Ventral anterior homeobox 1

Overview
NameVentral anterior homeobox 1
Smed IDSMED30019584
Length (bp)564
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ventral anterior homeobox 1 (SMED30019584) t-SNE clustered cells

Violin plots show distribution of expression levels for Ventral anterior homeobox 1 (SMED30019584) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019584

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30019584h1SMcG0006855 dd_Smed_v4_49879_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ventral anterior homeobox 1 vs. Ensembl Human
Match: EMX1 (empty spiracles homeobox 1 [Source:HGNC Symbol;Acc:HGNC:3340])

HSP 1 Score: 77.411 bits (189), Expect = 9.294e-17
Identity = 35/66 (53.03%), Postives = 47/66 (71.21%), Query Frame = 3
Query:  258 FQTNFQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
                F ++ KRIR +F+ SQL  LE+ F    Y++G ERK+LA SL+LSE Q+K+WFQNRRTK K+
Sbjct:  184 LHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSLSLSETQVKVWFQNRRTKYKR 249          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Human
Match: VAX2 (ventral anterior homeobox 2 [Source:HGNC Symbol;Acc:HGNC:12661])

HSP 1 Score: 77.411 bits (189), Expect = 1.139e-16
Identity = 35/59 (59.32%), Postives = 41/59 (69.49%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            R KR R SF   QL  LE  F  C Y++G ER  LA+ LNLSE Q+K+WFQNRRTK+KK
Sbjct:  101 RPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKK 159          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Human
Match: VAX1 (ventral anterior homeobox 1 [Source:HGNC Symbol;Acc:HGNC:12660])

HSP 1 Score: 77.0258 bits (188), Expect = 2.173e-16
Identity = 35/59 (59.32%), Postives = 41/59 (69.49%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            R KR R SF   QL  LE  F  C Y++G ER  LA+ LNLSE Q+K+WFQNRRTK+KK
Sbjct:   99 RPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKK 157          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Human
Match: EMX2 (empty spiracles homeobox 2 [Source:HGNC Symbol;Acc:HGNC:3341])

HSP 1 Score: 72.4034 bits (176), Expect = 4.377e-15
Identity = 39/90 (43.33%), Postives = 51/90 (56.67%), Query Frame = 3
Query:  222 WCYHFMRGYHSEFQTN------------FQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            W  H  R     FQ N              ++ KRIR +F+ SQL  LE  F    Y++G ERK+LA SL+L+E Q+K+WFQNRRTK K+
Sbjct:  122 WLIHRYRYLGHRFQGNDTSPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKR 211          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Human
Match: NKX6-2 (NK6 homeobox 2 [Source:HGNC Symbol;Acc:HGNC:19321])

HSP 1 Score: 69.3218 bits (168), Expect = 8.703e-14
Identity = 32/63 (50.79%), Postives = 44/63 (69.84%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKLNAV 467
            +KK  R +F+  Q+  LEK F    Y+ G ER RLA SL ++E+Q+K+WFQNRRTK +K +AV
Sbjct:  147 KKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAV 209          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Celegans
Match: ceh-5 (Homeobox protein ceh-5 [Source:UniProtKB/Swiss-Prot;Acc:P20269])

HSP 1 Score: 73.1738 bits (178), Expect = 1.027e-16
Identity = 33/63 (52.38%), Postives = 46/63 (73.02%), Query Frame = 3
Query:  276 KRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKLNA 464
            +R KR R  F   QL+ LE+ F T  Y+ G  R +LA+SL LS+NQ+K+WFQNRRTK+KK+++
Sbjct:   33 ERPKRPRTVFTDEQLEKLEESFNTSGYLSGSTRAKLAESLGLSDNQVKVWFQNRRTKQKKIDS 95          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Celegans
Match: ceh-2 (Homeobox protein ceh-2 [Source:UniProtKB/Swiss-Prot;Acc:G5ECT8])

HSP 1 Score: 73.1738 bits (178), Expect = 4.446e-16
Identity = 33/61 (54.10%), Postives = 46/61 (75.41%), Query Frame = 3
Query:  276 KRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKL 458
            ++ KRIR +F+ SQL  LEK F    Y++G ERK+LA  L+L+E Q+K+WFQNRRTK K++
Sbjct:  124 RKNKRIRTAFSASQLIQLEKAFEGNHYVVGNERKQLAAKLSLTETQVKVWFQNRRTKHKRV 184          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Celegans
Match: cog-1 (COG-1B [Source:UniProtKB/TrEMBL;Acc:G5EGF2])

HSP 1 Score: 62.003 bits (149), Expect = 1.018e-12
Identity = 29/63 (46.03%), Postives = 43/63 (68.25%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKLNAV 467
            +KK+ R +F   Q+  LE+ F    Y+ G +R +LA+ LN+SE+Q+K+WFQNRRTK +K  A 
Sbjct:   18 QKKQSRPTFTGHQIYQLERKFEQTKYLAGADRAQLAQELNMSESQVKVWFQNRRTKWRKKEAA 80          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Celegans
Match: ceh-43 (Homeobox protein ceh-43 [Source:UniProtKB/Swiss-Prot;Acc:Q18273])

HSP 1 Score: 63.5438 bits (153), Expect = 3.154e-12
Identity = 29/60 (48.33%), Postives = 41/60 (68.33%), Query Frame = 3
Query:  276 KRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            K+ ++ R  +N SQLQ+L+K F    Y+   +R  LA  L LS+ Q+KIWFQNRR+K+KK
Sbjct:  100 KKMRKPRTIYNSSQLQMLQKKFQKTQYLALPDRAALAHELGLSQTQVKIWFQNRRSKQKK 159          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Celegans
Match: cog-1 (COG-1B [Source:UniProtKB/TrEMBL;Acc:G5EGF2])

HSP 1 Score: 62.3882 bits (150), Expect = 8.244e-12
Identity = 29/63 (46.03%), Postives = 43/63 (68.25%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKLNAV 467
            +KK+ R +F   Q+  LE+ F    Y+ G +R +LA+ LN+SE+Q+K+WFQNRRTK +K  A 
Sbjct:  168 QKKQSRPTFTGHQIYQLERKFEQTKYLAGADRAQLAQELNMSESQVKVWFQNRRTKWRKKEAA 230          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Fly
Match: ems (gene:FBgn0000576 transcript:FBtr0082863)

