Lipoma-preferred partner

Overview
NameLipoma-preferred partner
Smed IDSMED30019594
Length (bp)1398
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lipoma-preferred partner (SMED30019594) t-SNE clustered cells

Violin plots show distribution of expression levels for Lipoma-preferred partner (SMED30019594) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lipoma-preferred partner (SMED30019594) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lipoma-preferred partner (SMED30019594) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019594

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30019594h1SMcG0005922 dd_Smed_v4_12584_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019594h1SMcG0005922 dd_Smed_v4_12584_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lipoma-preferred partner vs. Ensembl Human
Match: TRIP6 (thyroid hormone receptor interactor 6 [Source:HGNC Symbol;Acc:HGNC:12311])

HSP 1 Score: 144.05 bits (362), Expect = 2.148e-37
Identity = 62/134 (46.27%), Postives = 84/134 (62.69%), Query Frame = 3
Query:  744 LNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            L+ VFH  CF C  C A L    F+  ++R  C  C   +LEKC  C+  I DRI+R +G  YHP CFTC VC+  LDG  FTVD   ++ C+EDFH+++APRC  CG  I P+ G +E  RI++ D++FH+ C
Sbjct:  296 LDRVFHVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRILRAMGKAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVALDRSFHIGC 429          
BLAST of Lipoma-preferred partner vs. Ensembl Human
Match: LPP (LIM domain containing preferred translocation partner in lipoma [Source:HGNC Symbol;Acc:HGNC:6679])

HSP 1 Score: 141.739 bits (356), Expect = 5.286e-36
Identity = 67/161 (41.61%), Postives = 91/161 (56.52%), Query Frame = 3
Query:  669 NECHRCRKPFELANGKSSVGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
              C RC        G++ VG+  G   ++ VFH  CF C  C   L    F+  +K+  C  C   +LE+C VC+  I +RI+R  G  YHP CFTC +C+  LDG  FTVD    + C+EDFHK++APRC  C EPI P  G +E  RI++ D+ FH+ C
Sbjct:  392 GRCARC--------GENVVGEGTGCTAMDQVFHVDCFTCIICNNKLRGQPFYAVEKKAYCEPCYINTLEQCNVCSKPIMERILRATGKAYHPHCFTCVMCHRSLDGIPFTVDAGGLIHCIEDFHKKFAPRCSVCKEPIMPAPGQEETVRIVALDRDFHVHC 544          
BLAST of Lipoma-preferred partner vs. Ensembl Human
Match: LPP (LIM domain containing preferred translocation partner in lipoma [Source:HGNC Symbol;Acc:HGNC:6679])

HSP 1 Score: 142.124 bits (357), Expect = 5.853e-36
Identity = 67/161 (41.61%), Postives = 91/161 (56.52%), Query Frame = 3
Query:  669 NECHRCRKPFELANGKSSVGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
              C RC        G++ VG+  G   ++ VFH  CF C  C   L    F+  +K+  C  C   +LE+C VC+  I +RI+R  G  YHP CFTC +C+  LDG  FTVD    + C+EDFHK++APRC  C EPI P  G +E  RI++ D+ FH+ C
Sbjct:  414 GRCARC--------GENVVGEGTGCTAMDQVFHVDCFTCIICNNKLRGQPFYAVEKKAYCEPCYINTLEQCNVCSKPIMERILRATGKAYHPHCFTCVMCHRSLDGIPFTVDAGGLIHCIEDFHKKFAPRCSVCKEPIMPAPGQEETVRIVALDRDFHVHC 566          
BLAST of Lipoma-preferred partner vs. Ensembl Human
Match: LPP (LIM domain containing preferred translocation partner in lipoma [Source:HGNC Symbol;Acc:HGNC:6679])

HSP 1 Score: 142.124 bits (357), Expect = 5.853e-36
Identity = 67/161 (41.61%), Postives = 91/161 (56.52%), Query Frame = 3
Query:  669 NECHRCRKPFELANGKSSVGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
              C RC        G++ VG+  G   ++ VFH  CF C  C   L    F+  +K+  C  C   +LE+C VC+  I +RI+R  G  YHP CFTC +C+  LDG  FTVD    + C+EDFHK++APRC  C EPI P  G +E  RI++ D+ FH+ C
Sbjct:  414 GRCARC--------GENVVGEGTGCTAMDQVFHVDCFTCIICNNKLRGQPFYAVEKKAYCEPCYINTLEQCNVCSKPIMERILRATGKAYHPHCFTCVMCHRSLDGIPFTVDAGGLIHCIEDFHKKFAPRCSVCKEPIMPAPGQEETVRIVALDRDFHVHC 566          
BLAST of Lipoma-preferred partner vs. Ensembl Human
Match: ZYX (zyxin [Source:HGNC Symbol;Acc:HGNC:13200])

HSP 1 Score: 132.494 bits (332), Expect = 1.226e-33
Identity = 65/157 (41.40%), Postives = 88/157 (56.05%), Query Frame = 3
Query:  675 CHRCRKPFELANGKSSVGQINGPLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            C RC +P  LA  + +V      L  +FH  CF C++C   L    F+  +    C  C  ++LEKC  C   I DR++R  G  YHP CFTC VC   L+G +F VD   R  C+ D+HK+YAPRC  C EPI P+ G  E  R+++ DK FH++C
Sbjct:  227 CGRCHQP--LARAQPAVRA----LGQLFHIACFTCHQCAQQLQGQQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGTSFIVDQANRPHCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKC 377          
BLAST of Lipoma-preferred partner vs. Ensembl Celegans
Match: zyx-1 (Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4])

HSP 1 Score: 126.331 bits (316), Expect = 2.279e-32
Identity = 60/147 (40.82%), Postives = 84/147 (57.14%), Query Frame = 3
Query:  711 GKSSVGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            GK   G   G   +N +FH  CF C +C   L   SF+    +  C  C   SLEKCT CN  I+D+++R  G  YH  CF C  C   LDG  FT+D    + C+  FH ++APRC  C +PI PQ+G +E+ R+++ DK+FH++C
Sbjct:  149 GKEITGDQPGCNAMNQIFHVDCFKCGQCSKTLAGASFYNIDDKPTCEGCYQNSLEKCTACNRAISDKLLRACGGVYHVNCFVCFSCKKSLDGIPFTLDKDNNVHCVPCFHDKFAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDC 295          
BLAST of Lipoma-preferred partner vs. Ensembl Celegans
Match: zyx-1 (Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4])

HSP 1 Score: 130.183 bits (326), Expect = 2.539e-32
Identity = 60/147 (40.82%), Postives = 84/147 (57.14%), Query Frame = 3
Query:  711 GKSSVGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            GK   G   G   +N +FH  CF C +C   L   SF+    +  C  C   SLEKCT CN  I+D+++R  G  YH  CF C  C   LDG  FT+D    + C+  FH ++APRC  C +PI PQ+G +E+ R+++ DK+FH++C
Sbjct:  415 GKEITGDQPGCNAMNQIFHVDCFKCGQCSKTLAGASFYNIDDKPTCEGCYQNSLEKCTACNRAISDKLLRACGGVYHVNCFVCFSCKKSLDGIPFTLDKDNNVHCVPCFHDKFAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDC 561          
BLAST of Lipoma-preferred partner vs. Ensembl Celegans
Match: zyx-1 (Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4])

HSP 1 Score: 130.183 bits (326), Expect = 2.539e-32
Identity = 60/147 (40.82%), Postives = 84/147 (57.14%), Query Frame = 3
Query:  711 GKSSVGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            GK   G   G   +N +FH  CF C +C   L   SF+    +  C  C   SLEKCT CN  I+D+++R  G  YH  CF C  C   LDG  FT+D    + C+  FH ++APRC  C +PI PQ+G +E+ R+++ DK+FH++C
Sbjct:  415 GKEITGDQPGCNAMNQIFHVDCFKCGQCSKTLAGASFYNIDDKPTCEGCYQNSLEKCTACNRAISDKLLRACGGVYHVNCFVCFSCKKSLDGIPFTLDKDNNVHCVPCFHDKFAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDC 561          
BLAST of Lipoma-preferred partner vs. Ensembl Celegans
Match: zyx-1 (Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4])

HSP 1 Score: 123.635 bits (309), Expect = 2.846e-32
Identity = 60/150 (40.00%), Postives = 85/150 (56.67%), Query Frame = 3
Query:  702 LANGKSSVGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            +  GK   G   G   +N +FH  CF C +C   L   SF+    +  C  C   SLEKCT CN  I+D+++R  G  YH  CF C  C   LDG  FT+D    + C+  FH ++APRC  C +PI PQ+G +E+ R+++ DK+FH++C
Sbjct:   54 VGCGKEITGDQPGCNAMNQIFHVDCFKCGQCSKTLAGASFYNIDDKPTCEGCYQNSLEKCTACNRAISDKLLRACGGVYHVNCFVCFSCKKSLDGIPFTLDKDNNVHCVPCFHDKFAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDC 203          
BLAST of Lipoma-preferred partner vs. Ensembl Celegans
Match: zyx-1 (Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4])

HSP 1 Score: 129.413 bits (324), Expect = 5.206e-32
Identity = 60/147 (40.82%), Postives = 84/147 (57.14%), Query Frame = 3
Query:  711 GKSSVGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            GK   G   G   +N +FH  CF C +C   L   SF+    +  C  C   SLEKCT CN  I+D+++R  G  YH  CF C  C   LDG  FT+D    + C+  FH ++APRC  C +PI PQ+G +E+ R+++ DK+FH++C
Sbjct:  415 GKEITGDQPGCNAMNQIFHVDCFKCGQCSKTLAGASFYNIDDKPTCEGCYQNSLEKCTACNRAISDKLLRACGGVYHVNCFVCFSCKKSLDGIPFTLDKDNNVHCVPCFHDKFAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDC 561          
BLAST of Lipoma-preferred partner vs. Ensembl Fly
Match: Zyx (gene:FBgn0011642 transcript:FBtr0309882)

