 Score: 86.6557 bits (213), Expect = 4.139e-20
Identity = 52/168 (30.95%), Postives = 86/168 (51.19%), Query Frame = 3
Query:  258 LFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTKEP------NKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTT--EDAAKNAIVNEKQDVLGSKCDVRMAVPK 737
            L V GL W+ +E+D+++YF T+G+V    +K D  TGNS+GFGFV     +   KVL    H +  +  D K     ++       ++KIFVG  + D++ + ++++FSQ+G V  V +P        KP+   +F T  +D     +  E   + G+   +  A PK
Sbjct:   27 LIVLGLPWKASEQDIRDYFSTFGEVLMAQVKRDIKTGNSKGFGFVRFRDYETQLKVLA-QRHMIDGRWCDCKLPNSKEQQVGDAFRSRKIFVGRCTEDITADDLRQFFSQFGEVTDVFIP--------KPFRAFAFVTFSDDQIAQGLCGEDLIIKGTSVHISSAEPK 185          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 123.25 bits (308), Expect = 1.293e-31
Identity = 63/163 (38.65%), Postives = 100/163 (61.35%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTKEPNK--KIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPK 737
            K+F+GGL+W+TTE++L+ YF  +G V+   I  D  TG SRGFGF++ E   ++ +V++  +H L  K IDPK A P  E +K  KIFVGG+ PDV  ++ +E+FSQ+GT+    L  D   G+ + + F+++ + DA      N+  D    K +++ A P+
Sbjct:  160 KMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKT-QHILDGKVIDPKRAIPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQNKFIDFKDRKIEIKRAEPR 321          

HSP 2 Score: 61.2326 bits (147), Expect = 7.771e-11
Identity = 39/110 (35.45%), Postives = 62/110 (56.36%), Query Frame = 3
Query:  156 DENVKDKSLLENHCKPEKNDINKMXXXXXXXSRKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            DE VK + +L+      K  I +   DE D + K+FVGG+  +   ++ + +F  WG +    + LDK TG SRGFGFVT ++ D + +V +      K++KI+ K A+P
Sbjct:  214 DEVVKTQHILDGKVIDPKRAIPR---DEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQNKFIDFKDRKIEIKRAEP 320          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 67.3958 bits (163), Expect = 6.588e-13
Identity = 46/160 (28.75%), Postives = 78/160 (48.75%), Query Frame = 3
Query:  258 LFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKP-------AKPT-------------KEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAI 677
            +FVG LSW   +E LK  FE  G V    +  ++ T  SRG+G+V  E +   +K ++     ++ K+ID +P       +KP               EP+  +F+G LS +   + I E F+++G V SV +P      + K + ++ F+  + AK A+
Sbjct:  170 IFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQ----EMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKAL 325          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 61.6178 bits (148), Expect = 4.941e-11
Identity = 47/173 (27.17%), Postives = 82/173 (47.40%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAK---------PTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVN-EKQDVLGSKCDVRMAVPKD 740
            R L+VG L    TE+ LK YF+  G +++  I +DK   N   + FV      +    L+     L  K+I+    K          + +    +FVG L+ +V +E ++  F  + +  S  + +D   G  + Y F+SFT++D A+NA+ + + QD+ G    +  A  +D
Sbjct:   75 RVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVN-YAFVEYHQSHDANIALQT----LNGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAKRD 242          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 59.6918 bits (143), Expect = 2.433e-10
Identity = 54/191 (28.27%), Postives = 89/191 (46.60%), Query Frame = 3
Query:  258 LFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTME-TEDNLKKVLEIPEHRLKNKKIDPKPA--------------------KPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSK-CDVRMAVPKDQVNKNKMA 764
            L+V  ++ ETT+E  +  F  +G +    ++ D   G  +GFGFV  E  ED +K V  + +  L  +K+    A                    K  K     +FV  L   V +E+++E F+ YGT+ S  +   T  GK K + F+ F+T + A  AI  + Q ++  K   V +A  KD V ++++A
Sbjct:  221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKV-MRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKD-VRRSQLA 408          

HSP 2 Score: 55.4546 bits (132), Expect = 6.096e-9
Identity = 43/151 (28.48%), Postives = 69/151 (45.70%), Query Frame = 3
Query:  249 SRKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEH--------RLKNKKIDPKPAKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAI 677
            S  L+VG L    +E  L + F   G VS   +  D +T  S G+ +V     +  +K +E   +        R+   + DP      K+ +  IF+  L PD+  + + + FS +G + S  +  D + GK K + F+ F  E AAK AI
Sbjct:   37 SASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSL---RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDEN-GKSKGFGFVHFEEEGAAKEAI 183          

