Protein kinase domain containing protein

Overview
NameProtein kinase domain containing protein
Smed IDSMED30019571
Length (bp)1866
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain containing protein (SMED30019571) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain containing protein (SMED30019571) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain containing protein (SMED30019571) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain containing protein (SMED30019571) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019571

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30019571h1SMcG0005707 dd_Smed_v4_2822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30019571h1SMcG0005707 dd_Smed_v4_2822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019571h1SMcG0005707 dd_Smed_v4_2822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019571h1SMcG0005707 dd_Smed_v4_2822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019571h1SMcG0005707 dd_Smed_v4_2822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019571h1SMcG0005707 dd_Smed_v4_2822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019571h1SMcG0005707 dd_Smed_v4_2822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019571h1SMcG0005707 dd_Smed_v4_5481_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019571h1SMcG0005707 dd_Smed_v4_5481_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019571h1SMcG0005707 dd_Smed_v4_5481_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019571h1SMcG0005707 dd_Smed_v4_2822_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 64.3142 bits (155), Expect = 8.316e-13
Identity = 43/131 (32.82%), Postives = 63/131 (48.09%), Query Frame = 2
Query: 1340 NMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL--------IMNNSELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            N   GK  G G FGRV+   D+ +G++LA K    D  S      +SAL         + +  + +Y G  + ++E  L I M YM GGS+   ++    L E    + + QIL  +  LH   I+HRDIK
Sbjct:  388 NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIK 518          

HSP 2 Score: 29.6462 bits (65), Expect = 8.316e-13
Identity = 13/23 (56.52%), Postives = 16/23 (69.57%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D AGN KL DFG SK ++ 
Sbjct:  521 NILRDSAGNVKLGDFGASKRLQT 543          
BLAST of Protein kinase domain containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 64.3142 bits (155), Expect = 8.382e-13
Identity = 43/131 (32.82%), Postives = 63/131 (48.09%), Query Frame = 2
Query: 1340 NMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL--------IMNNSELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            N   GK  G G FGRV+   D+ +G++LA K    D  S      +SAL         + +  + +Y G  + ++E  L I M YM GGS+   ++    L E    + + QIL  +  LH   I+HRDIK
Sbjct:  392 NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIK 522          

HSP 2 Score: 29.6462 bits (65), Expect = 8.382e-13
Identity = 13/23 (56.52%), Postives = 16/23 (69.57%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D AGN KL DFG SK ++ 
Sbjct:  525 NILRDSAGNVKLGDFGASKRLQT 547          
BLAST of Protein kinase domain containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 64.3142 bits (155), Expect = 8.382e-13
Identity = 43/131 (32.82%), Postives = 63/131 (48.09%), Query Frame = 2
Query: 1340 NMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL--------IMNNSELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            N   GK  G G FGRV+   D+ +G++LA K    D  S      +SAL         + +  + +Y G  + ++E  L I M YM GGS+   ++    L E    + + QIL  +  LH   I+HRDIK
Sbjct:  392 NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIK 522          

HSP 2 Score: 29.6462 bits (65), Expect = 8.382e-13
Identity = 13/23 (56.52%), Postives = 16/23 (69.57%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D AGN KL DFG SK ++ 
Sbjct:  525 NILRDSAGNVKLGDFGASKRLQT 547          
BLAST of Protein kinase domain containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 64.3142 bits (155), Expect = 8.815e-13
Identity = 43/131 (32.82%), Postives = 63/131 (48.09%), Query Frame = 2
Query: 1340 NMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL--------IMNNSELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            N   GK  G G FGRV+   D+ +G++LA K    D  S      +SAL         + +  + +Y G  + ++E  L I M YM GGS+   ++    L E    + + QIL  +  LH   I+HRDIK
Sbjct:  361 NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIK 491          

HSP 2 Score: 29.6462 bits (65), Expect = 8.815e-13
Identity = 13/22 (59.09%), Postives = 16/22 (72.73%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMK 1821
            NI+ D AGN KL DFG SK ++
Sbjct:  494 NILRDSAGNVKLGDFGASKRLQ 515          
BLAST of Protein kinase domain containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 64.3142 bits (155), Expect = 8.961e-13
Identity = 43/131 (32.82%), Postives = 63/131 (48.09%), Query Frame = 2
Query: 1340 NMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL--------IMNNSELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            N   GK  G G FGRV+   D+ +G++LA K    D  S      +SAL         + +  + +Y G  + ++E  L I M YM GGS+   ++    L E    + + QIL  +  LH   I+HRDIK
Sbjct:  357 NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIK 487          