HSP 1 Score: 137.502 bits (345), Expect = 3.813e-35
Identity = 61/143 (42.66%), Postives = 89/143 (62.24%), Query Frame = 3
Query:  723 VGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            +G+ +G   ++ ++H  CF C  C+ NL    F+    +  C     ++LEKC+VC   I +RI+R  G PYHP+CFTC VC   LDG  FTVD   + +C+ DFHK++APRC  C +PI P  G +E  R+++ D++FHLEC
Sbjct:  307 LGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLEC 449          
BLAST of Lipoma-preferred partner vs. Ensembl Fly
Match: Zyx (gene:FBgn0011642 transcript:FBtr0089214)

HSP 1 Score: 137.502 bits (345), Expect = 4.429e-35
Identity = 61/143 (42.66%), Postives = 89/143 (62.24%), Query Frame = 3
Query:  723 VGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            +G+ +G   ++ ++H  CF C  C+ NL    F+    +  C     ++LEKC+VC   I +RI+R  G PYHP+CFTC VC   LDG  FTVD   + +C+ DFHK++APRC  C +PI P  G +E  R+++ D++FHLEC
Sbjct:  334 LGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLEC 476          
BLAST of Lipoma-preferred partner vs. Ensembl Fly
Match: Zyx (gene:FBgn0011642 transcript:FBtr0089211)

HSP 1 Score: 138.272 bits (347), Expect = 4.658e-35
Identity = 61/143 (42.66%), Postives = 89/143 (62.24%), Query Frame = 3
Query:  723 VGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            +G+ +G   ++ ++H  CF C  C+ NL    F+    +  C     ++LEKC+VC   I +RI+R  G PYHP+CFTC VC   LDG  FTVD   + +C+ DFHK++APRC  C +PI P  G +E  R+++ D++FHLEC
Sbjct:  396 LGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLEC 538          
BLAST of Lipoma-preferred partner vs. Ensembl Fly
Match: Zyx (gene:FBgn0011642 transcript:FBtr0345298)

HSP 1 Score: 138.272 bits (347), Expect = 4.658e-35
Identity = 61/143 (42.66%), Postives = 89/143 (62.24%), Query Frame = 3
Query:  723 VGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            +G+ +G   ++ ++H  CF C  C+ NL    F+    +  C     ++LEKC+VC   I +RI+R  G PYHP+CFTC VC   LDG  FTVD   + +C+ DFHK++APRC  C +PI P  G +E  R+++ D++FHLEC
Sbjct:  396 LGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLEC 538          
BLAST of Lipoma-preferred partner vs. Ensembl Fly
Match: Zyx (gene:FBgn0011642 transcript:FBtr0089210)

HSP 1 Score: 137.887 bits (346), Expect = 4.759e-35
Identity = 61/143 (42.66%), Postives = 89/143 (62.24%), Query Frame = 3
Query:  723 VGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            +G+ +G   ++ ++H  CF C  C+ NL    F+    +  C     ++LEKC+VC   I +RI+R  G PYHP+CFTC VC   LDG  FTVD   + +C+ DFHK++APRC  C +PI P  G +E  R+++ D++FHLEC
Sbjct:  375 LGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLEC 517          
BLAST of Lipoma-preferred partner vs. Ensembl Zebrafish
Match: trip6 (thyroid hormone receptor interactor 6 [Source:ZFIN;Acc:ZDB-GENE-140106-91])

HSP 1 Score: 152.91 bits (385), Expect = 3.742e-40
Identity = 61/134 (45.52%), Postives = 87/134 (64.93%), Query Frame = 3
Query:  744 LNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            +  VFH  CF C  C A L    F+   ++  C  C   +LE+C+ C+  I DRI+R +G  YHP+CFTC VC CCLDG  FTVD   ++ C++DFH+++APRC  CG+PI P+ G +E  RI++ D++FH+ C
Sbjct:  390 MEQVFHVECFTCITCHARLRGQPFYALDRKSYCENCYISTLERCSKCSEPILDRILRAMGKAYHPRCFTCVVCGCCLDGVPFTVDATSQIHCIDDFHRKFAPRCSVCGQPIMPEPGQEETVRIVALDRSFHVNC 523          
BLAST of Lipoma-preferred partner vs. Ensembl Zebrafish
Match: trip6 (thyroid hormone receptor interactor 6 [Source:ZFIN;Acc:ZDB-GENE-140106-91])

HSP 1 Score: 152.91 bits (385), Expect = 3.742e-40
Identity = 61/134 (45.52%), Postives = 87/134 (64.93%), Query Frame = 3
Query:  744 LNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            +  VFH  CF C  C A L    F+   ++  C  C   +LE+C+ C+  I DRI+R +G  YHP+CFTC VC CCLDG  FTVD   ++ C++DFH+++APRC  CG+PI P+ G +E  RI++ D++FH+ C
Sbjct:  390 MEQVFHVECFTCITCHARLRGQPFYALDRKSYCENCYISTLERCSKCSEPILDRILRAMGKAYHPRCFTCVVCGCCLDGVPFTVDATSQIHCIDDFHRKFAPRCSVCGQPIMPEPGQEETVRIVALDRSFHVNC 523          
BLAST of Lipoma-preferred partner vs. Ensembl Zebrafish
Match: trip6 (thyroid hormone receptor interactor 6 [Source:ZFIN;Acc:ZDB-GENE-140106-91])

HSP 1 Score: 152.91 bits (385), Expect = 3.742e-40
Identity = 61/134 (45.52%), Postives = 87/134 (64.93%), Query Frame = 3
Query:  744 LNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            +  VFH  CF C  C A L    F+   ++  C  C   +LE+C+ C+  I DRI+R +G  YHP+CFTC VC CCLDG  FTVD   ++ C++DFH+++APRC  CG+PI P+ G +E  RI++ D++FH+ C
Sbjct:  390 MEQVFHVECFTCITCHARLRGQPFYALDRKSYCENCYISTLERCSKCSEPILDRILRAMGKAYHPRCFTCVVCGCCLDGVPFTVDATSQIHCIDDFHRKFAPRCSVCGQPIMPEPGQEETVRIVALDRSFHVNC 523          
BLAST of Lipoma-preferred partner vs. Ensembl Zebrafish
Match: trip6 (thyroid hormone receptor interactor 6 [Source:ZFIN;Acc:ZDB-GENE-140106-91])

HSP 1 Score: 152.91 bits (385), Expect = 3.823e-40
Identity = 61/134 (45.52%), Postives = 87/134 (64.93%), Query Frame = 3
Query:  744 LNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            +  VFH  CF C  C A L    F+   ++  C  C   +LE+C+ C+  I DRI+R +G  YHP+CFTC VC CCLDG  FTVD   ++ C++DFH+++APRC  CG+PI P+ G +E  RI++ D++FH+ C
Sbjct:  391 MEQVFHVECFTCITCHARLRGQPFYALDRKSYCENCYISTLERCSKCSEPILDRILRAMGKAYHPRCFTCVVCGCCLDGVPFTVDATSQIHCIDDFHRKFAPRCSVCGQPIMPEPGQEETVRIVALDRSFHVNC 524          
BLAST of Lipoma-preferred partner vs. Ensembl Zebrafish
Match: CR352261.1 (thyroid hormone receptor interactor 6 [Source:NCBI gene;Acc:792697])

HSP 1 Score: 152.91 bits (385), Expect = 3.899e-40
Identity = 61/134 (45.52%), Postives = 87/134 (64.93%), Query Frame = 3
Query:  744 LNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            +  VFH  CF C  C A L    F+   ++  C  C   +LE+C+ C+  I DRI+R +G  YHP+CFTC VC CCLDG  FTVD   ++ C++DFH+++APRC  CG+PI P+ G +E  RI++ D++FH+ C
Sbjct:  391 MEQVFHVECFTCITCHARLRGQPFYALDRKSYCENCYISTLERCSKCSEPILDRILRAMGKAYHPRCFTCVVCGCCLDGVPFTVDATSQIHCIDDFHRKFAPRCSVCGQPIMPEPGQEETVRIVALDRSFHVNC 524          
BLAST of Lipoma-preferred partner vs. Ensembl Xenopus
Match: nudt17 (nudix hydrolase 17 [Source:Xenbase;Acc:XB-GENE-979158])

HSP 1 Score: 150.599 bits (379), Expect = 1.844e-40
Identity = 85/243 (34.98%), Postives = 123/243 (50.62%), Query Frame = 3
Query:  423 NLSQVRKNSEAEVDALTNILIKSIANKTENKDSNPRSYTSSTYLPNQPYSSKRVSNTSSQPAVXXXXXXXXXXXXXXXXXXXNECHRCRKPFELANGKSSVGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
             + + R + +AE+D+LT+IL    A+   +    PR+       P  PY ++  S          +        +  S      C RC        G++ VG+  G   ++ VFH  CF C  C + L    F+  +K+  C  C   +LEKC+VC   I +RI+R  G  YHP CFTC VC   LDG  FTVD   ++ C+EDFHK++APRC  C EPI P  G +E  RI++ D+ FH++C
Sbjct:  112 TIEERRSSLDAEIDSLTSIL----ADLENSSPYKPRT-------PQGPYLAQASSLRPEDELERLTKKMLYDMENPPSEEYFGRCSRC--------GENVVGEGTGCTAMDQVFHVECFTCMTCNSKLRGQPFYAVEKKAFCEPCYIRTLEKCSVCAKPIMERILRATGKAYHPHCFTCVVCFRSLDGIPFTVDASGQIHCIEDFHKKFAPRCSVCKEPIMPAPGQEETVRIVALDRDFHVQC 335          
BLAST of Lipoma-preferred partner vs. Ensembl Xenopus
Match: nudt17 (nudix hydrolase 17 [Source:Xenbase;Acc:XB-GENE-979158])

HSP 1 Score: 150.599 bits (379), Expect = 6.736e-39
Identity = 69/161 (42.86%), Postives = 93/161 (57.76%), Query Frame = 3
Query:  669 NECHRCRKPFELANGKSSVGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
              C RC        G++ VG+  G   ++ VFH  CF C  C + L    F+  +K+  C  C   +LEKC+VC   I +RI+R  G  YHP CFTC VC   LDG  FTVD   ++ C+EDFHK++APRC  C EPI P  G +E  RI++ D+ FH++C
Sbjct:  416 GRCSRC--------GENVVGEGTGCTAMDQVFHVECFTCMTCNSKLRGQPFYAVEKKAFCEPCYIRTLEKCSVCAKPIMERILRATGKAYHPHCFTCVVCFRSLDGIPFTVDASGQIHCIEDFHKKFAPRCSVCKEPIMPAPGQEETVRIVALDRDFHVQC 568          
BLAST of Lipoma-preferred partner vs. Ensembl Xenopus
Match: nudt17 (nudix hydrolase 17 [Source:Xenbase;Acc:XB-GENE-979158])