HSP 3 Score: 46.9802 bits (110), Expect = 2.691e-6
Identity = 45/177 (25.42%), Postives = 82/177 (46.33%), Query Frame = 3
Query:  249 SRKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKK---IDPKPAK--------PTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSF-TTEDAAKNAIVNEKQDVLGSKCDVRMAVPKDQ 743
            S  +F+  L  +   + L + F  +G +    I  D+  G S+GFGFV  E E   K+ ++     L N +   + P  ++         TK     ++V  ++ + ++EQ +E F+++G + S  L  D + GK K + F+++   EDA K        ++ G K  V  A  K++
Sbjct:  125 SGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDE-NGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNE 299          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Yeast
Match: NOP13 (Nucleolar protein found in preribosomal complexes; contains an RNA recognition motif (RRM); relative distribution to the nucleolus increases upon DNA replication stress [Source:SGD;Acc:S000005119])

HSP 1 Score: 53.9138 bits (128), Expect = 1.749e-8
Identity = 42/171 (24.56%), Postives = 82/171 (47.95%), Query Frame = 3
Query:  258 LFVGGLSWETTEEDLKNYF--------ETWGKVSHCVIKLDKM----TGNS-----RGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPK-----PAKPTKE---------PNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAI 677
            +++G LS++TT++DL  +F        +   +V+   I    M      NS     +GF ++  +  + +K VLE+ E  L  + +  K       +P K+         P++ +FVG LS DV+++ ++++F   G +  + +      GK K + F+ F  E+ + NA+
Sbjct:  127 VWIGNLSFDTTKDDLVRFFIAKTKDNEDEKSRVTEQDITRLSMPRVAAKNSNAMKNKGFCYMFFKNVEQMKAVLELSESHLNGRNMLIKDSENYSGRPDKDDLVAMSKNPPSRILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNAL 297          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Nematostella
Match: EDO39879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8S5])

HSP 1 Score: 130.183 bits (326), Expect = 1.739e-36
Identity = 67/168 (39.88%), Postives = 101/168 (60.12%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTKEP------NKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+F+GGLSW+TT E L+ +FE +G++  CV+  D +T  SRGFGF+T +    +  VL      L  KKIDPK A P + P       KKIF+GGLS + SEE +K+YFSQ+G +    L FD +  + + + F++F +E++A  A   +   +   K +V+ A PK+
Sbjct:    1 KMFIGGLSWQTTAEGLRQHFEKFGELKECVVMRDPVTKRSRGFGFLTFKDPKAVDVVLNSGAQELDGKKIDPKLAVPKRAPAKMVTTTKKIFIGGLSTNTSEEDMKKYFSQFGKITETMLMFDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPKE 168          

HSP 2 Score: 79.7221 bits (195), Expect = 8.913e-18
Identity = 35/79 (44.30%), Postives = 54/79 (68.35%), Query Frame = 3
Query:  249 SRKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            ++K+F+GGLS  T+EED+K YF  +GK++  ++  DK T   RGFGFVT E+E++  K  +   H + NKK++ K A+P
Sbjct:   88 TKKIFIGGLSTNTSEEDMKKYFSQFGKITETMLMFDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQP 166          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Nematostella
Match: EDO38417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCX6])

HSP 1 Score: 130.568 bits (327), Expect = 3.107e-35
Identity = 69/168 (41.07%), Postives = 104/168 (61.90%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVL-EIPEHRLKNKKIDPKPAKPTKEPN----KKIFVGGLSPDVSEEQIKEYFSQ-YGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            KLFVGGLS+ETT+E LK YF  +G++    IK+D +TG  RGF FV  + +     VL ++  H L  + IDPKPA P  +P     KKIFVGGL P+ S+E+I+EYF + Y  V+ ++   + S  +R+ + F+SF +ED        +  ++ G+K +V+ A+PK+
Sbjct:   30 KLFVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGRPRGFAFVQFKHQSEADAVLNQVDPHVLDGRTIDPKPAAPIGKPPHLRVKKIFVGGLKPETSDEKIREYFGKAYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDKICETQFHNIEGNKVEVKRALPKE 197          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Nematostella
Match: EDO49349 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG33])

HSP 1 Score: 119.783 bits (299), Expect = 1.211e-32
Identity = 68/176 (38.64%), Postives = 101/176 (57.39%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTKEPN--------KKIFVGGLSPDVSEEQIKEYFSQY------GTVESVDLPFDTSKGKR-KPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPK 737
            K+F+GGL+W TTEE LK+YF  WG +  CVI   K  G SRGFGFVT E+ D++ +VL+  +H L +++I+PK + P  E          +KIFVGGL+    EE IKEYF+        G V  VDL  D    KR + + F++F  ++  +     +  ++   +C+V+ A P+
Sbjct:    1 KIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIM--KRDGRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPRDESGAPEAMSKTRKIFVGGLASTTVEEDIKEYFNSLCRKNGMGEVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAEPQ 174          