HSP 2 Score: 29.6462 bits (65), Expect = 8.961e-13
Identity = 13/22 (59.09%), Postives = 16/22 (72.73%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMK 1821
            NI+ D AGN KL DFG SK ++
Sbjct:  490 NILRDSAGNVKLGDFGASKRLQ 511          
BLAST of Protein kinase domain containing protein vs. Ensembl Celegans
Match: unc-82 (pep chromosome:WBcel235:IV:7424498:7444660:1 gene:WBGene00006814.1 transcript:B0496.3e.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-82)

HSP 1 Score: 53.5286 bits (127), Expect = 4.064e-10
Identity = 35/132 (26.52%), Postives = 65/132 (49.24%), Query Frame = 2
Query: 1328 KSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMK-------TANSDKSSLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            K      + K+ G+G +G+V    D    +++A+K        + +D   + R+I I +  +N+  + +   +F+ K ++ + M Y +GG L  Y+     L E EA RI  QI   +   H+ ++ HRD+K
Sbjct:  292 KEKHRFEITKKLGSGTYGKVSLAYDHKFDREVAVKLIKKSAIESKADLVRIRREIRIMS-ALNHPNIIQIYEVFENKDKIILVMEYSSGGELYDYVSRCGSLPEAEARRIFRQITSAVLYCHKHRVAHRDLK 422          

HSP 2 Score: 30.0314 bits (66), Expect = 4.064e-10
Identity = 14/31 (45.16%), Postives = 20/31 (64.52%), Query Frame = 1
Query: 1753 DNIVFDGAGNAKLIDFGLSKWMKNSTDENIL 1845
            +NI+ D   NAK+ DFGLS +     D+N+L
Sbjct:  424 ENILLDQNNNAKIADFGLSNYF---ADKNLL 451          
BLAST of Protein kinase domain containing protein vs. Ensembl Celegans
Match: unc-82 (pep chromosome:WBcel235:IV:7428926:7444648:1 gene:WBGene00006814.1 transcript:B0496.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-82)

HSP 1 Score: 53.5286 bits (127), Expect = 4.468e-10
Identity = 35/132 (26.52%), Postives = 65/132 (49.24%), Query Frame = 2
Query: 1328 KSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMK-------TANSDKSSLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            K      + K+ G+G +G+V    D    +++A+K        + +D   + R+I I +  +N+  + +   +F+ K ++ + M Y +GG L  Y+     L E EA RI  QI   +   H+ ++ HRD+K
Sbjct:   53 KEKHRFEITKKLGSGTYGKVSLAYDHKFDREVAVKLIKKSAIESKADLVRIRREIRIMS-ALNHPNIIQIYEVFENKDKIILVMEYSSGGELYDYVSRCGSLPEAEARRIFRQITSAVLYCHKHRVAHRDLK 183          

HSP 2 Score: 30.0314 bits (66), Expect = 4.468e-10
Identity = 14/31 (45.16%), Postives = 20/31 (64.52%), Query Frame = 1
Query: 1753 DNIVFDGAGNAKLIDFGLSKWMKNSTDENIL 1845
            +NI+ D   NAK+ DFGLS +     D+N+L
Sbjct:  185 ENILLDQNNNAKIADFGLSNYF---ADKNLL 212          
BLAST of Protein kinase domain containing protein vs. Ensembl Celegans
Match: unc-82 (pep chromosome:WBcel235:IV:7428926:7444648:1 gene:WBGene00006814.1 transcript:B0496.3d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-82)

HSP 1 Score: 53.5286 bits (127), Expect = 4.800e-10
Identity = 35/132 (26.52%), Postives = 65/132 (49.24%), Query Frame = 2
Query: 1328 KSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMK-------TANSDKSSLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            K      + K+ G+G +G+V    D    +++A+K        + +D   + R+I I +  +N+  + +   +F+ K ++ + M Y +GG L  Y+     L E EA RI  QI   +   H+ ++ HRD+K
Sbjct:   53 KEKHRFEITKKLGSGTYGKVSLAYDHKFDREVAVKLIKKSAIESKADLVRIRREIRIMS-ALNHPNIIQIYEVFENKDKIILVMEYSSGGELYDYVSRCGSLPEAEARRIFRQITSAVLYCHKHRVAHRDLK 183          