HSP 1 Score: 150.214 bits (378), Expect = 7.428e-39
Identity = 69/161 (42.86%), Postives = 93/161 (57.76%), Query Frame = 3
Query:  669 NECHRCRKPFELANGKSSVGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
              C RC        G++ VG+  G   ++ VFH  CF C  C + L    F+  +K+  C  C   +LEKC+VC   I +RI+R  G  YHP CFTC VC   LDG  FTVD   ++ C+EDFHK++APRC  C EPI P  G +E  RI++ D+ FH++C
Sbjct:  416 GRCSRC--------GENVVGEGTGCTAMDQVFHVECFTCMTCNSKLRGQPFYAVEKKAFCEPCYIRTLEKCSVCAKPIMERILRATGKAYHPHCFTCVVCFRSLDGIPFTVDASGQIHCIEDFHKKFAPRCSVCKEPIMPAPGQEETVRIVALDRDFHVQC 568          
BLAST of Lipoma-preferred partner vs. Ensembl Xenopus
Match: gnpda1 (glucosamine-6-phosphate deaminase 1 [Source:Xenbase;Acc:XB-GENE-966376])

HSP 1 Score: 129.798 bits (325), Expect = 6.754e-32
Identity = 60/162 (37.04%), Postives = 88/162 (54.32%), Query Frame = 3
Query:  675 CHRCRKPFELANGKSSVGQINGPLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSR-----CVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            C +C K    AN      Q    +  ++H  CF C  C   L   +F++   ++ C         H+S ++C VC   I D I++ LG  +HP CF C VCN CLDG  FTVD+  +++C++D+HK  AP+C AC  PI P  G  E  R++S DK +H++C
Sbjct:  393 CVKCSKGVYGAN------QACQAMGNLYHNGCFICSACSRKLRGKAFYFVNGKVYCEEDFLYSGFHQSADRCFVCGHWIMDMILQALGKSFHPGCFRCAVCNECLDGVPFTVDMENKIYCVKDYHKILAPKCAACSLPILPSEGTDETIRVVSMDKDYHIDC 548          
BLAST of Lipoma-preferred partner vs. Ensembl Xenopus
Match: arf4 (ADP ribosylation factor 4 [Source:Xenbase;Acc:XB-GENE-484079])

HSP 1 Score: 128.257 bits (321), Expect = 4.467e-31
Identity = 55/155 (35.48%), Postives = 84/155 (54.19%), Query Frame = 3
Query:  696 FELANGKSSVGQINGPLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSR-----CVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
             +   G     Q    +  ++H  CF C  C   L   +F+    ++ C          ++ +KC VC  +I + I++ LG  YHP CF C VCN CLDG  FTVDV   ++C++D+H  +AP+C +C +PI P  G +E  R++S DK +H+EC
Sbjct:  490 IKCGKGVYGASQACQAMGNLYHTNCFTCCSCGRRLRGKAFYNVNGKVYCEEDFLYSGFQQTADKCFVCGHLIMEMILQALGKSYHPGCFRCVVCNECLDGVPFTVDVENNIYCVKDYHTVFAPKCASCNQPILPAQGSEETIRVVSMDKDYHVEC 644          
BLAST of Lipoma-preferred partner vs. Ensembl Mouse
Match: Trip6 (thyroid hormone receptor interactor 6 [Source:MGI Symbol;Acc:MGI:1343458])

HSP 1 Score: 144.05 bits (362), Expect = 1.677e-37
Identity = 66/147 (44.90%), Postives = 90/147 (61.22%), Query Frame = 3
Query:  711 GKSSVGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            G+  VG   G   L+ VFH  CF C  C A L    F+  ++R  C  C   +LEKC+ C+  I DRI+R +G  YHP CFTC VC+  LDG  FTVD   ++ C+EDFH+++APRC  CG  I P+ G +E  RI++ D++FH+ C
Sbjct:  287 GEDVVGDGAGVVALDRVFHIGCFVCSTCRAQLRGQHFYAVERRAYCESCYVATLEKCSTCSEPILDRILRAMGKAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVALDRSFHIGC 433          
BLAST of Lipoma-preferred partner vs. Ensembl Mouse
Match: Lpp (LIM domain containing preferred translocation partner in lipoma [Source:MGI Symbol;Acc:MGI:2441849])

HSP 1 Score: 142.51 bits (358), Expect = 7.950e-37
Identity = 67/161 (41.61%), Postives = 93/161 (57.76%), Query Frame = 3
Query:  669 NECHRCRKPFELANGKSSVGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
              C RC        G++ VG+  G   ++ VFH  CF C  C+  L    F+  +K+  C  C   +LE+C+VC+  I +RI+R  G  YHP CFTC +C+  LDG  FTVD    + C+EDFHK++APRC  C EPI P  G +E  RI++ D+ FH+ C
Sbjct:  290 GRCARC--------GENVVGEGTGCTAMDQVFHVDCFTCIVCDVKLRGQPFYAVEKKAYCEPCYINTLEQCSVCSKPIMERILRATGKAYHPHCFTCVMCHRSLDGIPFTVDACGLIHCIEDFHKKFAPRCSVCKEPIMPAPGQEETVRIVALDRDFHVHC 442          
BLAST of Lipoma-preferred partner vs. Ensembl Mouse
Match: Lpp (LIM domain containing preferred translocation partner in lipoma [Source:MGI Symbol;Acc:MGI:2441849])

HSP 1 Score: 143.665 bits (361), Expect = 1.056e-36
Identity = 67/161 (41.61%), Postives = 93/161 (57.76%), Query Frame = 3
Query:  669 NECHRCRKPFELANGKSSVGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
              C RC        G++ VG+  G   ++ VFH  CF C  C+  L    F+  +K+  C  C   +LE+C+VC+  I +RI+R  G  YHP CFTC +C+  LDG  FTVD    + C+EDFHK++APRC  C EPI P  G +E  RI++ D+ FH+ C
Sbjct:  415 GRCARC--------GENVVGEGTGCTAMDQVFHVDCFTCIVCDVKLRGQPFYAVEKKAYCEPCYINTLEQCSVCSKPIMERILRATGKAYHPHCFTCVMCHRSLDGIPFTVDACGLIHCIEDFHKKFAPRCSVCKEPIMPAPGQEETVRIVALDRDFHVHC 567          
BLAST of Lipoma-preferred partner vs. Ensembl Mouse
Match: Lpp (LIM domain containing preferred translocation partner in lipoma [Source:MGI Symbol;Acc:MGI:2441849])

HSP 1 Score: 143.665 bits (361), Expect = 1.056e-36
Identity = 67/161 (41.61%), Postives = 93/161 (57.76%), Query Frame = 3
Query:  669 NECHRCRKPFELANGKSSVGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
              C RC        G++ VG+  G   ++ VFH  CF C  C+  L    F+  +K+  C  C   +LE+C+VC+  I +RI+R  G  YHP CFTC +C+  LDG  FTVD    + C+EDFHK++APRC  C EPI P  G +E  RI++ D+ FH+ C
Sbjct:  415 GRCARC--------GENVVGEGTGCTAMDQVFHVDCFTCIVCDVKLRGQPFYAVEKKAYCEPCYINTLEQCSVCSKPIMERILRATGKAYHPHCFTCVMCHRSLDGIPFTVDACGLIHCIEDFHKKFAPRCSVCKEPIMPAPGQEETVRIVALDRDFHVHC 567          
BLAST of Lipoma-preferred partner vs. Ensembl Mouse
Match: Zyx (zyxin [Source:MGI Symbol;Acc:MGI:103072])

HSP 1 Score: 138.658 bits (348), Expect = 2.459e-35
Identity = 65/157 (41.40%), Postives = 92/157 (58.60%), Query Frame = 3
Query:  675 CHRCRKPFELANGKSSVGQINGPLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            C +C +P  LA  + +V      L  +FH TCF C++C+  L    F+  +    C  C  ++LEKC  C   I DR++R  G  YHP+CFTC VC C L+G +F VD   +  C+ D+HK+YAPRC  C EPI P+ G  E  R+++ DK FH++C
Sbjct:  345 CGKCNQP--LARAQPAVRA----LGQLFHITCFTCHQCQQQLQGQQFYSLEGAPYCEGCYTDTLEKCNTCGQPITDRMLRATGKAYHPQCFTCVVCACPLEGTSFIVDQANQPHCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKC 495          
BLAST of Lipoma-preferred partner vs. UniProt/SwissProt
Match: sp|Q3SX26|TRIP6_BOVIN (Thyroid receptor-interacting protein 6 OS=Bos taurus OX=9913 GN=TRIP6 PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 9.943e-37
Identity = 66/147 (44.90%), Postives = 90/147 (61.22%), Query Frame = 3
Query:  711 GKSSVGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            G+  VG   G   L+ VFH  CF C  C A L    F+  ++R  C  C   +LEKC+ C+  I DRI+R +G  YHP CFTC VC+  LDG  FTVD   ++ C+EDFH+++APRC  CG  I P+ G +E  RI++ D++FH+ C
Sbjct:  288 GEDVVGDGAGVVALDRVFHVGCFVCSTCRAQLRGQHFYAVERRAYCESCYVATLEKCSTCSQPILDRILRAMGKAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVALDRSFHIGC 434          
BLAST of Lipoma-preferred partner vs. UniProt/SwissProt
Match: sp|Q15654|TRIP6_HUMAN (Thyroid receptor-interacting protein 6 OS=Homo sapiens OX=9606 GN=TRIP6 PE=1 SV=3)