HSP 2 Score: 52.373 bits (124), Expect = 2.836e-8
Identity = 31/86 (36.05%), Postives = 50/86 (58.14%), Query Frame = 3
Query:  249 SRKLFVGGLSWETTEEDLKNYFET------WGKVSHCVIKLDKMT-GNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            +RK+FVGGL+  T EED+K YF +       G+V    +K D+      RGF FVT + ++ ++KV  +  H ++ K+ + K A+P
Sbjct:   88 TRKIFVGGLASTTVEEDIKEYFNSLCRKNGMGEVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAEP 173          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Nematostella
Match: EDO33389 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSE1])

HSP 1 Score: 110.538 bits (275), Expect = 3.228e-29
Identity = 58/152 (38.16%), Postives = 89/152 (58.55%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTKEPNK-----------KIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNA 674
            RK+FVGGL+  T    L+ YFE +G+V+ CV+  D +T  SR FGF+T      ++ V++   H+L  K IDPKPA P + P +           KIFVGGL+   S++ +++YF+ YG V SV+L  D    K + + F++F ++D+   A
Sbjct:    1 RKIFVGGLAISTDSAGLQGYFEKYGEVTDCVLMTDPVTKRSRCFGFITFRDPSVVQNVMDDKPHQLDGKMIDPKPAVP-RGPGQGPPQGNQNNEFKIFVGGLAHSTSKQDLEDYFTAYGKVVSVNLMVDPQTQKMRGFGFVTFESKDSVTKA 151          

HSP 2 Score: 63.929 bits (154), Expect = 2.193e-12
Identity = 28/70 (40.00%), Postives = 46/70 (65.71%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKI 464
            K+FVGGL+  T+++DL++YF  +GKV    + +D  T   RGFGFVT E++D++ K  +   H++  K +
Sbjct:   95 KIFVGGLAHSTSKQDLEDYFTAYGKVVSVNLMVDPQTQKMRGFGFVTFESKDSVTKAADEHYHQINGKTV 164          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Nematostella
Match: EDO33402 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSE0])

HSP 1 Score: 108.612 bits (270), Expect = 4.242e-29
Identity = 54/110 (49.09%), Postives = 71/110 (64.55%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTV 581
            RK+FVGGL+  TT+E L  YFE +G+V+ CV+  D  T  SRGFGFVT      ++ VL    H L  K IDPKPA+ +   + K+F+GGL+   +EE +KEYFS YG V
Sbjct:   14 RKIFVGGLATSTTKEGLHQYFENFGEVTDCVLMTDPTTKRSRGFGFVTFRDPATIESVLAKKPHILDGKTIDPKPARGSAN-DGKVFIGGLAFGTTEEDLKEYFSTYGMV 122          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Medaka
Match: hnrnpd (heterogeneous nuclear ribonucleoprotein D0-like [Source:NCBI gene;Acc:101171014])

HSP 1 Score: 167.933 bits (424), Expect = 1.970e-49
Identity = 80/164 (48.78%), Postives = 117/164 (71.34%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP--TKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+FVGGLSW+TT++DLK+YF  +G+V  C +KLD MTG SRGFGFV  +  ++++KV    EH+L  K IDPK AK   +KEP KK+FVGGLSPD  EE+++EYF  +G VES++LP +    KR+ + F++F  E+A K  +  +  ++  SKC+V++A+ K+
Sbjct:   57 KMFVGGLSWDTTKKDLKDYFAKFGEVVDCTLKLDPMTGRSRGFGFVLFKDAESVEKVASQKEHKLNGKVIDPKKAKAMKSKEPVKKVFVGGLSPDTPEEKVREYFGAFGEVESIELPMENKTNKRRGFCFITFKEEEAVKKVMEKKYHNIGLSKCEVKVALSKE 220          

HSP 2 Score: 55.0694 bits (131), Expect = 3.146e-8
Identity = 29/76 (38.16%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPA 479
            +K+FVGGLS +T EE ++ YF  +G+V    + ++  T   RGF F+T + E+ +KKV+E   H +   K + K A
Sbjct:  141 KKVFVGGLSPDTPEEKVREYFGAFGEVESIELPMENKTNKRRGFCFITFKEEEAVKKVMEKKYHNIGLSKCEVKVA 216          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Medaka
Match: hnrnpd (heterogeneous nuclear ribonucleoprotein D0-like [Source:NCBI gene;Acc:101171014])

HSP 1 Score: 167.548 bits (423), Expect = 9.428e-49
Identity = 80/164 (48.78%), Postives = 117/164 (71.34%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP--TKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+FVGGLSW+TT++DLK+YF  +G+V  C +KLD MTG SRGFGFV  +  ++++KV    EH+L  K IDPK AK   +KEP KK+FVGGLSPD  EE+++EYF  +G VES++LP +    KR+ + F++F  E+A K  +  +  ++  SKC+V++A+ K+
Sbjct:   57 KMFVGGLSWDTTKKDLKDYFAKFGEVVDCTLKLDPMTGRSRGFGFVLFKDAESVEKVASQKEHKLNGKVIDPKKAKAMKSKEPVKKVFVGGLSPDTPEEKVREYFGAFGEVESIELPMENKTNKRRGFCFITFKEEEAVKKVMEKKYHNIGLSKCEVKVALSKE 220          