HSP 2 Score: 30.0314 bits (66), Expect = 4.800e-10
Identity = 14/31 (45.16%), Postives = 20/31 (64.52%), Query Frame = 1
Query: 1753 DNIVFDGAGNAKLIDFGLSKWMKNSTDENIL 1845
            +NI+ D   NAK+ DFGLS +     D+N+L
Sbjct:  185 ENILLDQNNNAKIADFGLSNYF---ADKNLL 212          
BLAST of Protein kinase domain containing protein vs. Ensembl Celegans
Match: unc-82 (pep chromosome:WBcel235:IV:7428926:7444648:1 gene:WBGene00006814.1 transcript:B0496.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-82)

HSP 1 Score: 53.5286 bits (127), Expect = 4.956e-10
Identity = 35/132 (26.52%), Postives = 65/132 (49.24%), Query Frame = 2
Query: 1328 KSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMK-------TANSDKSSLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            K      + K+ G+G +G+V    D    +++A+K        + +D   + R+I I +  +N+  + +   +F+ K ++ + M Y +GG L  Y+     L E EA RI  QI   +   H+ ++ HRD+K
Sbjct:   53 KEKHRFEITKKLGSGTYGKVSLAYDHKFDREVAVKLIKKSAIESKADLVRIRREIRIMS-ALNHPNIIQIYEVFENKDKIILVMEYSSGGELYDYVSRCGSLPEAEARRIFRQITSAVLYCHKHRVAHRDLK 183          

HSP 2 Score: 30.0314 bits (66), Expect = 4.956e-10
Identity = 14/31 (45.16%), Postives = 20/31 (64.52%), Query Frame = 1
Query: 1753 DNIVFDGAGNAKLIDFGLSKWMKNSTDENIL 1845
            +NI+ D   NAK+ DFGLS +     D+N+L
Sbjct:  185 ENILLDQNNNAKIADFGLSNYF---ADKNLL 212          
BLAST of Protein kinase domain containing protein vs. Ensembl Celegans
Match: unc-82 (pep chromosome:WBcel235:IV:7431348:7444648:1 gene:WBGene00006814.1 transcript:B0496.3i.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-82)

HSP 1 Score: 53.1434 bits (126), Expect = 5.329e-10
Identity = 35/132 (26.52%), Postives = 65/132 (49.24%), Query Frame = 2
Query: 1328 KSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMK-------TANSDKSSLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            K      + K+ G+G +G+V    D    +++A+K        + +D   + R+I I +  +N+  + +   +F+ K ++ + M Y +GG L  Y+     L E EA RI  QI   +   H+ ++ HRD+K
Sbjct:   70 KEKHRFEITKKLGSGTYGKVSLAYDHKFDREVAVKLIKKSAIESKADLVRIRREIRIMS-ALNHPNIIQIYEVFENKDKIILVMEYSSGGELYDYVSRCGSLPEAEARRIFRQITSAVLYCHKHRVAHRDLK 200          

HSP 2 Score: 30.0314 bits (66), Expect = 5.329e-10
Identity = 14/31 (45.16%), Postives = 20/31 (64.52%), Query Frame = 1
Query: 1753 DNIVFDGAGNAKLIDFGLSKWMKNSTDENIL 1845
            +NI+ D   NAK+ DFGLS +     D+N+L
Sbjct:  202 ENILLDQNNNAKIADFGLSNYF---ADKNLL 229          
BLAST of Protein kinase domain containing protein vs. Ensembl Fly
Match: Nuak1 (gene:FBgn0262617 transcript:FBtr0337050)

HSP 1 Score: 57.7658 bits (138), Expect = 3.513e-11
Identity = 36/132 (27.27%), Postives = 71/132 (53.79%), Query Frame = 2
Query: 1328 KSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKT-------ANSDKSSLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            K  +  ++ K+ G G +G+V    +  +G+++A+KT       A +D   + R++ I + + + + +  Y  +F+ + ++ + M +  GG L  Y+  +K L E+EA RI  Q+   +   H+ KI HRD+K
Sbjct:   65 KLRQRFDIIKKLGQGTYGKVQLGINKETGQEVAIKTIKKCKIEAEADLVRIRREVQIMSSVHHPNIIHIYE-VFENREKMVLVMEFAAGGELYDYLSERKVLTEEEARRIFRQVATAVYYCHKHKICHRDLK 195          

HSP 2 Score: 30.0314 bits (66), Expect = 3.513e-11
Identity = 12/19 (63.16%), Postives = 15/19 (78.95%), Query Frame = 1
Query: 1753 DNIVFDGAGNAKLIDFGLS 1809
            +NI+ D  GNAK+ DFGLS
Sbjct:  197 ENILLDEKGNAKIADFGLS 215          
BLAST of Protein kinase domain containing protein vs. Ensembl Fly
Match: Nuak1 (gene:FBgn0262617 transcript:FBtr0305355)