HSP 1 Score: 81.2629 bits (199), Expect = 6.243e-18
Identity = 34/61 (55.74%), Postives = 47/61 (77.05%), Query Frame = 3
Query:  276 KRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKL 458
            ++ KRIR +F+ SQL  LE  F +  Y++G ERK LA++LNLSE Q+K+WFQNRRTK K++
Sbjct:  386 RKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRM 446          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Fly
Match: E5 (gene:FBgn0008646 transcript:FBtr0082880)

HSP 1 Score: 74.3294 bits (181), Expect = 1.660e-15
Identity = 30/61 (49.18%), Postives = 46/61 (75.41%), Query Frame = 3
Query:  276 KRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKL 458
            ++ KR+R +F+ +QL  LE  F    Y++G ERK+LA+ L+L+E Q+K+WFQNRRTK K++
Sbjct:  301 RKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRM 361          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Fly
Match: HGTX (gene:FBgn0040318 transcript:FBtr0075720)

HSP 1 Score: 67.781 bits (164), Expect = 2.676e-13
Identity = 30/63 (47.62%), Postives = 43/63 (68.25%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKLNAV 467
            +KK  R +F+  Q+  LEK F    Y+ G ER +LA +L +SE+Q+K+WFQNRRTK +K +A 
Sbjct:  391 KKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAA 453          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Fly
Match: bap (gene:FBgn0004862 transcript:FBtr0084087)

HSP 1 Score: 63.929 bits (154), Expect = 4.593e-12
Identity = 31/59 (52.54%), Postives = 41/59 (69.49%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            RKKR R +F+ +Q+  LE+ F    Y+ G ER  +AKSL L+E Q+KIWFQNRR K K+
Sbjct:  174 RKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKR 232          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Fly
Match: B-H1 (gene:FBgn0011758 transcript:FBtr0074430)

HSP 1 Score: 63.929 bits (154), Expect = 6.221e-12
Identity = 30/68 (44.12%), Postives = 44/68 (64.71%), Query Frame = 3
Query:  264 TNFQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKLNAV 467
            +   K++++ R +F   QLQ LEK F    Y+  +ER+ LA  L+LS+ Q+K W+QNRRTK K+  AV
Sbjct:  293 SGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWKRQTAV 360          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Zebrafish
Match: vax1 (ventral anterior homeobox 1 [Source:NCBI gene;Acc:373870])

HSP 1 Score: 77.0258 bits (188), Expect = 1.241e-16
Identity = 35/59 (59.32%), Postives = 41/59 (69.49%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            R KR R SF   QL  LE  F  C Y++G ER  LA+ LNLSE Q+K+WFQNRRTK+KK
Sbjct:   91 RPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKK 149          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Zebrafish
Match: vax1 (ventral anterior homeobox 1 [Source:NCBI gene;Acc:373870])

HSP 1 Score: 77.0258 bits (188), Expect = 1.241e-16
Identity = 35/59 (59.32%), Postives = 41/59 (69.49%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            R KR R SF   QL  LE  F  C Y++G ER  LA+ LNLSE Q+K+WFQNRRTK+KK
Sbjct:   91 RPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKK 149          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Zebrafish
Match: emx1 (empty spiracles homeobox 1 [Source:NCBI gene;Acc:378964])

HSP 1 Score: 75.485 bits (184), Expect = 1.273e-16
Identity = 35/62 (56.45%), Postives = 47/62 (75.81%), Query Frame = 3
Query:  270 FQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            F ++ KRIR +F+ SQL  LE+ F    Y++G ERK+LA SL+LSE Q+K+WFQNRRTK K+
Sbjct:  129 FARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLANSLSLSETQVKVWFQNRRTKYKR 190          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Zebrafish
Match: vax2 (ventral anterior homeobox 2 [Source:NCBI gene;Acc:373869])

HSP 1 Score: 76.6406 bits (187), Expect = 1.502e-16
Identity = 35/59 (59.32%), Postives = 41/59 (69.49%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            R KR R SF   QL  LE  F  C Y++G ER  LA+ LNLSE Q+K+WFQNRRTK+KK
Sbjct:  102 RPKRTRTSFTAEQLYRLELEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKK 160          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Zebrafish
Match: emx3 (empty spiracles homeobox 3 [Source:ZFIN;Acc:ZDB-GENE-990415-53])

HSP 1 Score: 73.1738 bits (178), Expect = 1.100e-15
Identity = 33/62 (53.23%), Postives = 45/62 (72.58%), Query Frame = 3
Query:  270 FQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            F ++ KRIR +F+ SQL  LE+ F    Y++G ERK+LA  L L+E Q+K+WFQNRRTK K+
Sbjct:  131 FSRKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLANGLCLTETQVKVWFQNRRTKHKR 192          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Xenopus
Match: VAX1 (ventral anterior homeobox 1 [Source:NCBI gene;Acc:100486982])

HSP 1 Score: 76.2554 bits (186), Expect = 1.925e-17
Identity = 35/59 (59.32%), Postives = 41/59 (69.49%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            R KR R SF   QL  LE  F  C Y++G ER  LA+ LNLSE Q+K+WFQNRRTK+KK
Sbjct:   37 RPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKK 95          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Xenopus
Match: vps51 (VPS51 GARP complex subunit [Source:Xenbase;Acc:XB-GENE-1005391])

HSP 1 Score: 74.7146 bits (182), Expect = 4.390e-17
Identity = 35/62 (56.45%), Postives = 47/62 (75.81%), Query Frame = 3
Query:  270 FQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            F ++ KRIR +F+ SQL  LE+ F    Y++G ERK+LA SL+LSE Q+K+WFQNRRTK K+
Sbjct:   15 FARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLASSLSLSETQVKVWFQNRRTKYKR 76          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Xenopus
Match: VAX2 (ventral anterior homeobox 2 [Source:NCBI gene;Acc:100485836])