HSP 2 Score: 55.0694 bits (131), Expect = 3.868e-8
Identity = 29/76 (38.16%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPA 479
            +K+FVGGLS +T EE ++ YF  +G+V    + ++  T   RGF F+T + E+ +KKV+E   H +   K + K A
Sbjct:  141 KKVFVGGLSPDTPEEKVREYFGAFGEVESIELPMENKTNKRRGFCFITFKEEEAVKKVMEKKYHNIGLSKCEVKVA 216          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Medaka
Match: hnrnpaba (heterogeneous nuclear ribonucleoprotein A/B [Source:NCBI gene;Acc:101162934])

HSP 1 Score: 166.392 bits (420), Expect = 3.525e-48
Identity = 78/163 (47.85%), Postives = 117/163 (71.78%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPT-KEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+FVGGLSW+T+++DLK+YF  +G+V+ C IK+D+ TG SRGFGF+  +   ++ KVLE  EHRL  ++IDPK A    KE  KKIFVGGL PD+S+E+I+EYF  +G +E+++LP D    KR+ +VF+++  E + K  +  +   V GSKC++++A PK+
Sbjct:   73 KMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDQQTGRSRGFGFILFKDAASVDKVLEQKEHRLDGRQIDPKRAMAMKKEIVKKIFVGGLKPDLSKEEIEEYFGAFGEIETIELPQDPKTEKRRGFVFITYKEEPSVKKVLEKKYHTVGGSKCEIKIAQPKE 235          

HSP 2 Score: 53.5286 bits (127), Expect = 1.270e-7
Identity = 28/78 (35.90%), Postives = 47/78 (60.26%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            +K+FVGGL  + ++E+++ YF  +G++    +  D  T   RGF F+T + E ++KKVLE   H +   K + K A+P
Sbjct:  156 KKIFVGGLKPDLSKEEIEEYFGAFGEIETIELPQDPKTEKRRGFVFITYKEEPSVKKVLEKKYHTVGGSKCEIKIAQP 233          

HSP 3 Score: 47.7506 bits (112), Expect = 9.524e-6
Identity = 33/96 (34.38%), Postives = 56/96 (58.33%), Query Frame = 3
Query:  477 AKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAK-NAIVNEKQDVL-GSKCDVR--MAVPKDQVNK 752
            A   +E   K+FVGGLS D S++ +K+YFS++G V    +  D   G+ + + F+ F  +DAA  + ++ +K+  L G + D +  MA+ K+ V K
Sbjct:   64 ASKGEEDAGKMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDQQTGRSRGFGFILF--KDAASVDKVLEQKEHRLDGRQIDPKRAMAMKKEIVKK 157          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Medaka
Match: hnrnpaba (heterogeneous nuclear ribonucleoprotein A/B [Source:NCBI gene;Acc:101162934])

HSP 1 Score: 166.777 bits (421), Expect = 4.047e-48
Identity = 78/163 (47.85%), Postives = 117/163 (71.78%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPT-KEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+FVGGLSW+T+++DLK+YF  +G+V+ C IK+D+ TG SRGFGF+  +   ++ KVLE  EHRL  ++IDPK A    KE  KKIFVGGL PD+S+E+I+EYF  +G +E+++LP D    KR+ +VF+++  E + K  +  +   V GSKC++++A PK+
Sbjct:   88 KMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDQQTGRSRGFGFILFKDAASVDKVLEQKEHRLDGRQIDPKRAMAMKKEIVKKIFVGGLKPDLSKEEIEEYFGAFGEIETIELPQDPKTEKRRGFVFITYKEEPSVKKVLEKKYHTVGGSKCEIKIAQPKE 250          

HSP 2 Score: 53.5286 bits (127), Expect = 1.247e-7
Identity = 28/78 (35.90%), Postives = 47/78 (60.26%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            +K+FVGGL  + ++E+++ YF  +G++    +  D  T   RGF F+T + E ++KKVLE   H +   K + K A+P
Sbjct:  171 KKIFVGGLKPDLSKEEIEEYFGAFGEIETIELPQDPKTEKRRGFVFITYKEEPSVKKVLEKKYHTVGGSKCEIKIAQP 248          

HSP 3 Score: 47.7506 bits (112), Expect = 9.845e-6
Identity = 33/96 (34.38%), Postives = 56/96 (58.33%), Query Frame = 3
Query:  477 AKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAK-NAIVNEKQDVL-GSKCDVR--MAVPKDQVNK 752
            A   +E   K+FVGGLS D S++ +K+YFS++G V    +  D   G+ + + F+ F  +DAA  + ++ +K+  L G + D +  MA+ K+ V K
Sbjct:   79 ASKGEEDAGKMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDQQTGRSRGFGFILF--KDAASVDKVLEQKEHRLDGRQIDPKRAMAMKKEIVKK 172          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Medaka
Match: hnrnpabb (heterogeneous nuclear ribonucleoprotein A/B [Source:NCBI gene;Acc:101170948])