HSP 1 Score: 144.05 bits (362), Expect = 1.032e-36
Identity = 62/134 (46.27%), Postives = 84/134 (62.69%), Query Frame = 3
Query:  744 LNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            L+ VFH  CF C  C A L    F+  ++R  C  C   +LEKC  C+  I DRI+R +G  YHP CFTC VC+  LDG  FTVD   ++ C+EDFH+++APRC  CG  I P+ G +E  RI++ D++FH+ C
Sbjct:  296 LDRVFHVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRILRAMGKAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVALDRSFHIGC 429          
BLAST of Lipoma-preferred partner vs. UniProt/SwissProt
Match: sp|Q9Z1Y4|TRIP6_MOUSE (Thyroid receptor-interacting protein 6 OS=Mus musculus OX=10090 GN=Trip6 PE=1 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 1.173e-36
Identity = 66/147 (44.90%), Postives = 90/147 (61.22%), Query Frame = 3
Query:  711 GKSSVGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            G+  VG   G   L+ VFH  CF C  C A L    F+  ++R  C  C   +LEKC+ C+  I DRI+R +G  YHP CFTC VC+  LDG  FTVD   ++ C+EDFH+++APRC  CG  I P+ G +E  RI++ D++FH+ C
Sbjct:  287 GEDVVGDGAGVVALDRVFHIGCFVCSTCRAQLRGQHFYAVERRAYCESCYVATLEKCSTCSEPILDRILRAMGKAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVALDRSFHIGC 433          
BLAST of Lipoma-preferred partner vs. UniProt/SwissProt
Match: sp|Q5F464|LPP_CHICK (Lipoma-preferred partner homolog OS=Gallus gallus OX=9031 GN=LPP PE=2 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 1.583e-36
Identity = 67/161 (41.61%), Postives = 92/161 (57.14%), Query Frame = 3
Query:  669 NECHRCRKPFELANGKSSVGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
              C RC        G++ VG+  G   ++ VFH  CF C  C   L    F+  +K+  C  C   +LE+C+VC   I +RI+R  G  YHP CFTC +C+  LDG  FTVD    + C+EDFHK++APRC  C EPI P  G +E  RI++ D+ FH++C
Sbjct:  406 GRCARC--------GENVVGEGTGCTAMDQVFHVECFTCMMCNNKLRGQPFYAVEKKAYCEPCYINTLEQCSVCAKPIMERILRATGKAYHPHCFTCVMCHRSLDGIPFTVDAGGNIHCIEDFHKKFAPRCSVCKEPIMPAPGQEETVRIVALDRDFHVQC 558          
BLAST of Lipoma-preferred partner vs. UniProt/SwissProt
Match: sp|Q04584|ZYX_CHICK (Zyxin OS=Gallus gallus OX=9031 GN=ZYX PE=1 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 3.466e-36
Identity = 62/157 (39.49%), Postives = 96/157 (61.15%), Query Frame = 3
Query:  675 CHRCRKPFELANGKSSVGQINGPLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            C  CRKP  L+  + +V      L+ +FH  CF C++CE  L    F+   ++  C  C   +LEKC+VC   I DR+++  G+ YHP+CFTC +C+  L+G +F VD   +  C++D+H++YAPRC  C EPI P+ G  E  R+++ +K FH++C
Sbjct:  352 CGFCRKP--LSRTQPAVRA----LDCLFHVECFTCFKCEKQLQGQQFYNVDEKPFCEDCYAGTLEKCSVCKQTITDRMLKATGNSYHPQCFTCVMCHTPLEGASFIVDQANQPHCVDDYHRKYAPRCSVCSEPIMPEPGKDETVRVVALEKNFHMKC 502          
BLAST of Lipoma-preferred partner vs. TrEMBL
Match: A0A183QV67 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 1.932e-52
Identity = 118/339 (34.81%), Postives = 173/339 (51.03%), Query Frame = 3
Query:  279 LSKTNYPKYTDEMTTATL-----IPVVHL-------------------------PSNNNSDYSTSTRKST-------SFNDPPKSNLSQVRKNSEAEVDALTNILIKSIANKTENKDSNPRSYTSSTYLPNQPYSSKRVSNTSSQPAVXXXXXXXXXXXXXXXXXXXNECHRCRKPFELANGKSSVGQIN---------GPLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHE-SLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLECSGI 1154
            +S  + P Y    +++T+     IPVVHL                         P+   +D   ST+ ST       +  + P +  +    + EAEVDALTN+L++S+  +T +  S+  +  +ST  P+           +S PA S  ++  T S    +++  N C RCR+      G +  G +N         G L    H  CF CYRC A L  D++++  +RLLC  CV + ++E C+ C+  I DR++  LG PYHP CF C VC   LD + FT+DVH R+ CL DFHKRYAPRC +CG PI P  G QE +R++SG+  +HLEC G+
Sbjct:   17 ISSIDAPHYAQGSSSSTIGQSIVIPVVHLGASRGSISSSSYTMASHSSENLDNTPNALQTDNGESTKSSTFRTSSVLTAGNRPINRPAPPLSDPEAEVDALTNLLMQSM--ETRSSVSSAGAGGTSTSGPD---------GVNSSPASSICNSGDTTSAVTNATVGQNICFRCRRSLFPPEGTTLSGSLNSTNNVVTLTGALGVKLHVACFTCYRCAAPLKSDAYYHNLRRLLCPACVRDGAVEACSNCHRPIGDRVVHALGMPYHPNCFVCVVCAGRLDSRPFTIDVHGRLHCLTDFHKRYAPRCASCGRPIVPDAGCQEARRVVSGNSNYHLECFGV 344          
BLAST of Lipoma-preferred partner vs. TrEMBL
Match: A0A564XWH0 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS634 PE=4 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 1.872e-50
Identity = 144/425 (33.88%), Postives = 199/425 (46.82%), Query Frame = 3
Query:  105 RRVFDLDSAFNERASPRAKLFSDLYGLLDMNQSTFPH----SRLYNFTLDA---RDREPYP-IDNRLSKTNYPKYTDEMTTATL-----IPVVHLPSNN-----------------NSDYSTST--RKSTSFNDPPKSNLSQVRKNSEAEVDALTNILIKSI-ANKTENKDSNP----------------RSYTSSTYLPN-----QPYSSKRVS-------NTSSQPAVXXXXXXXXXXXXXXXXXXX-----NECHRCRKPF------ELANGKSS--VGQINGPLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHES-LEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLECSGI 1154
            RR   L+SAFNERA PR       +  +   Q T PH    S LY     +   RD    P  D  +  T+ P Y      ++      IPVVHL S                    S+Y T    RK+T    P  ++ + +  + EAEVDALT++LI+ + A ++     +P                R    +T LP+     Q  + +RV        N +  P   +S  +++ + S  SS  +     N C RCR+P        L  G  +  V  + G L    H+ CF CY C   LN   ++++  RLLC  CV +  +E C  C   I +RI+R LG PYHP CF C+VC+  LD K FTVDVH R  CLEDFHKRYAPRC  C  PI P+ G QE +R+++G+  +HL C G+
Sbjct:    8 RRSTYLNSAFNERAGPRTTDDRKYHHTVKPAQRT-PHYAQVSELYPMQASSGGPRDFRYRPNADIMMPGTDMPGYGQGRLGSSGGGGVPIPVVHLDSPTYHSSRGVYSGGLSRPEPASNYRTGGLLRKAT----PTVTSPTSLSTDPEAEVDALTDVLIQKMEAPRSTGGIMSPHGSDVDGTSSPVGSIRRGSGGTTTLPSRMIQFQQRTQQRVGSPSTANNNNAGSPLTVSSPRTSSPTNSSASSGITDSFLQNNCFRCRRPLVPPESATLGPGSPNPPVVTLTGALAVRLHEACFTCYNCRTKLNPQGYYHSLHRLLCPTCVRDGEVESCVNCGRPIGERIVRALGAPYHPGCFVCSVCHTHLDAKPFTVDVHGRPLCLEDFHKRYAPRCAVCSRPIAPEAGSQEARRVVAGNSNYHLACYGV 427          
BLAST of Lipoma-preferred partner vs. TrEMBL
Match: A0A3S5BA20 (Uncharacterized protein (Fragment) OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS31606 PE=4 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 2.719e-49
Identity = 81/175 (46.29%), Postives = 107/175 (61.14%), Query Frame = 3
Query:  669 NECHRCRKPF---------------ELANGKSSVGQINGPLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHE-SLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            N C RCR+P                  A+  ++V Q+ G L    H  CF CYRC A L +D+++++ +RLLC  CV + ++E C+ C   I DR++R LG PYHP CF CTVC   LD + FTVDVH R  CL DFH+RYAPRC  CG PI P+ G QE +R+++GD  +HLEC
Sbjct:  193 NACFRCRRPLLPPEGSTLSPTTGLAGPASASANVIQLTGALAVRLHVACFTCYRCSAPLRLDAYYHSLRRLLCPACVRDGAVEACSNCRRPIGDRVVRALGLPYHPGCFVCTVCGLRLDARPFTVDVHGRPHCLADFHRRYAPRCAQCGRPIAPEAGSQEARRVVAGDANYHLEC 367          
BLAST of Lipoma-preferred partner vs. TrEMBL
Match: A0A183A8B3 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS3198 PE=4 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 2.901e-48
Identity = 88/208 (42.31%), Postives = 120/208 (57.69%), Query Frame = 3
Query:  570 SSKRVSNTSSQPAVXXXXXXXXXXXXXXXXXXXNECHRCRKPF------------ELANGKSSVGQINGPLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHE-SLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLECSGI 1154
            S+  V N +S+P       ST    +   + SSN C RCR+                AN  S+V  + G L+   H  CF CYRC A L  D+++++ +RLLC  CV + ++E C+ C   I DRI+  LG PYHP CF C VC   LD + FT+D+H R+ CL+DFH+RYAPRC  C  PI P+ G QE +R++SGD  +HLEC G+
Sbjct:  202 STSSVHNAASEPGSVGLLGSTLVGANSSGTQSSNSCFRCRRALIPPDGSTLNPSVSTANNSSNVVTLTGALSVRLHVACFTCYRCAAPLRPDAYYHSLRRLLCPACVRDGAVETCSNCRRPIGDRIVHALGLPYHPNCFVCVVCAGRLDSRPFTIDIHGRLHCLDDFHRRYAPRCAVCARPIAPEPGSQEARRVVSGDSNYHLECFGV 409          
BLAST of Lipoma-preferred partner vs. TrEMBL
Match: A0A3P7SR76 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS1103 PE=4 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 8.706e-48
Identity = 81/171 (47.37%), Postives = 102/171 (59.65%), Query Frame = 3
Query:  669 NECHRCRKPF------ELANGKSS--VGQINGPLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHES-LEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLECSGI 1154
            N C RCR+P        L  G  S  V  + G L    H+TCF CY C   LN   ++++  RLLC  CV +  +E C  C   I +RI+R LG PYHP CF C+VC+  LD K FTVDVH R  CLEDFHKRYAPRC  C  PI P+ G QE +R+++G+  +HL C G+
Sbjct:   57 NNCFRCRRPLIPPESATLGPGSPSPPVVTLTGALAVRLHETCFTCYNCRTKLNPQGYYHSLHRLLCPTCVRDGEVESCVNCGRPIGERIVRALGAPYHPGCFVCSVCHTHLDAKPFTVDVHGRPLCLEDFHKRYAPRCAVCSRPIAPEAGSQEARRVVAGNSNYHLSCYGV 227          
BLAST of Lipoma-preferred partner vs. Ensembl Cavefish
Match: lpp (lipoma-preferred partner homolog [Source:NCBI gene;Acc:103032787])