HSP 1 Score: 77.0258 bits (188), Expect = 1.570e-16
Identity = 35/59 (59.32%), Postives = 41/59 (69.49%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            R KR R SF   QL  LE  F  C Y++G ER  LA+ LNLSE Q+K+WFQNRRTK+KK
Sbjct:  101 RPKRTRTSFTAEQLYRLELEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKK 159          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Xenopus
Match: sorl1 (sortilin-related receptor, L(DLR class) A repeats containing [Source:Xenbase;Acc:XB-GENE-995776])

HSP 1 Score: 74.3294 bits (181), Expect = 4.829e-16
Identity = 34/66 (51.52%), Postives = 45/66 (68.18%), Query Frame = 3
Query:  258 FQTNFQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
                F ++ KRIR +F+ SQL  LE  F    Y++G ERK+LA SL L+E Q+K+WFQNRRTK K+
Sbjct:  107 LHGPFSRKPKRIRTAFSPSQLLRLEGAFEKNHYVVGAERKQLANSLCLTETQVKVWFQNRRTKHKR 172          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Xenopus
Match: wdr70 (WD repeat domain 70 [Source:Xenbase;Acc:XB-GENE-956087])

HSP 1 Score: 72.4034 bits (176), Expect = 3.322e-15
Identity = 39/90 (43.33%), Postives = 51/90 (56.67%), Query Frame = 3
Query:  222 WCYHFMRGYHSEFQTN------------FQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            W  H  R     FQ N              ++ KRIR +F+ SQL  LE  F    Y++G ERK+LA SL+L+E Q+K+WFQNRRTK K+
Sbjct:  117 WLIHRYRYLGHRFQGNDTSAESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKR 206          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Mouse
Match: Emx1 (empty spiracles homeobox 1 [Source:MGI Symbol;Acc:MGI:95387])

HSP 1 Score: 77.0258 bits (188), Expect = 5.865e-17
Identity = 35/62 (56.45%), Postives = 47/62 (75.81%), Query Frame = 3
Query:  270 FQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            F ++ KRIR +F+ SQL  LE+ F    Y++G ERK+LA SL+LSE Q+K+WFQNRRTK K+
Sbjct:  155 FARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSLSLSETQVKVWFQNRRTKYKR 216          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Mouse
Match: Vax2 (ventral anterior homeobox 2 [Source:MGI Symbol;Acc:MGI:1346018])

HSP 1 Score: 77.411 bits (189), Expect = 7.367e-17
Identity = 35/59 (59.32%), Postives = 41/59 (69.49%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            R KR R SF   QL  LE  F  C Y++G ER  LA+ LNLSE Q+K+WFQNRRTK+KK
Sbjct:  101 RPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKK 159          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Mouse
Match: Vax1 (ventral anterior homeobox 1 [Source:MGI Symbol;Acc:MGI:1277163])

HSP 1 Score: 77.0258 bits (188), Expect = 1.614e-16
Identity = 35/59 (59.32%), Postives = 41/59 (69.49%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            R KR R SF   QL  LE  F  C Y++G ER  LA+ LNLSE Q+K+WFQNRRTK+KK
Sbjct:   99 RPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKK 157          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Mouse
Match: Emx2 (empty spiracles homeobox 2 [Source:MGI Symbol;Acc:MGI:95388])

HSP 1 Score: 72.4034 bits (176), Expect = 3.044e-15
Identity = 39/90 (43.33%), Postives = 51/90 (56.67%), Query Frame = 3
Query:  222 WCYHFMRGYHSEFQTN------------FQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            W  H  R     FQ N              ++ KRIR +F+ SQL  LE  F    Y++G ERK+LA SL+L+E Q+K+WFQNRRTK K+
Sbjct:  123 WLIHRYRYLGHRFQGNDTSPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKR 212          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Mouse
Match: Nkx6-3 (NK6 homeobox 3 [Source:MGI Symbol;Acc:MGI:1921811])

HSP 1 Score: 67.3958 bits (163), Expect = 1.903e-13
Identity = 31/63 (49.21%), Postives = 43/63 (68.25%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKLNAV 467
            +KK  R +F   Q+  LEK F    Y+ G ER RLA SL ++E+Q+K+WFQNRRTK +K +A+
Sbjct:  139 KKKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKSAL 201          
BLAST of Ventral anterior homeobox 1 vs. UniProt/SwissProt
Match: sp|P18488|EMS_DROME (Homeotic protein empty spiracles OS=Drosophila melanogaster OX=7227 GN=ems PE=2 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 7.843e-17
Identity = 34/61 (55.74%), Postives = 47/61 (77.05%), Query Frame = 3
Query:  276 KRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKL 458
            ++ KRIR +F+ SQL  LE  F +  Y++G ERK LA++LNLSE Q+K+WFQNRRTK K++
Sbjct:  389 RKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRM 449          
BLAST of Ventral anterior homeobox 1 vs. UniProt/SwissProt
Match: sp|Q04741|EMX1_HUMAN (Homeobox protein EMX1 OS=Homo sapiens OX=9606 GN=EMX1 PE=1 SV=2)