HSP 1 Score: 164.851 bits (416), Expect = 1.073e-47
Identity = 74/163 (45.40%), Postives = 114/163 (69.94%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPT-KEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+FVGGLSW+T+++DLK+YF  +G+VS C IK+D  TG SRGFGFV  +   ++ KVLE  EHRL  ++IDPK A    KE  +KIFVGGL+P+ +EE I+EYF  +G +E+++LP D    KR+ ++F+++  E + K  +  +   + G +C++++A PK+
Sbjct:   57 KMFVGGLSWDTSKKDLKDYFSKFGEVSDCTIKMDSNTGRSRGFGFVLFKDSSSVDKVLEQKEHRLDGRQIDPKRAMAMKKEAVRKIFVGGLNPEATEEAIREYFGAFGEIETIELPIDPKSKKRRGFIFITYKDEASVKKCLEKKYHTIEGGRCELKIAQPKE 219          

HSP 2 Score: 58.9214 bits (141), Expect = 1.818e-9
Identity = 29/78 (37.18%), Postives = 48/78 (61.54%), Query Frame = 3
Query:  252 RKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            RK+FVGGL+ E TEE ++ YF  +G++    + +D  +   RGF F+T + E ++KK LE   H ++  + + K A+P
Sbjct:  140 RKIFVGGLNPEATEEAIREYFGAFGEIETIELPIDPKSKKRRGFIFITYKDEASVKKCLEKKYHTIEGGRCELKIAQP 217          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Planmine SMEST
Match: SMESG000029158.1 (SMESG000029158.1)

HSP 1 Score: 219.164 bits (557), Expect = 1.939e-68
Identity = 103/188 (54.79%), Postives = 141/188 (75.00%), Query Frame = 3
Query:  195 CKPEKNDINKMXXXXXXXSRKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKDQVNKNK 758
            C+P  +    + D+  DDSRK+FVGGLSWET+E+DL+ YF  +G V  C+IKLD+ T +SRGFGFV  ++ED + KVLEI EH L  KKIDPK AKP++EP KK+FVGGL PD+SE  IKEYFSQ+G +E+++ PFDT K KRK Y+F++F+ E  A+ A   E Q++ G K +VR+A+P++Q N++K
Sbjct:    4 CRPHGDCEININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQANRSK 191          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Planmine SMEST
Match: SMESG000029158.1 (SMESG000029158.1)

HSP 1 Score: 219.164 bits (557), Expect = 2.569e-68
Identity = 103/188 (54.79%), Postives = 141/188 (75.00%), Query Frame = 3
Query:  195 CKPEKNDINKMXXXXXXXSRKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKDQVNKNK 758
            C+P  +    + D+  DDSRK+FVGGLSWET+E+DL+ YF  +G V  C+IKLD+ T +SRGFGFV  ++ED + KVLEI EH L  KKIDPK AKP++EP KK+FVGGL PD+SE  IKEYFSQ+G +E+++ PFDT K KRK Y+F++F+ E  A+ A   E Q++ G K +VR+A+P++Q N++K
Sbjct:   18 CRPHGDCEININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQANRSK 205          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Planmine SMEST
Match: SMESG000020492.1 (SMESG000020492.1)

HSP 1 Score: 115.546 bits (288), Expect = 1.377e-28
Identity = 59/166 (35.54%), Postives = 92/166 (55.42%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPA----KPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKD 740
            K+F+GGLS  T ++ L+NYF+ +G +  CV+ +D  TG SRGFG++    E  ++ VLE   H L  K +D K      K     + KIFVGG+  D +EE I+++FSQ+G V  V+L  D +K + + + F+ F  E   K  IV     + G   +++   P +
Sbjct:   11 KVFIGGLSQATNDDSLRNYFDQFGSIEDCVVMMDNKTGRSRGFGYIKFHEESTVRTVLEEGPHLLDGKIVDVKQCNIHMKGRNRRSLKIFVGGIGLDDNEETIRQFFSQFGNVTDVNLMLDQTKQRHRGFAFVGFDDESVVKELIVRHFVTMNGKHVEIKAMEPPN 176          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Planmine SMEST
Match: SMESG000077233.1 (SMESG000077233.1)

HSP 1 Score: 111.694 bits (278), Expect = 4.978e-27
Identity = 62/199 (31.16%), Postives = 103/199 (51.76%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTK--------------------------------EPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKDQVNKN 755
            K+F+GGLS  T+ E +++YF  +G +   +I  D +T  SRGFGFVT     ++KKVL    H L +KKIDPK A P K                                   KK+F+GG+S + ++++++EYFSQ+G +E+ +L  D +  + + + F++F  ED+A+        D+     + + A+PK+ +  N
Sbjct:   29 KMFIGGLSPTTSPETMRDYFRKYGDIKEFMIMRDPVTKRSRGFGFVTFLESSSVKKVLNKTPHFLDSKKIDPKVAVPRKIESSTKNCDTSIDCLGINGYSSGKLSDSSLNNAKTKKVFIGGISTNTTKQELEEYFSQFGILETCELMMDKATSRHRGFGFVTFENEDSAEKVCDIHFHDLNNKTVEAKKALPKEIIGNN 227          