HSP 1 Score: 145.206 bits (365), Expect = 9.699e-39
Identity = 82/249 (32.93%), Postives = 123/249 (49.40%), Query Frame = 3
Query:  414 PKSNLSQVRKNSEAEVDALTNILIKSIANKTENKDSNPRSYTSSTYLPNQPY---SSKRVSNTSSQPAVXXXXXXXXXXXXXXXXXXXNECHRCRKPFELANGKSSVGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            P+  L + R + +AE+D+LT+IL   + + +  K   P+    S   P +     + K + + +  P+                      C  C        G++ +G+  G   ++ VFH  CF C  C   L    F+  +K+  C  C   +LE C +C   I +RI+R  G PYHP CFTC VC+  LDG  FTVD    + C+EDFHK++APRC  C EPI P  G +E  RI++ D+ FH++C
Sbjct:  106 PEKTLEERRSSLDAEIDSLTSIL-ADLESSSPYKPRTPQGPGQSMARPEEELDRLTKKMLYDMNHPPS----------------EEYFGRCASC--------GENVLGEGTGCTAMDQVFHVDCFICMTCSCKLRGKPFYAVEKKAYCEPCYINTLETCNICAKPIMERILRATGKPYHPHCFTCVVCHRSLDGIPFTVDASNHIHCIEDFHKKFAPRCSVCQEPIMPAPGQEETVRIVALDRDFHVQC 329          
BLAST of Lipoma-preferred partner vs. Ensembl Cavefish
Match: ENSAMXT00000040849.1 (thyroid receptor-interacting protein 6-like [Source:NCBI gene;Acc:103041331])

HSP 1 Score: 148.288 bits (373), Expect = 1.636e-38
Identity = 60/134 (44.78%), Postives = 85/134 (63.43%), Query Frame = 3
Query:  744 LNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            +  VFH  CF C  C A L    F+   K+  C  C   +LE+C+ C+  I DRI+R +G  YHP+CF C VC CCLDG  FTVD   ++ C++DFH+++APRC  C +PI P+ G +E  RI++ D++FH+ C
Sbjct:  402 MEQVFHVECFTCITCHARLRGQPFYALDKKSYCESCYISTLERCSKCSNPILDRILRAMGKAYHPRCFNCVVCGCCLDGVPFTVDATSQIHCIDDFHRKFAPRCSVCCQPIMPEPGQEETVRIVALDRSFHVNC 535          
BLAST of Lipoma-preferred partner vs. Ensembl Cavefish
Match: ENSAMXT00000036341.1 (thyroid receptor-interacting protein 6-like [Source:NCBI gene;Acc:103041331])

HSP 1 Score: 147.902 bits (372), Expect = 1.871e-38
Identity = 60/134 (44.78%), Postives = 85/134 (63.43%), Query Frame = 3
Query:  744 LNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            +  VFH  CF C  C A L    F+   K+  C  C   +LE+C+ C+  I DRI+R +G  YHP+CF C VC CCLDG  FTVD   ++ C++DFH+++APRC  C +PI P+ G +E  RI++ D++FH+ C
Sbjct:  394 MEQVFHVECFTCITCHARLRGQPFYALDKKSYCESCYISTLERCSKCSNPILDRILRAMGKAYHPRCFNCVVCGCCLDGVPFTVDATSQIHCIDDFHRKFAPRCSVCCQPIMPEPGQEETVRIVALDRSFHVNC 527          
BLAST of Lipoma-preferred partner vs. Ensembl Cavefish
Match: ENSAMXT00000037949.1 (thyroid receptor-interacting protein 6-like [Source:NCBI gene;Acc:103041331])

HSP 1 Score: 147.902 bits (372), Expect = 1.871e-38
Identity = 60/134 (44.78%), Postives = 85/134 (63.43%), Query Frame = 3
Query:  744 LNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            +  VFH  CF C  C A L    F+   K+  C  C   +LE+C+ C+  I DRI+R +G  YHP+CF C VC CCLDG  FTVD   ++ C++DFH+++APRC  C +PI P+ G +E  RI++ D++FH+ C
Sbjct:  394 MEQVFHVECFTCITCHARLRGQPFYALDKKSYCESCYISTLERCSKCSNPILDRILRAMGKAYHPRCFNCVVCGCCLDGVPFTVDATSQIHCIDDFHRKFAPRCSVCCQPIMPEPGQEETVRIVALDRSFHVNC 527          
BLAST of Lipoma-preferred partner vs. Ensembl Cavefish
Match: lpp (lipoma-preferred partner homolog [Source:NCBI gene;Acc:103032787])

HSP 1 Score: 144.821 bits (364), Expect = 2.080e-37
Identity = 64/147 (43.54%), Postives = 88/147 (59.86%), Query Frame = 3
Query:  711 GKSSVGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            G++ +G+  G   ++ VFH  CF C  C   L    F+  +K+  C  C   +LE C +C   I +RI+R  G PYHP CFTC VC+  LDG  FTVD    + C+EDFHK++APRC  C EPI P  G +E  RI++ D+ FH++C
Sbjct:  372 GENVLGEGTGCTAMDQVFHVDCFICMTCSCKLRGKPFYAVEKKAYCEPCYINTLETCNICAKPIMERILRATGKPYHPHCFTCVVCHRSLDGIPFTVDASNHIHCIEDFHKKFAPRCSVCQEPIMPAPGQEETVRIVALDRDFHVQC 518          
BLAST of Lipoma-preferred partner vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010404.1 (pep scaffold:Pmarinus_7.0:GL477924:140:5584:1 gene:ENSPMAG00000009420.1 transcript:ENSPMAT00000010404.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 1.906e-21
Identity = 42/91 (46.15%), Postives = 61/91 (67.03%), Query Frame = 3
Query:  858 ESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRP-QNG-GQENKRIISGD 1124
            ++ +KC  C  +I + I++ +G  YHP CF C VCN CLDG  FTVD   R++C++D+H+ +AP+C ACG PI P Q+G G   K++ SG 
Sbjct:    6 QNADKCFECGHLIMETILQAVGKSYHPTCFRCVVCNECLDGVPFTVDRDHRVYCVQDYHRTFAPKCAACGLPILPNQSGCGSVRKQLSSGQ 96          
BLAST of Lipoma-preferred partner vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010401.1 (pep scaffold:Pmarinus_7.0:GL477924:137:5584:1 gene:ENSPMAG00000009420.1 transcript:ENSPMAT00000010401.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.5001 bits (210), Expect = 2.524e-20
Identity = 38/79 (48.10%), Postives = 54/79 (68.35%), Query Frame = 3
Query:  858 ESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKR-YAPRCDACGEPIRPQNG 1091
            ++ +KC  C  +I + I++ +G  YHP CF C VCN CLDG  FTVD   R++C++D+H+R +AP+C ACG PI P  G
Sbjct:    7 QNADKCFECGHLIMETILQAVGKSYHPTCFRCVVCNECLDGVPFTVDRDHRVYCVQDYHRRTFAPKCAACGLPILPNQG 85          
BLAST of Lipoma-preferred partner vs. Ensembl Sea Lamprey
Match: lims2 (LIM and senescent cell antigen-like domains 2 [Source:ZFIN;Acc:ZDB-GENE-050522-56])

HSP 1 Score: 59.3066 bits (142), Expect = 5.267e-10
Identity = 46/154 (29.87%), Postives = 65/154 (42.21%), Query Frame = 3
Query:  708 NGKSSVGQINGPLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEK------CTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHE---RMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLE 1142
            +G+  VG++   +N  +H  CF C  C   L    F     R LC  C +    K      C  C+ II+++ +     PYHP  F CT C     GK  T D  E    ++CL    K   P C AC  PI       E + + +  K +H+E
Sbjct:  139 SGEFIVGRVIKAMNNSWHPECFRCNICSEMLADVGFVKNAGRHLCRPCHNREKAKGLGKYICQKCHAIIDEQPLLFKNDPYHPDHFNCTNC-----GKELTADARELKGELYCLPCHDKMGIPICGACRRPI-------EGRVVNAMGKQWHVE 280          
BLAST of Lipoma-preferred partner vs. Ensembl Sea Lamprey
Match: ablim1a (actin binding LIM protein 1a [Source:ZFIN;Acc:ZDB-GENE-080219-41])

HSP 1 Score: 59.3066 bits (142), Expect = 1.184e-9
Identity = 30/99 (30.30%), Postives = 44/99 (44.44%), Query Frame = 3
Query:  675 CHRCRKPFELANGKSSVGQINGPLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHES-LEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNC 968
            CH+C +P +        G+     +  FH  CF C  C  +L  + FF      LC+    +    +CT C   +   ++  LG  YHP+CF C VC C
Sbjct:   14 CHKCSEPCK--------GEALRVQDRHFHIKCFICKVCGCDLAQNGFFMKSGEYLCTHDYQQQHGTRCTGCGDFVEGEVVTALGKTYHPQCFVCAVCRC 104          