HSP 1 Score: 77.411 bits (189), Expect = 3.273e-16
Identity = 35/62 (56.45%), Postives = 47/62 (75.81%), Query Frame = 3
Query:  270 FQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            F ++ KRIR +F+ SQL  LE+ F    Y++G ERK+LA SL+LSE Q+K+WFQNRRTK K+
Sbjct:  155 FARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSLSLSETQVKVWFQNRRTKYKR 216          
BLAST of Ventral anterior homeobox 1 vs. UniProt/SwissProt
Match: sp|Q6GLB9|EMX1_XENTR (Homeobox protein EMX1 OS=Xenopus tropicalis OX=8364 GN=emx1 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 3.870e-16
Identity = 35/62 (56.45%), Postives = 47/62 (75.81%), Query Frame = 3
Query:  270 FQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            F ++ KRIR +F+ SQL  LE+ F    Y++G ERK+LA SL+LSE Q+K+WFQNRRTK K+
Sbjct:  131 FARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLASSLSLSETQVKVWFQNRRTKYKR 192          
BLAST of Ventral anterior homeobox 1 vs. UniProt/SwissProt
Match: sp|Q04742|EMX1_MOUSE (Homeobox protein EMX1 OS=Mus musculus OX=10090 GN=Emx1 PE=1 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 4.102e-16
Identity = 35/62 (56.45%), Postives = 47/62 (75.81%), Query Frame = 3
Query:  270 FQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            F ++ KRIR +F+ SQL  LE+ F    Y++G ERK+LA SL+LSE Q+K+WFQNRRTK K+
Sbjct:  155 FARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSLSLSETQVKVWFQNRRTKYKR 216          
BLAST of Ventral anterior homeobox 1 vs. UniProt/SwissProt
Match: sp|Q9WTP9|VAX2_MOUSE (Ventral anterior homeobox 2 OS=Mus musculus OX=10090 GN=Vax2 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 5.153e-16
Identity = 35/59 (59.32%), Postives = 41/59 (69.49%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            R KR R SF   QL  LE  F  C Y++G ER  LA+ LNLSE Q+K+WFQNRRTK+KK
Sbjct:  101 RPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKK 159          
BLAST of Ventral anterior homeobox 1 vs. TrEMBL
Match: A0A0R3U5Z8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS2168 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.463e-15
Identity = 47/132 (35.61%), Postives = 75/132 (56.82%), Query Frame = 3
Query:   72 NFINFIKQNNQKKLNNSEIISDFIVY---RKPTNPNYSKLRYQTKSAEYFHKMWCYHFMRGYHSEFQTNFQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKL 458
            N +N I    + + + +E+      Y   R+PT  + S   +    + Y ++ + Y  + G  +       ++ KRIR +F+ SQL  LE  F    Y++G+ERKRLA+SL+L+E Q+K+WFQNRRTK K+L
Sbjct:   55 NALNMIGPIMKGRESCAELHDGCFGYPMERRPTLDDTSHCFFPPLHSTYLNEAYPYGTLFGDPTSHGIRAYRKPKRIRTAFSPSQLLRLESAFELNHYVVGQERKRLAESLSLTETQVKVWFQNRRTKFKRL 186          
BLAST of Ventral anterior homeobox 1 vs. TrEMBL
Match: A0A5K3FG70 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.529e-15
Identity = 47/132 (35.61%), Postives = 75/132 (56.82%), Query Frame = 3
Query:   72 NFINFIKQNNQKKLNNSEIISDFIVY---RKPTNPNYSKLRYQTKSAEYFHKMWCYHFMRGYHSEFQTNFQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKL 458
            N +N I    + + + +E+      Y   R+PT  + S   +    + Y ++ + Y  + G  +       ++ KRIR +F+ SQL  LE  F    Y++G+ERKRLA+SL+L+E Q+K+WFQNRRTK K+L
Sbjct:   64 NALNMIGPIMKGRESCAELHDGCFGYPMERRPTLDDTSHCFFPPLHSTYLNEAYPYGTLFGDPTSHGIRAYRKPKRIRTAFSPSQLLRLESAFELNHYVVGQERKRLAESLSLTETQVKVWFQNRRTKFKRL 195          
BLAST of Ventral anterior homeobox 1 vs. TrEMBL
Match: A0A0A1XBX0 (Homeotic protein empty spiracles OS=Zeugodacus cucurbitae OX=28588 GN=ems_0 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 2.050e-15
Identity = 35/61 (57.38%), Postives = 47/61 (77.05%), Query Frame = 3
Query:  276 KRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKL 458
            ++ KRIR +F+ SQL  LE  F +  Y++G ERK LA+SLNLSE Q+K+WFQNRRTK K++
Sbjct:  414 RKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQSLNLSETQVKVWFQNRRTKHKRM 474          
BLAST of Ventral anterior homeobox 1 vs. TrEMBL
Match: B4JV49 (GH14408 OS=Drosophila grimshawi OX=7222 GN=Dgri\GH14408 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 2.459e-15
Identity = 35/61 (57.38%), Postives = 47/61 (77.05%), Query Frame = 3
Query:  276 KRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKL 458
            ++ KRIR +F+ SQL  LE  F +  Y++G ERK LA+SLNLSE Q+K+WFQNRRTK K++
Sbjct:  398 RKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQSLNLSETQVKVWFQNRRTKHKRM 458          
BLAST of Ventral anterior homeobox 1 vs. TrEMBL
Match: A0A0R3TR70 (Homeobox domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS10061 PE=4 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.597e-15
Identity = 36/66 (54.55%), Postives = 50/66 (75.76%), Query Frame = 3
Query:  276 KRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKLNAVFD 473
            ++ KRIR +F+ +QL  LE  F    Y++G+ERKRLA+SL+L+E Q+K+WFQNRRTK K+LN   D
Sbjct:  120 RKAKRIRTAFSPTQLLRLESAFEVNHYVVGQERKRLAESLDLTETQVKVWFQNRRTKHKRLNTERD 185          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Cavefish
Match: emx1 (homeobox protein EMX1 [Source:NCBI gene;Acc:103045183])

HSP 1 Score: 76.2554 bits (186), Expect = 7.061e-17
Identity = 35/62 (56.45%), Postives = 47/62 (75.81%), Query Frame = 3
Query:  270 FQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            F ++ KRIR +F+ SQL  LE+ F    Y++G ERK+LA SL+LSE Q+K+WFQNRRTK K+
Sbjct:  129 FARKPKRIRTAFSPSQLLRLERAFDKNHYVVGAERKQLANSLSLSETQVKVWFQNRRTKYKR 190          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Cavefish
Match: vax1 (ventral anterior homeobox 1 [Source:NCBI gene;Acc:103039179])

HSP 1 Score: 77.411 bits (189), Expect = 7.243e-17
Identity = 35/59 (59.32%), Postives = 41/59 (69.49%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            R KR R SF   QL  LE  F  C Y++G ER  LA+ LNLSE Q+K+WFQNRRTK+KK
Sbjct:   93 RPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKK 151          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Cavefish
Match: vax2 (ventral anterior homeobox 2 [Source:NCBI gene;Acc:103039860])