HSP 2 Score: 78.1814 bits (191), Expect = 1.412e-15
Identity = 35/79 (44.30%), Postives = 53/79 (67.09%), Query Frame = 3
Query:  249 SRKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            ++K+F+GG+S  TT+++L+ YF  +G +  C + +DK T   RGFGFVT E ED+ +KV +I  H L NK ++ K A P
Sbjct:  142 TKKVFIGGISTNTTKQELEEYFSQFGILETCELMMDKATSRHRGFGFVTFENEDSAEKVCDIHFHDLNNKTVEAKKALP 220          

HSP 3 Score: 50.8322 bits (120), Expect = 1.073e-6
Identity = 31/106 (29.25%), Postives = 57/106 (53.77%), Query Frame = 3
Query:  423 VLEIPEHRLKNKKIDPKPAKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGS-KCDVRMAVPK 737
             LEI  H   N + + + + P      K+F+GGLSP  S E +++YF +YG ++   +  D    + + + F++F  E ++   ++N+    L S K D ++AVP+
Sbjct:    2 TLEIACHDESNSEYETENSSPICNDPGKMFIGGLSPTTSPETMRDYFRKYGDIKEFMIMRDPVTKRSRGFGFVTF-LESSSVKKVLNKTPHFLDSKKIDPKVAVPR 106          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Planmine SMEST
Match: SMESG000077233.1 (SMESG000077233.1)

HSP 1 Score: 111.309 bits (277), Expect = 6.502e-27
Identity = 62/199 (31.16%), Postives = 103/199 (51.76%), Query Frame = 3
Query:  255 KLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTK--------------------------------EPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGSKCDVRMAVPKDQVNKN 755
            K+F+GGLS  T+ E +++YF  +G +   +I  D +T  SRGFGFVT     ++KKVL    H L +KKIDPK A P K                                   KK+F+GG+S + ++++++EYFSQ+G +E+ +L  D +  + + + F++F  ED+A+        D+     + + A+PK+ +  N
Sbjct:   29 KMFIGGLSPTTSPETMRDYFRKYGDIKEFMIMRDPVTKRSRGFGFVTFLESSSVKKVLNKTPHFLDSKKIDPKVAVPRKIESSTKNCDTSIDCLGINGYSSGKLSDSSLNNAKTKKVFIGGISTNTTKQELEEYFSQFGILETCELMMDKATSRHRGFGFVTFENEDSAEKVCDIHFHDLNNKTVEAKKALPKEIIGNN 227          

HSP 2 Score: 77.7962 bits (190), Expect = 1.877e-15
Identity = 35/79 (44.30%), Postives = 53/79 (67.09%), Query Frame = 3
Query:  249 SRKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDKMTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKP 485
            ++K+F+GG+S  TT+++L+ YF  +G +  C + +DK T   RGFGFVT E ED+ +KV +I  H L NK ++ K A P
Sbjct:  142 TKKVFIGGISTNTTKQELEEYFSQFGILETCELMMDKATSRHRGFGFVTFENEDSAEKVCDIHFHDLNNKTVEAKKALP 220          