HSP 2 Score: 58.151 bits (139), Expect = 2.873e-9
Identity = 38/152 (25.00%), Postives = 63/152 (41.45%), Query Frame = 3
Query:  726 GQINGPLNTVFHQTCFNCYRCEANLNV-DSFFYAQKRLLCSRCVHE---------SLEKCTVCNF-IINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLECS 1148
            G++   L   +H  CF C  C       D   +  K  LC RC+           +   CT C   I+N + +  L   +H  CF C  C   L G+  + D     +C +D+  ++  +C+ CG+ I         K + +G+K +H  C+
Sbjct:   82 GEVVTALGKTYHPQCFVCAVCRCPFPAGDRVTFNGKDCLCQRCIQPVATNAKDIGASTNCTGCGSDIMNGQALLALDKQWHLGCFKCKTCGKVLTGEYISKD--GVPYCEQDYQSQFGIKCEECGKFI-------TGKVLEAGEKHYHPSCA 224          
BLAST of Lipoma-preferred partner vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007081.1 (pep scaffold:Pmarinus_7.0:GL476780:360940:430661:-1 gene:ENSPMAG00000006392.1 transcript:ENSPMAT00000007081.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 3.268e-9
Identity = 34/109 (31.19%), Postives = 47/109 (43.12%), Query Frame = 3
Query:  672 ECHRCRKPFELANGKSSVGQINGPLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSR-CVHESLEKCTVCNFII--NDRIIRVLGHPYHPKCFTCTVCNCCLDGKAF 989
            +C +CRK          +G+I   L   +H TCF C  C        F        C +  V     KC  C+F +   D+ I  LGH +H  CF C VC+  L+G+ F
Sbjct:  477 DCAKCRKKI--------MGEIMHALRQTWHTTCFVCASCGKPFGNSLFHMEDGEPYCEKDYVVLFSTKCHGCDFPVEAGDKFIEALGHTWHDTCFICAVCHVNLEGQPF 577          
BLAST of Lipoma-preferred partner vs. Ensembl Nematostella
Match: EDO39581 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9J0])

HSP 1 Score: 109.768 bits (273), Expect = 1.347e-27
Identity = 55/147 (37.41%), Postives = 82/147 (55.78%), Query Frame = 3
Query:  711 GKSSVGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            G+   G+  G   ++ +FH  CF C +C   L    F+       C     +SLE C  C+  I DRI+R  G  +HP CF C  C+  LDG  FT+D   ++ CLED++++Y+PRC +C + I P++G  E  RI+S +K FH+ C
Sbjct:   40 GQKVSGEGTGCTAMDKLFHIKCFICVKCGCQLTGKVFYKVDNDAYCEADYLDSLETCWYCHQHITDRILRATGKCFHPHCFNCEECHKNLDGVPFTLDNFNKVHCLEDYYRKYSPRCASCHQLILPEDGQDETVRIVSMNKDFHVRC 186          
BLAST of Lipoma-preferred partner vs. Ensembl Nematostella
Match: EDO32541 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUS6])

HSP 1 Score: 105.916 bits (263), Expect = 3.929e-27
Identity = 53/147 (36.05%), Postives = 78/147 (53.06%), Query Frame = 3
Query:  744 LNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEK------CTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLECSGITIKN 1166
            +  ++H  CF C+ C   L    F+  + R+ C +  ++SLE+      C  C  +I  RI++ LG  YHP CF C VC   L+G  FTVD    ++C+ D+H++Y+PRC AC EPI P     E  R++   K FH  C    + N
Sbjct:    1 MGNLYHAQCFLCHTCGKELRGQEFYRLENRVYCKQ-DYKSLERHQRPKRCHSCKEVIGQRILQTLGRDYHPVCFRCCVCEVELEGTPFTVDRQNAIYCIPDYHRKYSPRCHACREPIAPDEKSDETIRVVCLGKQFHDRCFKCEVTN 146          
BLAST of Lipoma-preferred partner vs. Ensembl Nematostella
Match: EDO41181 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S548])

HSP 1 Score: 73.559 bits (179), Expect = 1.065e-14
Identity = 46/135 (34.07%), Postives = 62/135 (45.93%), Query Frame = 3
Query:  687 RKPFELANGKSSVGQINGPLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLE-KCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFT-VDVHER---MFCLEDFHKRYAPRCDACGEPI 1076
            +K    A  K  +GQ+   L   +H   F C  CEA L   +FF    +  C R  H++   +C  CN  I D  +  L   +HP+ F C  C     G  F     HER    FC ED++  +APRC  CG+PI
Sbjct:   22 KKGMCAACNKPIIGQVCTALGKTWHPEHFACVACEAPLGTQNFFERDGKPYCERDYHDTFAPRCAYCNGPILDSCVTALDQTWHPEHFVCAEC-----GNPFGDTGFHERDGKPFCREDYYAMFAPRCGGCGQPI 151          
BLAST of Lipoma-preferred partner vs. Ensembl Nematostella
Match: LIMPET (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFX6])

HSP 1 Score: 67.3958 bits (163), Expect = 5.329e-12
Identity = 54/165 (32.73%), Postives = 72/165 (43.64%), Query Frame = 3
Query:  675 CHRCR-----KPFELANGKSSVGQIN-GPLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEK-CTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGD-KTFHLEC 1145
            CH CR     K     NG  + G+   G  +  FH  CF C  C+  +    F    +R LC+ C      K C  CN +I    ++  G  YH +CFTC  C+  L G  FT     R  C   + +RYA RC AC   I      + N + ++ D K FH EC
Sbjct:  367 CHGCRGINPSKVCAACNGDFAPGEKKVGYQSKTFHDKCFICDECKQPIGSKQFIRRDERRLCNNCFDSKFAKVCVKCNQVIKTSSVQHAGSTYHSECFTCHHCDKPLAGSPFTKQ-EGRNVCQNCYRERYAKRCGACHNLI------EGNTKFVAYDEKYFHREC 524          

HSP 2 Score: 52.373 bits (124), Expect = 3.017e-7
Identity = 65/270 (24.07%), Postives = 108/270 (40.00%), Query Frame = 3
Query:  342 VHLPSNNNSDYST-STRKSTSFNDPP---KSNLSQV---------RKNSEAEVDALTNILIKSIANKTENKDSNPRSYTSSTYLPNQPYSSKRVSNTSSQPAVXX-------XXXXXXXXXXXXXXXXXNECHRCRKPFELANGKSSVGQINGPLNTVFHQTCFNCYRCEANLNVDSFFYAQK-RLLCSRCVHESLE-KCTVCN-FIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRP 1082
            +H+ S NN+D +T   R      DPP    S+L Q          R  +  E+    ++L +    K ++  +  R+   S  +P Q +SSK     +    ++           +      R      + C RC  P    +  +   +  GP ++ +H  CF C   +  L VD  + ++   + C R   E L+ +C  C   I      + L   +HP    C+ C+  L  + F V V     C   + + +A RC+ACGEPI P
Sbjct:   62 LHVLSTNNNDQNTPEERMGVEEEDPPMLQGSHLQQAMMEGYEWVPRGLTSEEIQIYMSLLPEDKIPKLKSLGAQHRTKQLSLQIPLQDFSSKHCKKLTLDQKMAMDDFCEKRIKTALGVGAVRACMAQPSTCKRCNGPVNPGD-MALFAERLGP-DSCWHVKCFTCEE-DGELLVDLIYCSKDDEIYCCRHWGEKLKPRCAGCEELIYVGEYSQALEKNWHPGHLCCSYCDESLSNQKF-VTVEGSPSCFRCYDENFANRCEACGEPIGP 327          
BLAST of Lipoma-preferred partner vs. Ensembl Nematostella
Match: EDO49798 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFX7])

HSP 1 Score: 60.8474 bits (146), Expect = 3.234e-10
Identity = 43/139 (30.94%), Postives = 65/139 (46.76%), Query Frame = 3
Query:  672 ECHRCRKPFELANGKSSVGQINGPLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLE-KCTVCNFII-NDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRP 1082
            EC  C     +A   S  GQ     +T +H +CF C  C+  L    +FY   ++ C R   E+L+ +C  C+ II  ++        +H + F C  C+C L G  + +    + +C   F   YA  CD+CGEPI P
Sbjct:  174 ECGECVTAGSMAVYASRAGQ-----HTCWHASCFICTTCKELLVDLIYFYKDSKVYCGRHHAETLKPRCAACDEIIFAEQCTEAEDSCWHVQHFCCFECDCPLGGMRYVMR-DNKPYCCHCFESLYAEFCDSCGEPIEP 306          
BLAST of Lipoma-preferred partner vs. Ensembl Medaka
Match: ENSORLT00000008337.2 (thyroid hormone receptor interactor 6 [Source:NCBI gene;Acc:101164348])

HSP 1 Score: 160.229 bits (404), Expect = 5.755e-43
Identity = 71/161 (44.10%), Postives = 98/161 (60.87%), Query Frame = 3
Query:  669 NECHRCRKPFELANGKSSVGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
              C RC        G + VG  +G   +  VFH  CF C  C   L    F+  +K+  C  C   +LE+C+ C+  I DRI+R +G  YHP+CFTC VCNCCLDG  FTVD   ++ C++DFH++YAPRC  CGEPI P+ G +E  RI++ D++FH++C
Sbjct:  367 GRCARC--------GDNVVGDGSGCIAMEQVFHVECFTCITCHTRLRGKPFYALEKKSYCENCYISTLERCSKCSKPILDRILRAMGKAYHPRCFTCVVCNCCLDGVPFTVDATSQIHCIDDFHRKYAPRCSVCGEPIMPEPGQEETVRIVALDRSFHVDC 519          
BLAST of Lipoma-preferred partner vs. Ensembl Medaka
Match: lpp (lipoma-preferred partner homolog [Source:NCBI gene;Acc:101167359])