HSP 1 Score: 76.6406 bits (187), Expect = 1.104e-16
Identity = 35/59 (59.32%), Postives = 41/59 (69.49%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            R KR R SF   QL  LE  F  C Y++G ER  LA+ LNLSE Q+K+WFQNRRTK+KK
Sbjct:   95 RPKRTRTSFTAEQLYRLELEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKK 153          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Cavefish
Match: vax2 (ventral anterior homeobox 2 [Source:NCBI gene;Acc:103039860])

HSP 1 Score: 76.2554 bits (186), Expect = 1.597e-16
Identity = 35/59 (59.32%), Postives = 41/59 (69.49%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            R KR R SF   QL  LE  F  C Y++G ER  LA+ LNLSE Q+K+WFQNRRTK+KK
Sbjct:  102 RPKRTRTSFTAEQLYRLELEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKK 160          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Cavefish
Match: emx3 (homeobox protein EMX1-like [Source:NCBI gene;Acc:103029694])

HSP 1 Score: 73.1738 bits (178), Expect = 9.987e-16
Identity = 33/62 (53.23%), Postives = 45/62 (72.58%), Query Frame = 3
Query:  270 FQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            F ++ KRIR +F+ SQL  LE+ F    Y++G ERK+LA  L L+E Q+K+WFQNRRTK K+
Sbjct:  126 FSRKPKRIRTAFSPSQLLRLERAFEKNHYVVGTERKQLANGLCLTETQVKVWFQNRRTKHKR 187          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Sea Lamprey
Match: emx2 (empty spiracles homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-990415-54])

HSP 1 Score: 78.9518 bits (193), Expect = 2.484e-18
Identity = 35/66 (53.03%), Postives = 47/66 (71.21%), Query Frame = 3
Query:  258 FQTNFQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            F   F ++ KRIR +F+ SQL  LE  F    Y++G ERK+LA SL+L+E Q+K+WFQNRRTK K+
Sbjct:  179 FPGPFARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGSERKQLASSLSLTETQVKVWFQNRRTKHKR 244          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Sea Lamprey
Match: barhl2 (BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050913-153])

HSP 1 Score: 57.3806 bits (137), Expect = 1.859e-11
Identity = 28/64 (43.75%), Postives = 42/64 (65.62%), Query Frame = 3
Query:  276 KRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKLNAV 467
            K+ ++ R +F+  QL  LE+ F    Y+  ++R  LA SL+LS+ Q+K W+QNRRTK K+  AV
Sbjct:    3 KKPRKARTAFSDHQLTQLERSFERQKYLSVQDRMELASSLSLSDTQVKTWYQNRRTKWKRQTAV 66          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Sea Lamprey
Match: barhl2 (BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050913-153])

HSP 1 Score: 57.3806 bits (137), Expect = 2.528e-11
Identity = 28/64 (43.75%), Postives = 42/64 (65.62%), Query Frame = 3
Query:  276 KRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKLNAV 467
            K+ ++ R +F+  QL  LE+ F    Y+  ++R  LA SL+LS+ Q+K W+QNRRTK K+  AV
Sbjct:    3 KKPRKARTAFSDHQLTQLERSFERQKYLSVQDRMELASSLSLSDTQVKTWYQNRRTKWKRQTAV 66          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011473.1 (pep scaffold:Pmarinus_7.0:GL476736:88393:88668:-1 gene:ENSPMAG00000010446.1 transcript:ENSPMAT00000011473.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 3.220e-11
Identity = 29/61 (47.54%), Postives = 36/61 (59.02%), Query Frame = 3
Query:  285 KRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKLNAV 467
            KR R +F   QL  L+  F    Y+    R+ LA+ L LSE Q+KIWFQN+R K KK N V
Sbjct:   19 KRPRTAFTPEQLSRLKAEFQASRYLSEARRQALARDLQLSEAQVKIWFQNKRAKLKKANGV 79          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Sea Lamprey
Match: tlx1 (T cell leukemia homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-021021-2])

HSP 1 Score: 59.3066 bits (142), Expect = 3.239e-11
Identity = 27/64 (42.19%), Postives = 40/64 (62.50%), Query Frame = 3
Query:  255 EFQTNFQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTK 446
             +Q     ++K+ R SF + Q+  LEK F+   Y+   ER  LAK+L +++ Q+K WFQNRRTK
Sbjct:  221 PYQNRTPPKRKKPRTSFTRLQICELEKRFHRQKYLASAERAALAKALKMTDAQVKTWFQNRRTK 284          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Yeast
Match: YOX1 (Homeobox transcriptional repressor; binds to Mcm1p and to early cell cycle boxes (ECBs) in the promoters of cell cycle-regulated genes expressed in M/G1 phase; expression is cell cycle-regulated; phosphorylated by Cdc28p; relocalizes from nucleus to cytoplasm upon DNA replication stress; YOX1 has a paralog, YHP1, that arose from the whole genome duplication [Source:SGD;Acc:S000004489])

HSP 1 Score: 43.5134 bits (101), Expect = 7.560e-6
Identity = 22/54 (40.74%), Postives = 33/54 (61.11%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRR 440
            R+KR R S    +L IL+  F  C     E+R  LA+S +++E  ++IWFQN+R
Sbjct:  177 RRKRRRTSSQ--ELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNKR 228          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Nematostella
Match: EDO37142 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGR9])

HSP 1 Score: 72.7886 bits (177), Expect = 1.620e-17
Identity = 33/65 (50.77%), Postives = 49/65 (75.38%), Query Frame = 3
Query:  252 SEFQTNFQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTK 446
            S+   ++ +++KR R +F+  QL+ LEK F    YI+GEER+++AK L+LSE Q+K+WFQNRRTK
Sbjct:    5 SDDSGSYVQKRKRARTAFSAEQLKKLEKRFQANHYIVGEERQKIAKDLDLSEAQVKVWFQNRRTK 69          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Nematostella
Match: EDO48710 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIH8])