HSP 3 Score: 50.447 bits (119), Expect = 1.178e-6
Identity = 31/106 (29.25%), Postives = 57/106 (53.77%), Query Frame = 3
Query:  423 VLEIPEHRLKNKKIDPKPAKPTKEPNKKIFVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIVNEKQDVLGS-KCDVRMAVPK 737
             LEI  H   N + + + + P      K+F+GGLSP  S E +++YF +YG ++   +  D    + + + F++F  E ++   ++N+    L S K D ++AVP+
Sbjct:    2 TLEIACHDESNSEYETENSSPICNDPGKMFIGGLSPTTSPETMRDYFRKYGDIKEFMIMRDPVTKRSRGFGFVTF-LESSSVKKVLNKTPHFLDSKKIDPKVAVPR 106          
The following BLAST results are available for this feature:
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HNRNPD7.431e-5049.39heterogeneous nuclear ribonucleoprotein D [Source:... [more]
HNRNPD3.788e-4949.39heterogeneous nuclear ribonucleoprotein D [Source:... [more]
HNRNPD6.058e-4949.39heterogeneous nuclear ribonucleoprotein D [Source:... [more]
HNRNPD1.333e-4849.39heterogeneous nuclear ribonucleoprotein D [Source:... [more]
HNRNPDL1.335e-4847.56heterogeneous nuclear ribonucleoprotein D like [So... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sqd-12.366e-3439.51Homologous to Drosophila SQD (Squid) protein [Sou... [more]
sqd-12.366e-3439.51Homologous to Drosophila SQD (Squid) protein [Sou... [more]
sqd-12.366e-3439.51Homologous to Drosophila SQD (Squid) protein [Sou... [more]
sqd-12.366e-3439.51Homologous to Drosophila SQD (Squid) protein [Sou... [more]
sqd-12.366e-3439.51Homologous to Drosophila SQD (Squid) protein [Sou... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sqd3.542e-4243.21gene:FBgn0263396 transcript:FBtr0082854[more]
sqd5.584e-4243.21gene:FBgn0263396 transcript:FBtr0309094[more]
sqd5.584e-4243.21gene:FBgn0263396 transcript:FBtr0082856[more]
sqd1.515e-4143.21gene:FBgn0263396 transcript:FBtr0082855[more]
msi8.217e-3441.18gene:FBgn0011666 transcript:FBtr0333665[more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpabb1.388e-5048.47heterogeneous nuclear ribonucleoprotein A/Bb [Sour... [more]
hnrnpabb1.388e-5048.47heterogeneous nuclear ribonucleoprotein A/Bb [Sour... [more]
hnrnpdl1.220e-4946.34heterogeneous nuclear ribonucleoprotein D-like [So... [more]
hnrnpdl1.220e-4946.34heterogeneous nuclear ribonucleoprotein D-like [So... [more]
hnrnpdl1.220e-4946.34heterogeneous nuclear ribonucleoprotein D-like [So... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adam171.766e-4949.39ADAM metallopeptidase domain 17 [Source:Xenbase;Ac... [more]
cep1124.680e-4947.85centrosomal protein 112kDa [Source:Xenbase;Acc:XB-... [more]
cep1125.567e-4847.85centrosomal protein 112kDa [Source:Xenbase;Acc:XB-... [more]
h2bc211.067e-4545.73H2B clustered histone 21 [Source:Xenbase;Acc:XB-GE... [more]
h2bc211.589e-4545.73H2B clustered histone 21 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hnrnpd5.914e-5049.39heterogeneous nuclear ribonucleoprotein D [Source:... [more]
Hnrnpab7.103e-5048.47heterogeneous nuclear ribonucleoprotein A/B [Sourc... [more]
Hnrnpd1.854e-4949.39heterogeneous nuclear ribonucleoprotein D [Source:... [more]
Hnrnpab2.298e-4948.47heterogeneous nuclear ribonucleoprotein A/B [Sourc... [more]
Hnrnpd2.493e-4949.39heterogeneous nuclear ribonucleoprotein D [Source:... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99020|ROAA_MOUSE4.968e-4948.47Heterogeneous nuclear ribonucleoprotein A/B OS=Mus... [more]
sp|Q5ZI72|HNRDL_CHICK5.183e-4847.56Heterogeneous nuclear ribonucleoprotein D-like OS=... [more]
sp|Q9Z130|HNRDL_MOUSE6.547e-4847.56Heterogeneous nuclear ribonucleoprotein D-like OS=... [more]
sp|Q14103|HNRPD_HUMAN8.348e-4849.39Heterogeneous nuclear ribonucleoprotein D0 OS=Homo... [more]
sp|Q60668|HNRPD_MOUSE8.989e-4849.39Heterogeneous nuclear ribonucleoprotein D0 OS=Mus ... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A4V6K21.005e-12784.05PRM10 protein (Fragment) OS=Dugesia japonica OX=61... [more]
G4LYB61.694e-8068.60Heterogeneous nuclear ribonucleoprotein,putative O... [more]
G4LYB81.336e-7968.82Heterogeneous nuclear ribonucleoprotein,putative O... [more]
A0A4Z2CMJ46.780e-7966.28Heterogeneous nuclear ribonucleoprotein A/B isofor... [more]
A0A4Z2CMS83.600e-7866.28Heterogeneous nuclear ribonucleoprotein A/B isofor... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpabb3.140e-5048.47heterogeneous nuclear ribonucleoprotein A/B [Sourc... [more]