HSP 1 Score: 144.05 bits (362), Expect = 3.437e-37
Identity = 63/147 (42.86%), Postives = 91/147 (61.90%), Query Frame = 3
Query:  711 GKSSVGQING--PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            G++ VG+  G   ++ VFH +CF C  C   L    F+  +K+  C  C  ++LE C++C+  I +RI+R  G  YHP CF C VC+  LDG  FTVD   ++ C+EDFHK++APRC  C EPI P  G +E  RI++ D+ FH++C
Sbjct:  370 GENVVGEGTGCTAMDQVFHVSCFICVTCGTKLRGKPFYAVEKKAFCEPCYIKTLETCSICSKPIMERILRATGKAYHPHCFICVVCHRSLDGIPFTVDASNQIHCIEDFHKKFAPRCCVCSEPIMPAPGQEETVRIVALDRDFHVQC 516          
BLAST of Lipoma-preferred partner vs. Ensembl Medaka
Match: LIMD1 (LIM domains containing 1 [Source:NCBI gene;Acc:101175430])

HSP 1 Score: 129.798 bits (325), Expect = 3.070e-32
Identity = 52/139 (37.41%), Postives = 80/139 (57.55%), Query Frame = 3
Query:  744 LNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSR-----CVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            + +++H +CF C  C   L   +F+Y   ++ C          +S +KC  C  +I D I++ LG  YHP CF C +CN  LDG  FTVD   +++C+ D+H+  AP+C AC +PI P  G  E  R++S +K +H+EC
Sbjct:  355 MGSLYHDSCFTCTACSRRLRGKAFYYVGGKVFCEEDFLYSGFQQSADKCNACGHLIMDMILQALGKSYHPGCFRCVICNESLDGVPFTVDTENKIYCVRDYHRVLAPKCAACNQPILPSEGSDETIRVVSMEKDYHVEC 493          
BLAST of Lipoma-preferred partner vs. Ensembl Medaka
Match: wtip (WT1 interacting protein [Source:NCBI gene;Acc:101158185])

HSP 1 Score: 124.405 bits (311), Expect = 4.392e-30
Identity = 57/162 (35.19%), Postives = 85/162 (52.47%), Query Frame = 3
Query:  675 CHRCRKPFELANGKSSVGQINGPLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSR-----CVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            C +C K      G     Q    +  ++H  CF C  C   L   +F+    ++ C          ++ EKC VC  +I + I++ LG  YHP CF C VC   LDG  FTVDV   ++C++D+H  +AP+C +C +PI P  G +E  R++S DK +H+EC
Sbjct:  490 CIKCGK------GVYGASQACQAMGNLYHTNCFTCCSCGRRLRGKAFYNVNGKVYCEEDFLYSGFQQTAEKCFVCGHLIMEMILQALGKSYHPGCFRCVVCKEGLDGVPFTVDVENNIYCVKDYHTVFAPKCASCNQPILPAQGSEETIRVVSMDKDYHVEC 645          
BLAST of Lipoma-preferred partner vs. Ensembl Medaka
Match: wtip (WT1 interacting protein [Source:NCBI gene;Acc:101158185])

HSP 1 Score: 123.635 bits (309), Expect = 8.953e-30
Identity = 54/155 (34.84%), Postives = 82/155 (52.90%), Query Frame = 3
Query:  696 FELANGKSSVGQINGPLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSR-----CVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
             +   G     Q    +  ++H  CF C  C   L   +F+    ++ C          ++ EKC VC  +I + I++ LG  YHP CF C VC   LDG  FTVDV   ++C++D+H  +AP+C +C +PI P  G +E  R++S DK +H+EC
Sbjct:  491 IKCGKGVYGASQACQAMGNLYHTNCFTCCSCGRRLRGKAFYNVNGKVYCEEDFLYSGFQQTAEKCFVCGHLIMEMILQALGKSYHPGCFRCVVCKEGLDGVPFTVDVENNIYCVKDYHTVFAPKCASCNQPILPAQGSEETIRVVSMDKDYHVEC 645          
BLAST of Lipoma-preferred partner vs. Planmine SMEST
Match: SMESG000031084.1 (SMESG000031084.1)

HSP 1 Score: 701.049 bits (1808), Expect = 0.000e+0
Identity = 360/361 (99.72%), Postives = 361/361 (100.00%), Query Frame = 3
Query:   84 MHYNHPFRRVFDLDSAFNERASPRAKLFSDLYGLLDMNQSTFPHSRLYNFTLDARDREPYPIDNRLSKTNYPKYTDEMTTATLIPVVHLPSNNNSDYSTSTRKSTSFNDPPKSNLSQVRKNSEAEVDALTNILIKSIANKTENKDSNPRSYTSSTYLPNQPYSSKRVSNTSSQPAVXXXXXXXXXXXXXXXXXXXNECHRCRKPFELANGKSSVGQINGPLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLECSGITIKN 1166
            MHYNHPFRRVFDLDSAFNERASPRAKLFSDLYGLLDMNQSTFPHSRLYNFTLDARDREPYP+DNRLSKTNYPKYTDEMTTATLIPVVHLPSNNNSDYSTSTRKSTSFNDPPKSNLSQVRKNSEAEVDALTNILIKSIANKTENKDSNPRSYTSSTYLPNQPYSSKRVSNTSSQPAVSTSSNSTTGSISRQSSLSSNECHRCRKPFELANGKSSVGQINGPLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLECSGITIKN
Sbjct:    1 MHYNHPFRRVFDLDSAFNERASPRAKLFSDLYGLLDMNQSTFPHSRLYNFTLDARDREPYPLDNRLSKTNYPKYTDEMTTATLIPVVHLPSNNNSDYSTSTRKSTSFNDPPKSNLSQVRKNSEAEVDALTNILIKSIANKTENKDSNPRSYTSSTYLPNQPYSSKRVSNTSSQPAVSTSSNSTTGSISRQSSLSSNECHRCRKPFELANGKSSVGQINGPLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLECSGITIKN 361          
BLAST of Lipoma-preferred partner vs. Planmine SMEST
Match: SMESG000038145.1 (SMESG000038145.1)

HSP 1 Score: 115.161 bits (287), Expect = 5.841e-28
Identity = 51/140 (36.43%), Postives = 80/140 (57.14%), Query Frame = 3
Query:  741 PLNTVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSR-----CVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
             L  ++H  CF C  C  +L    F+  Q+++ C         H+S++ C  C  I+ + I+  LG  +HP+CF C++C+ CLDG  FTVD +  ++C+ D+H  +APRC  C +PI P+    E  RI+  D+ FH+EC
Sbjct:  220 ALGNLYHSNCFTCCYCNRSLRGRVFYKDQEKIYCENDYMVFGFHKSVKVCFACGHIVTETILEALGKDFHPRCFKCSICHKCLDGIPFTVDRNNNIYCIIDYHNTFAPRCAICLQPIIPRKDSDEVVRIVVNDRDFHVEC 359          
BLAST of Lipoma-preferred partner vs. Planmine SMEST
Match: SMESG000031934.1 (SMESG000031934.1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.849e-23
Identity = 50/165 (30.30%), Postives = 84/165 (50.91%), Query Frame = 3
Query:  696 FELANGKSSVGQINGPLN----------TVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSR----C-VHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            F   NG     Q +G +N           +FH  CF+C  C   L    F+    +L C      C   +S ++C +C  +I ++I++  G+ YH  CF CT+CN CLDG  FT+D   ++ C++D++  ++  C++C +PI P+      K+++  +K FH  C
Sbjct:    3 FNSINGSVLCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFAC 167          
BLAST of Lipoma-preferred partner vs. Planmine SMEST
Match: SMESG000072127.1 (SMESG000072127.1)