HSP 1 Score: 68.9366 bits (167), Expect = 3.368e-16
Identity = 36/60 (60.00%), Postives = 42/60 (70.00%), Query Frame = 3
Query:  285 KRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKLNA 464
            KRIR +F  +QL  LE  F    YI+G ERK+LA  LNLSE QIK+WFQNRRTK K+  A
Sbjct:    2 KRIRTAFTPTQLLHLENAFEKNHYIVGTERKQLASYLNLSETQIKVWFQNRRTKWKRQQA 61          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Nematostella
Match: EDO49251 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGX8])

HSP 1 Score: 64.6994 bits (156), Expect = 1.800e-14
Identity = 29/57 (50.88%), Postives = 39/57 (68.42%), Query Frame = 3
Query:  285 KRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            +R R  F+  QLQ+LE+ F    YI+G +RK LA  L LSE Q+++WFQNRR K +K
Sbjct:    1 RRGRTVFSAQQLQVLERVFAGSQYIVGSQRKFLASQLRLSETQVRVWFQNRRIKWRK 57          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Nematostella
Match: EDO30887 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZI0])

HSP 1 Score: 65.0846 bits (157), Expect = 2.719e-14
Identity = 30/63 (47.62%), Postives = 43/63 (68.25%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKLNAV 467
            ++K  R +F+  Q+  LEK F    Y+ G ER RLA SL ++E+Q+K+WFQNRRTK +K +A 
Sbjct:    5 KRKHTRPTFSGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAA 67          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Nematostella
Match: EDO49301 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH67])

HSP 1 Score: 63.5438 bits (153), Expect = 3.854e-14
Identity = 32/57 (56.14%), Postives = 39/57 (68.42%), Query Frame = 3
Query:  285 KRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            KRIR  F   QL+ LEK F    Y++G ER  LA SLNL+E Q+K+WFQNRR K +K
Sbjct:    2 KRIRTIFTPEQLERLEKEFERQQYMVGAERHYLAASLNLTETQVKVWFQNRRIKWRK 58          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Medaka
Match: vax1 (ventral anterior homeobox 1 [Source:NCBI gene;Acc:100049471])

HSP 1 Score: 78.5666 bits (192), Expect = 2.490e-17
Identity = 35/59 (59.32%), Postives = 42/59 (71.19%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            R KR R SF   QL  LE  F+ C Y++G ER  LA+ LNLSE Q+K+WFQNRRTK+KK
Sbjct:   90 RPKRTRTSFTAEQLYRLEMEFHRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKK 148          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Medaka
Match: vax1 (ventral anterior homeobox 1 [Source:NCBI gene;Acc:100049471])

HSP 1 Score: 78.5666 bits (192), Expect = 2.986e-17
Identity = 35/59 (59.32%), Postives = 42/59 (71.19%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            R KR R SF   QL  LE  F+ C Y++G ER  LA+ LNLSE Q+K+WFQNRRTK+KK
Sbjct:  101 RPKRTRTSFTAEQLYRLEMEFHRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKK 159          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Medaka
Match: emx1 (homeobox protein EMX1 [Source:NCBI gene;Acc:101168414])

HSP 1 Score: 76.6406 bits (187), Expect = 5.310e-17
Identity = 35/62 (56.45%), Postives = 47/62 (75.81%), Query Frame = 3
Query:  270 FQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            F ++ KRIR +F+ SQL  LE+ F    Y++G ERK+LA SL+LSE Q+K+WFQNRRTK K+
Sbjct:  131 FARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSLSLSETQVKVWFQNRRTKYKR 192          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Medaka
Match: vax2 (ventral anterior homeobox 2 [Source:NCBI gene;Acc:101155060])

HSP 1 Score: 77.0258 bits (188), Expect = 8.126e-17
Identity = 35/59 (59.32%), Postives = 41/59 (69.49%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            R KR R SF   QL  LE  F  C Y++G ER  LA+ LNLSE Q+K+WFQNRRTK+KK
Sbjct:   97 RPKRTRTSFTAEQLYRLELEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKK 155          
BLAST of Ventral anterior homeobox 1 vs. Ensembl Medaka
Match: emx2 (empty spiracles homeobox 2 [Source:NCBI gene;Acc:100049359])

HSP 1 Score: 75.485 bits (184), Expect = 9.286e-17
Identity = 49/171 (28.65%), Postives = 78/171 (45.61%), Query Frame = 3
Query:   33 KSLIRKSDENNNGNFINFIKQNNQKKLNNSEII--------SDFIVYRKPTNPNYSKLRYQTKSAEYFHKM-------------WCYHFMRGYHSEFQTN---------FQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            +SL+ K +      F+N     ++   +N +++         +  V   P  P ++   +   S+   H +             W  H  R     FQ +           ++ KRIR +F+ SQL  LE  F    Y++G ERK+LA SL+L+E Q+K+WFQNRRTK K+
Sbjct:   13 ESLVAKDNPVPMNPFLNGFHSGSRGVYSNPDLVFAEAVSHPPNSAVPVHPVAPPHALAAHPLSSSHSPHPLFASQQRDPSTFYPWLLHRYRYLGHRFQGDPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKR 183          
BLAST of Ventral anterior homeobox 1 vs. Planmine SMEST
Match: SMESG000055068.1 (SMESG000055068.1)

HSP 1 Score: 317.775 bits (813), Expect = 1.434e-112
Identity = 157/157 (100.00%), Postives = 157/157 (100.00%), Query Frame = 3
Query:    3 SFFIENILQPKSLIRKSDENNNGNFINFIKQNNQKKLNNSEIISDFIVYRKPTNPNYSKLRYQTKSAEYFHKMWCYHFMRGYHSEFQTNFQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKLNAVFD 473
            SFFIENILQPKSLIRKSDENNNGNFINFIKQNNQKKLNNSEIISDFIVYRKPTNPNYSKLRYQTKSAEYFHKMWCYHFMRGYHSEFQTNFQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKLNAVFD
Sbjct:    3 SFFIENILQPKSLIRKSDENNNGNFINFIKQNNQKKLNNSEIISDFIVYRKPTNPNYSKLRYQTKSAEYFHKMWCYHFMRGYHSEFQTNFQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKLNAVFD 159          
BLAST of Ventral anterior homeobox 1 vs. Planmine SMEST
Match: SMESG000017219.1 (SMESG000017219.1)