hnrnpabb1.059e-4948.47heterogeneous nuclear ribonucleoprotein A/B [Sourc... [more]
hnrnpd1.400e-4949.39heterogeneous nuclear ribonucleoprotein D0 [Source... [more]
hnrnpdl8.492e-4845.12heterogeneous nuclear ribonucleoprotein D like [So... [more]
hnrnpaba4.695e-4737.61heterogeneous nuclear ribonucleoprotein A/B-like [... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004893.11.099e-3836.78pep scaffold:Pmarinus_7.0:GL479484:4:2056:-1 gene:... [more]
HNRNPA03.451e-3839.66heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
HNRNPA05.777e-3838.51heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
HNRNPA2B12.705e-3333.33heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
TARDBP4.139e-2030.95TAR DNA binding protein [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HRP11.293e-3138.65Subunit of cleavage factor I; cleavage factor I is... [more]
NSR16.588e-1328.75Nucleolar protein that binds nuclear localization ... [more]
PUB14.941e-1127.17Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
PAB12.433e-1028.27Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
NOP131.749e-824.56Nucleolar protein found in preribosomal complexes;... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO398791.739e-3639.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384173.107e-3541.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493491.211e-3238.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333893.228e-2938.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334024.242e-2949.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpd1.970e-4948.78heterogeneous nuclear ribonucleoprotein D0-like [S... [more]
hnrnpd9.428e-4948.78heterogeneous nuclear ribonucleoprotein D0-like [S... [more]
hnrnpaba3.525e-4847.85heterogeneous nuclear ribonucleoprotein A/B [Sourc... [more]
hnrnpaba4.047e-4847.85heterogeneous nuclear ribonucleoprotein A/B [Sourc... [more]
hnrnpabb1.073e-4745.40heterogeneous nuclear ribonucleoprotein A/B [Sourc... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029158.11.939e-6854.79SMESG000029158.1[more]
SMESG000029158.12.569e-6854.79SMESG000029158.1[more]
SMESG000020492.11.377e-2835.54SMESG000020492.1[more]
SMESG000077233.14.978e-2731.16SMESG000077233.1[more]
SMESG000077233.16.502e-2731.16SMESG000077233.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019597 ID=SMED30019597|Name=Heterogeneous nuclear ribonucleoprotein,putative|organism=Schmidtea mediterranea sexual|type=transcript|length=1098bp
CAAATTTGTTTAAACTATTCAAATAAATTAATTTAGTTTCTATTTCTTAT
TAATTAAAAATGTCGGTGAATGATGTTAGCACAAATTTTTGTGAAGATAT
AGAAAATGTCAATGAAGAGAAAGAAATCAATGATAATTTTTGTCAAGAGG
ATGACGATGAAAACGTGAAAGATAAATCGTTATTGGAAAACCATTGCAAG
CCTGAGAAAAATGATATAAACAAAATGGAAGATGATGAAGATGATGATAG
CAGAAAACTTTTTGTCGGAGGTCTGAGTTGGGAGACTACCGAAGAGGATC
TGAAAAATTATTTCGAAACATGGGGTAAAGTATCACATTGTGTAATTAAG
CTGGACAAAATGACTGGTAATTCTCGTGGATTTGGGTTTGTTACCATGGA
AACTGAAGACAATTTGAAAAAAGTTCTCGAGATTCCTGAACATCGTTTAA
AAAATAAAAAAATTGATCCGAAACCTGCAAAACCAACAAAAGAACCTAAC
AAGAAAATCTTTGTTGGAGGCTTGTCCCCAGATGTGAGCGAAGAACAAAT
TAAAGAATATTTCTCTCAATATGGGACTGTTGAAAGTGTTGATCTGCCTT
TCGATACTTCAAAAGGAAAAAGGAAGCCATATGTCTTCCTTAGTTTTACT
ACCGAGGATGCCGCAAAAAATGCCATTGTCAATGAAAAACAAGATGTTTT
AGGTTCCAAGTGTGATGTTCGAATGGCCGTTCCTAAGGATCAAGTTAATA
AGAATAAAATGGCAGCTTGGGGCCCCTATAGTGGTGGCATGTATCCTCCT
GGTTCAGAATATTACAGCTATGAATATCCATACGGAGGCCCGTATTCGTA
TGATCCTAATGCTTACTATTCCGGATATTACAGCGGATATCCATACGGTT
ATTCTTATCCAATGCCGCCTCAACCGTATGTAGCACCGCCGAGGGCACCG
ATAGCTGGCGGCAAGATAGCCGCTCGAGGCAGAGGTAACGCTGCATATCA
TCCCTATACGAGGCAGCAGTGAGTAGCAGCAGCAGTTTTATCTATTTCTG
TATTCGATACTGTTTGTATTTCCTATAAATAAATTATATTTGTATTCT
back to top

protein sequence of SMED30019597-orf-1

>SMED30019597-orf-1 ID=SMED30019597-orf-1|Name=SMED30019597-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=321bp
MSVNDVSTNFCEDIENVNEEKEINDNFCQEDDDENVKDKSLLENHCKPEK
NDINKMEDDEDDDSRKLFVGGLSWETTEEDLKNYFETWGKVSHCVIKLDK
MTGNSRGFGFVTMETEDNLKKVLEIPEHRLKNKKIDPKPAKPTKEPNKKI
FVGGLSPDVSEEQIKEYFSQYGTVESVDLPFDTSKGKRKPYVFLSFTTED
AAKNAIVNEKQDVLGSKCDVRMAVPKDQVNKNKMAAWGPYSGGMYPPGSE
YYSYEYPYGGPYSYDPNAYYSGYYSGYPYGYSYPMPPQPYVAPPRAPIAG
GKIAARGRGNAAYHPYTRQQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003729mRNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: cellular component
TermDefinition
GO:0019013viral nucleocapsid
GO:0030529intracellular ribonucleoprotein complex