HSP 1 Score: 67.3958 bits (163), Expect = 8.637e-12
Identity = 43/131 (32.82%), Postives = 65/131 (49.62%), Query Frame = 3
Query:  756 FHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVHESL-EKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            +H+ CF C  C   +   SF   ++ ++C  C  E   +KCT C  +I    +   G P+H +CFTCT C+  L G  FT    E+ +C E + + +A +C  C +PI    G    K I   D+ +H EC
Sbjct:  374 WHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSK-EEKPYCAECYGELFAKKCSKCTKPITGFGG---CKFISFEDRHWHSEC 500          
BLAST of Lipoma-preferred partner vs. Planmine SMEST
Match: SMESG000009923.1 (SMESG000009923.1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.009e-10
Identity = 43/131 (32.82%), Postives = 60/131 (45.80%), Query Frame = 3
Query:  756 FHQTCFNCYRCEANLNVDSFFYAQKRLLCSRCVH-ESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 1145
            +H+ CF C  C  ++   SF     ++ C  C   +  +KC  C+ II    I   G P+H +CF CT C   L    FT    E+ +C E F + +  RC  C +PI    G    K I  GD  +H EC
Sbjct:  387 WHEDCFICADCNQSIGTKSFIPINGKISCIGCYENKHAQKCFKCSEIIRKSGITYKGDPWHKECFLCTSCQKMLSESKFTSK-EEKPYCTECFIELFCKRCKKCTQPISGFGGC---KFISVGDDHWHTEC 513          
The following BLAST results are available for this feature:
BLAST of Lipoma-preferred partner vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRIP62.148e-3746.27thyroid hormone receptor interactor 6 [Source:HGNC... [more]
LPP5.286e-3641.61LIM domain containing preferred translocation part... [more]
LPP5.853e-3641.61LIM domain containing preferred translocation part... [more]
LPP5.853e-3641.61LIM domain containing preferred translocation part... [more]
ZYX1.226e-3341.40zyxin [Source:HGNC Symbol;Acc:HGNC:13200][more]
back to top
BLAST of Lipoma-preferred partner vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zyx-12.279e-3240.82Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4][more]
zyx-12.539e-3240.82Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4][more]
zyx-12.539e-3240.82Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4][more]
zyx-12.846e-3240.00Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4][more]
zyx-15.206e-3240.82Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4][more]
back to top
BLAST of Lipoma-preferred partner vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zyx3.813e-3542.66gene:FBgn0011642 transcript:FBtr0309882[more]
Zyx4.429e-3542.66gene:FBgn0011642 transcript:FBtr0089214[more]
Zyx4.658e-3542.66gene:FBgn0011642 transcript:FBtr0089211[more]
Zyx4.658e-3542.66gene:FBgn0011642 transcript:FBtr0345298[more]
Zyx4.759e-3542.66gene:FBgn0011642 transcript:FBtr0089210[more]
back to top
BLAST of Lipoma-preferred partner vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trip63.742e-4045.52thyroid hormone receptor interactor 6 [Source:ZFIN... [more]
trip63.742e-4045.52thyroid hormone receptor interactor 6 [Source:ZFIN... [more]
trip63.742e-4045.52thyroid hormone receptor interactor 6 [Source:ZFIN... [more]
trip63.823e-4045.52thyroid hormone receptor interactor 6 [Source:ZFIN... [more]
CR352261.13.899e-4045.52thyroid hormone receptor interactor 6 [Source:NCBI... [more]
back to top
BLAST of Lipoma-preferred partner vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nudt171.844e-4034.98nudix hydrolase 17 [Source:Xenbase;Acc:XB-GENE-979... [more]
nudt176.736e-3942.86nudix hydrolase 17 [Source:Xenbase;Acc:XB-GENE-979... [more]
nudt177.428e-3942.86nudix hydrolase 17 [Source:Xenbase;Acc:XB-GENE-979... [more]
gnpda16.754e-3237.04glucosamine-6-phosphate deaminase 1 [Source:Xenbas... [more]
arf44.467e-3135.48ADP ribosylation factor 4 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Lipoma-preferred partner vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trip61.677e-3744.90thyroid hormone receptor interactor 6 [Source:MGI ... [more]
Lpp7.950e-3741.61LIM domain containing preferred translocation part... [more]
Lpp1.056e-3641.61LIM domain containing preferred translocation part... [more]
Lpp1.056e-3641.61LIM domain containing preferred translocation part... [more]
Zyx2.459e-3541.40zyxin [Source:MGI Symbol;Acc:MGI:103072][more]
back to top
BLAST of Lipoma-preferred partner vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3SX26|TRIP6_BOVIN9.943e-3744.90Thyroid receptor-interacting protein 6 OS=Bos taur... [more]
sp|Q15654|TRIP6_HUMAN1.032e-3646.27Thyroid receptor-interacting protein 6 OS=Homo sap... [more]
sp|Q9Z1Y4|TRIP6_MOUSE1.173e-3644.90Thyroid receptor-interacting protein 6 OS=Mus musc... [more]
sp|Q5F464|LPP_CHICK1.583e-3641.61Lipoma-preferred partner homolog OS=Gallus gallus ... [more]
sp|Q04584|ZYX_CHICK3.466e-3639.49Zyxin OS=Gallus gallus OX=9031 GN=ZYX PE=1 SV=1[more]
back to top
BLAST of Lipoma-preferred partner vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183QV671.932e-5234.81Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
A0A564XWH01.872e-5033.88Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A3S5BA202.719e-4946.29Uncharacterized protein (Fragment) OS=Protopolysto... [more]
A0A183A8B32.901e-4842.31Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A3P7SR768.706e-4847.37Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
back to top
BLAST of Lipoma-preferred partner vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lpp9.699e-3932.93lipoma-preferred partner homolog [Source:NCBI gene... [more]
ENSAMXT00000040849.11.636e-3844.78thyroid receptor-interacting protein 6-like [Sourc... [more]
ENSAMXT00000036341.11.871e-3844.78thyroid receptor-interacting protein 6-like [Sourc... [more]
ENSAMXT00000037949.11.871e-3844.78thyroid receptor-interacting protein 6-like [Sourc... [more]
lpp2.080e-3743.54lipoma-preferred partner homolog [Source:NCBI gene... [more]
back to top
BLAST of Lipoma-preferred partner vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010404.11.906e-2146.15pep scaffold:Pmarinus_7.0:GL477924:140:5584:1 gene... [more]
ENSPMAT00000010401.12.524e-2048.10pep scaffold:Pmarinus_7.0:GL477924:137:5584:1 gene... [more]
lims25.267e-1029.87LIM and senescent cell antigen-like domains 2 [Sou... [more]
ablim1a1.184e-930.30actin binding LIM protein 1a [Source:ZFIN;Acc:ZDB-... [more]
ENSPMAT00000007081.13.268e-931.19pep scaffold:Pmarinus_7.0:GL476780:360940:430661:-... [more]
back to top
BLAST of Lipoma-preferred partner vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipoma-preferred partner vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO395811.347e-2737.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325413.929e-2736.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411811.065e-1434.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
LIMPET5.329e-1232.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497983.234e-1030.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lipoma-preferred partner vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000008337.25.755e-4344.10thyroid hormone receptor interactor 6 [Source:NCBI... [more]
lpp3.437e-3742.86lipoma-preferred partner homolog [Source:NCBI gene... [more]
LIMD13.070e-3237.41LIM domains containing 1 [Source:NCBI gene;Acc:101... [more]
wtip4.392e-3035.19WT1 interacting protein [Source:NCBI gene;Acc:1011... [more]
wtip8.953e-3034.84WT1 interacting protein [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Lipoma-preferred partner vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031084.10.000e+099.72SMESG000031084.1[more]
SMESG000038145.15.841e-2836.43SMESG000038145.1[more]
SMESG000031934.12.849e-2330.30SMESG000031934.1[more]
SMESG000072127.18.637e-1232.82SMESG000072127.1[more]
SMESG000009923.11.009e-1032.82SMESG000009923.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019594 ID=SMED30019594|Name=Lipoma-preferred partner|organism=Schmidtea mediterranea sexual|type=transcript|length=1398bp
ATTTTTTTACCTAAGGCAATTCATATTGATTTTTAGAAACAGCAGTTTTT
TTGGAGTTGTAATCTATATAATACGATCATTTGATGCATTATAATCATCC
ATTTCGTCGAGTATTTGATTTAGATAGCGCATTCAACGAACGAGCAAGTC
CAAGAGCAAAATTATTCTCAGATTTATATGGATTACTTGACATGAATCAA
TCAACATTTCCTCACAGTCGTCTGTATAACTTTACTTTGGATGCTAGAGA
CAGAGAGCCGTATCCTATAGATAACCGATTATCCAAAACCAATTATCCAA
AATACACTGATGAAATGACAACAGCAACATTGATTCCAGTTGTCCATTTG
CCATCAAATAACAACTCAGATTATTCTACATCAACTAGAAAATCCACTTC
TTTCAATGATCCACCCAAAAGCAATTTATCCCAAGTTAGAAAAAATTCGG
AGGCTGAAGTAGACGCTCTAACAAATATCTTAATCAAAAGTATTGCAAAT
AAAACAGAAAACAAAGATTCAAATCCTCGAAGCTATACATCTTCTACTTA
TTTACCAAACCAGCCATATAGTAGCAAAAGAGTATCCAATACATCTAGTC
AGCCGGCAGTTTCAACTTCATCAAATTCAACAACAGGCTCTATAAGTCGC
CAGTCATCATTATCATCAAATGAATGCCATCGCTGTCGTAAACCGTTTGA
GTTGGCAAATGGCAAATCATCAGTTGGACAAATCAACGGACCATTGAATA
CAGTTTTCCACCAAACCTGTTTCAATTGTTACCGATGTGAAGCTAATTTA
AACGTAGATTCGTTTTTCTATGCCCAAAAACGGCTACTATGTTCAAGATG
TGTACATGAATCATTAGAAAAGTGTACTGTGTGTAATTTTATAATAAATG
ACAGGATAATAAGAGTTCTTGGCCATCCGTACCATCCAAAATGTTTTACT
TGCACCGTTTGCAACTGTTGCTTAGATGGGAAAGCGTTCACAGTGGATGT
CCATGAACGGATGTTTTGTCTGGAAGATTTTCATAAAAGATATGCACCGA
GATGTGATGCCTGTGGAGAACCAATTCGACCACAAAATGGTGGCCAAGAA
AATAAAAGAATAATTTCTGGTGATAAAACGTTCCATTTAGAATGTTCAGG
AATTACAATTAAAAACTGAATTTTACTAAAAAGAAATCGTGTAACTCATT
TGAACAAAACTTGAAAGTTCCGGTAAAATATCTCCGACTTTATTTGTAGT
TAATATTTATTTTATTGTGATTATTAAATTGTTACCATAATTTCCACATG
ACATCTTTTTTTCTATAATTTCTTATTTAAAAATTTTGACATGGGAATTT
ATTCTAGTCATAATTGATATTGTAGATTTAATCAAGGGTTTTTGACCT
back to top

protein sequence of SMED30019594-orf-1

>SMED30019594-orf-1 ID=SMED30019594-orf-1|Name=SMED30019594-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=362bp
MHYNHPFRRVFDLDSAFNERASPRAKLFSDLYGLLDMNQSTFPHSRLYNF
TLDARDREPYPIDNRLSKTNYPKYTDEMTTATLIPVVHLPSNNNSDYSTS
TRKSTSFNDPPKSNLSQVRKNSEAEVDALTNILIKSIANKTENKDSNPRS
YTSSTYLPNQPYSSKRVSNTSSQPAVSTSSNSTTGSISRQSSLSSNECHR
CRKPFELANGKSSVGQINGPLNTVFHQTCFNCYRCEANLNVDSFFYAQKR
LLCSRCVHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGK
AFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTF
HLECSGITIKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR001781Znf_LIM
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001781Zinc finger, LIM-typeSMARTSM00132lim_4coord: 197..256
e-value: 2.3E-4
score: 30.5
coord: 263..315
e-value: 1.3E-11
score: 54.6
IPR001781Zinc finger, LIM-typePFAMPF00412LIMcoord: 264..319
e-value: 2.0E-8
score: 34.4
coord: 198..259
e-value: 5.4E-8
score: 32.9
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 264..297
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 196..261
score: 8.465
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 262..322
score: 12.444
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 260..317
e-value: 4.4E-14
score: 54.2
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 318..356
e-value: 4.6E-5
score: 25.2
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 182..259
e-value: 8.0E-11
score: 43.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 95..122
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 140..195
NoneNo IPR availablePANTHERPTHR24207:SF2ZYX102 PROTEINcoord: 88..354
NoneNo IPR availablePANTHERPTHR24207FAMILY NOT NAMEDcoord: 88..354
NoneNo IPR availableCDDcd08368LIMcoord: 198..256
e-value: 2.53468E-5
score: 39.2231
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 232..294
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 290..355