HSP 1 Score: 73.9442 bits (180), Expect = 5.043e-16
Identity = 35/66 (53.03%), Postives = 47/66 (71.21%), Query Frame = 3
Query:  276 KRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKLNAVFD 473
            ++ KRIR +F+ SQL  LE  F    Y++G ERK+LA SLNL+E Q+K+WFQNRRTK K+  +  D
Sbjct:  135 RKPKRIRTAFSPSQLMRLEDAFEKNHYVVGLERKKLAASLNLTETQVKVWFQNRRTKYKRGKSEVD 200          
BLAST of Ventral anterior homeobox 1 vs. Planmine SMEST
Match: SMESG000023118.1 (SMESG000023118.1)

HSP 1 Score: 65.0846 bits (157), Expect = 8.921e-13
Identity = 32/67 (47.76%), Postives = 43/67 (64.18%), Query Frame = 3
Query:  267 NFQKRKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKLNAV 467
            N   R+K  R +F+  Q+  LEK F    Y+ G ER RLA  L +SE+Q+K+WFQNRRTK +K +A 
Sbjct:  122 NDSNRRKHTRPTFSGQQIFALEKKFEQTKYLAGPERTRLAYLLGMSESQVKVWFQNRRTKWRKRSAA 188          
BLAST of Ventral anterior homeobox 1 vs. Planmine SMEST
Match: SMESG000027004.1 (SMESG000027004.1)

HSP 1 Score: 64.6994 bits (156), Expect = 9.304e-13
Identity = 32/59 (54.24%), Postives = 43/59 (72.88%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            +KKR R +F+ +Q+  LE+ F   +Y+ G ER  LA+SL L+ENQ+KIWFQNRR K KK
Sbjct:   64 KKKRSRAAFSHNQVYELERRFSHQTYLSGPERTELARSLKLTENQVKIWFQNRRYKTKK 122          
BLAST of Ventral anterior homeobox 1 vs. Planmine SMEST
Match: SMESG000027004.1 (SMESG000027004.1)

HSP 1 Score: 64.6994 bits (156), Expect = 9.402e-13
Identity = 32/59 (54.24%), Postives = 43/59 (72.88%), Query Frame = 3
Query:  279 RKKRIRKSFNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKK 455
            +KKR R +F+ +Q+  LE+ F   +Y+ G ER  LA+SL L+ENQ+KIWFQNRR K KK
Sbjct:   65 KKKRSRAAFSHNQVYELERRFSHQTYLSGPERTELARSLKLTENQVKIWFQNRRYKTKK 123          
The following BLAST results are available for this feature:
BLAST of Ventral anterior homeobox 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EMX19.294e-1753.03empty spiracles homeobox 1 [Source:HGNC Symbol;Acc... [more]
VAX21.139e-1659.32ventral anterior homeobox 2 [Source:HGNC Symbol;Ac... [more]
VAX12.173e-1659.32ventral anterior homeobox 1 [Source:HGNC Symbol;Ac... [more]
EMX24.377e-1543.33empty spiracles homeobox 2 [Source:HGNC Symbol;Acc... [more]
NKX6-28.703e-1450.79NK6 homeobox 2 [Source:HGNC Symbol;Acc:HGNC:19321][more]
back to top
BLAST of Ventral anterior homeobox 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ceh-51.027e-1652.38Homeobox protein ceh-5 [Source:UniProtKB/Swiss-Pr... [more]
ceh-24.446e-1654.10Homeobox protein ceh-2 [Source:UniProtKB/Swiss-Pr... [more]
cog-11.018e-1246.03COG-1B [Source:UniProtKB/TrEMBL;Acc:G5EGF2][more]
ceh-433.154e-1248.33Homeobox protein ceh-43 [Source:UniProtKB/Swiss-P... [more]
cog-18.244e-1246.03COG-1B [Source:UniProtKB/TrEMBL;Acc:G5EGF2][more]
back to top
BLAST of Ventral anterior homeobox 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ems6.243e-1855.74gene:FBgn0000576 transcript:FBtr0082863[more]
E51.660e-1549.18gene:FBgn0008646 transcript:FBtr0082880[more]
HGTX2.676e-1347.62gene:FBgn0040318 transcript:FBtr0075720[more]
bap4.593e-1252.54gene:FBgn0004862 transcript:FBtr0084087[more]
B-H16.221e-1244.12gene:FBgn0011758 transcript:FBtr0074430[more]
back to top
BLAST of Ventral anterior homeobox 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vax11.241e-1659.32ventral anterior homeobox 1 [Source:NCBI gene;Acc:... [more]
vax11.241e-1659.32ventral anterior homeobox 1 [Source:NCBI gene;Acc:... [more]
emx11.273e-1656.45empty spiracles homeobox 1 [Source:NCBI gene;Acc:3... [more]
vax21.502e-1659.32ventral anterior homeobox 2 [Source:NCBI gene;Acc:... [more]
emx31.100e-1553.23empty spiracles homeobox 3 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Ventral anterior homeobox 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VAX11.925e-1759.32ventral anterior homeobox 1 [Source:NCBI gene;Acc:... [more]
vps514.390e-1756.45VPS51 GARP complex subunit [Source:Xenbase;Acc:XB-... [more]
VAX21.570e-1659.32ventral anterior homeobox 2 [Source:NCBI gene;Acc:... [more]
sorl14.829e-1651.52sortilin-related receptor, L(DLR class) A repeats ... [more]
wdr703.322e-1543.33WD repeat domain 70 [Source:Xenbase;Acc:XB-GENE-95... [more]
back to top
BLAST of Ventral anterior homeobox 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Emx15.865e-1756.45empty spiracles homeobox 1 [Source:MGI Symbol;Acc:... [more]
Vax27.367e-1759.32ventral anterior homeobox 2 [Source:MGI Symbol;Acc... [more]
Vax11.614e-1659.32ventral anterior homeobox 1 [Source:MGI Symbol;Acc... [more]
Emx23.044e-1543.33empty spiracles homeobox 2 [Source:MGI Symbol;Acc:... [more]
Nkx6-31.903e-1349.21NK6 homeobox 3 [Source:MGI Symbol;Acc:MGI:1921811][more]
back to top
BLAST of Ventral anterior homeobox 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P18488|EMS_DROME7.843e-1755.74Homeotic protein empty spiracles OS=Drosophila mel... [more]
sp|Q04741|EMX1_HUMAN3.273e-1656.45Homeobox protein EMX1 OS=Homo sapiens OX=9606 GN=E... [more]
sp|Q6GLB9|EMX1_XENTR3.870e-1656.45Homeobox protein EMX1 OS=Xenopus tropicalis OX=836... [more]
sp|Q04742|EMX1_MOUSE4.102e-1656.45Homeobox protein EMX1 OS=Mus musculus OX=10090 GN=... [more]
sp|Q9WTP9|VAX2_MOUSE5.153e-1659.32Ventral anterior homeobox 2 OS=Mus musculus OX=100... [more]
back to top
BLAST of Ventral anterior homeobox 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3U5Z81.463e-1535.61Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3FG701.529e-1535.61Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0A1XBX02.050e-1557.38Homeotic protein empty spiracles OS=Zeugodacus cuc... [more]
B4JV492.459e-1557.38GH14408 OS=Drosophila grimshawi OX=7222 GN=Dgri\GH... [more]
A0A0R3TR702.597e-1554.55Homeobox domain-containing protein OS=Rodentolepis... [more]
back to top
BLAST of Ventral anterior homeobox 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
emx17.061e-1756.45homeobox protein EMX1 [Source:NCBI gene;Acc:103045... [more]
vax17.243e-1759.32ventral anterior homeobox 1 [Source:NCBI gene;Acc:... [more]
vax21.104e-1659.32ventral anterior homeobox 2 [Source:NCBI gene;Acc:... [more]
vax21.597e-1659.32ventral anterior homeobox 2 [Source:NCBI gene;Acc:... [more]
emx39.987e-1653.23homeobox protein EMX1-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Ventral anterior homeobox 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
emx22.484e-1853.03empty spiracles homeobox 2 [Source:ZFIN;Acc:ZDB-GE... [more]
barhl21.859e-1143.75BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050... [more]
barhl22.528e-1143.75BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050... [more]
ENSPMAT00000011473.13.220e-1147.54pep scaffold:Pmarinus_7.0:GL476736:88393:88668:-1 ... [more]
tlx13.239e-1142.19T cell leukemia homeobox 1 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Ventral anterior homeobox 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YOX17.560e-640.74Homeobox transcriptional repressor; binds to Mcm1p... [more]
back to top
BLAST of Ventral anterior homeobox 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO371421.620e-1750.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487103.368e-1660.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492511.800e-1450.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308872.719e-1447.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493013.854e-1456.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ventral anterior homeobox 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vax12.490e-1759.32ventral anterior homeobox 1 [Source:NCBI gene;Acc:... [more]
vax12.986e-1759.32ventral anterior homeobox 1 [Source:NCBI gene;Acc:... [more]
emx15.310e-1756.45homeobox protein EMX1 [Source:NCBI gene;Acc:101168... [more]
vax28.126e-1759.32ventral anterior homeobox 2 [Source:NCBI gene;Acc:... [more]
emx29.286e-1728.65empty spiracles homeobox 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Ventral anterior homeobox 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055068.11.434e-112100.00SMESG000055068.1[more]
SMESG000017219.15.043e-1653.03SMESG000017219.1[more]
SMESG000023118.18.921e-1347.76SMESG000023118.1[more]
SMESG000027004.19.304e-1354.24SMESG000027004.1[more]
SMESG000027004.19.402e-1354.24SMESG000027004.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019584 ID=SMED30019584|Name=Ventral anterior homeobox 1|organism=Schmidtea mediterranea sexual|type=transcript|length=564bp
GTTCGTTTTTTATTGAAAATATTCTTCAACCGAAATCACTAATAAGAAAA
TCAGACGAAAATAACAATGGGAATTTTATCAATTTTATCAAGCAGAACAA
TCAAAAAAAATTAAATAATTCAGAAATAATAAGCGATTTTATCGTTTATC
GAAAACCAACCAATCCGAATTACAGTAAACTGCGATACCAAACAAAGTCA
GCTGAATATTTTCATAAAATGTGGTGTTACCATTTTATGAGAGGATATCA
TTCAGAATTTCAGACCAATTTTCAAAAAAGAAAGAAACGAATAAGGAAAT
CATTCAATAAATCCCAATTGCAAATTCTAGAAAAGTATTTCTATACATGC
TCATATATTATTGGAGAGGAGAGGAAAAGATTAGCAAAATCACTAAATTT
ATCAGAAAACCAGATAAAGATCTGGTTTCAGAATCGTCGAACGAAGGAGA
AGAAACTAAATGCAGTTTTTGACAAATGAATCAAATAAAAATGTAAAATT
AAAGAATCTATTATAATATTCCTTCACCTGTAATTATTTTCTTCTTATTA
AATACAGTTTAGCC
back to top

protein sequence of SMED30019584-orf-1

>SMED30019584-orf-1 ID=SMED30019584-orf-1|Name=SMED30019584-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=159bp
SFFIENILQPKSLIRKSDENNNGNFINFIKQNNQKKLNNSEIISDFIVYR
KPTNPNYSKLRYQTKSAEYFHKMWCYHFMRGYHSEFQTNFQKRKKRIRKS
FNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEK
KLNAVFDK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007411axon guidance
GO:0007420brain development
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0007275multicellular organism development
GO:0007601visual perception
GO:0016055Wnt signaling pathway
GO:0030900forebrain development
GO:0048048embryonic eye morphogenesis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
Vocabulary: INTERPRO
TermDefinition
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 94..156
e-value: 2.9E-23
score: 93.3
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 95..151
e-value: 1.4E-20
score: 72.8
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 92..152
score: 20.342
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 95..151
e-value: 4.97756E-17
score: 68.8092
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 80..152
e-value: 2.5E-21
score: 77.6
NoneNo IPR availablePANTHERPTHR24339FAMILY NOT NAMEDcoord: 62..152
NoneNo IPR availablePANTHERPTHR24339:SF37E5coord: 62..152
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 127..150
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 74..153