HSP 1 Score: 57.7658 bits (138), Expect = 3.514e-11
Identity = 36/132 (27.27%), Postives = 71/132 (53.79%), Query Frame = 2
Query: 1328 KSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKT-------ANSDKSSLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            K  +  ++ K+ G G +G+V    +  +G+++A+KT       A +D   + R++ I + + + + +  Y  +F+ + ++ + M +  GG L  Y+  +K L E+EA RI  Q+   +   H+ KI HRD+K
Sbjct:   65 KLRQRFDIIKKLGQGTYGKVQLGINKETGQEVAIKTIKKCKIEAEADLVRIRREVQIMSSVHHPNIIHIYE-VFENREKMVLVMEFAAGGELYDYLSERKVLTEEEARRIFRQVATAVYYCHKHKICHRDLK 195          

HSP 2 Score: 30.0314 bits (66), Expect = 3.514e-11
Identity = 12/19 (63.16%), Postives = 15/19 (78.95%), Query Frame = 1
Query: 1753 DNIVFDGAGNAKLIDFGLS 1809
            +NI+ D  GNAK+ DFGLS
Sbjct:  197 ENILLDEKGNAKIADFGLS 215          
BLAST of Protein kinase domain containing protein vs. Ensembl Fly
Match: Nuak1 (gene:FBgn0262617 transcript:FBtr0337049)

HSP 1 Score: 57.7658 bits (138), Expect = 3.562e-11
Identity = 36/132 (27.27%), Postives = 71/132 (53.79%), Query Frame = 2
Query: 1328 KSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKT-------ANSDKSSLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            K  +  ++ K+ G G +G+V    +  +G+++A+KT       A +D   + R++ I + + + + +  Y  +F+ + ++ + M +  GG L  Y+  +K L E+EA RI  Q+   +   H+ KI HRD+K
Sbjct:   65 KLRQRFDIIKKLGQGTYGKVQLGINKETGQEVAIKTIKKCKIEAEADLVRIRREVQIMSSVHHPNIIHIYE-VFENREKMVLVMEFAAGGELYDYLSERKVLTEEEARRIFRQVATAVYYCHKHKICHRDLK 195          

HSP 2 Score: 30.0314 bits (66), Expect = 3.562e-11
Identity = 12/19 (63.16%), Postives = 15/19 (78.95%), Query Frame = 1
Query: 1753 DNIVFDGAGNAKLIDFGLS 1809
            +NI+ D  GNAK+ DFGLS
Sbjct:  197 ENILLDEKGNAKIADFGLS 215          
BLAST of Protein kinase domain containing protein vs. Ensembl Fly
Match: Nuak1 (gene:FBgn0262617 transcript:FBtr0305356)

HSP 1 Score: 57.7658 bits (138), Expect = 3.563e-11
Identity = 36/132 (27.27%), Postives = 71/132 (53.79%), Query Frame = 2
Query: 1328 KSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKT-------ANSDKSSLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            K  +  ++ K+ G G +G+V    +  +G+++A+KT       A +D   + R++ I + + + + +  Y  +F+ + ++ + M +  GG L  Y+  +K L E+EA RI  Q+   +   H+ KI HRD+K
Sbjct:   65 KLRQRFDIIKKLGQGTYGKVQLGINKETGQEVAIKTIKKCKIEAEADLVRIRREVQIMSSVHHPNIIHIYE-VFENREKMVLVMEFAAGGELYDYLSERKVLTEEEARRIFRQVATAVYYCHKHKICHRDLK 195          

HSP 2 Score: 30.0314 bits (66), Expect = 3.563e-11
Identity = 12/19 (63.16%), Postives = 15/19 (78.95%), Query Frame = 1
Query: 1753 DNIVFDGAGNAKLIDFGLS 1809
            +NI+ D  GNAK+ DFGLS
Sbjct:  197 ENILLDEKGNAKIADFGLS 215          
BLAST of Protein kinase domain containing protein vs. Ensembl Fly
Match: Nuak1 (gene:FBgn0262617 transcript:FBtr0305354)

HSP 1 Score: 57.7658 bits (138), Expect = 3.570e-11
Identity = 36/132 (27.27%), Postives = 71/132 (53.79%), Query Frame = 2
Query: 1328 KSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKT-------ANSDKSSLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            K  +  ++ K+ G G +G+V    +  +G+++A+KT       A +D   + R++ I + + + + +  Y  +F+ + ++ + M +  GG L  Y+  +K L E+EA RI  Q+   +   H+ KI HRD+K
Sbjct:   65 KLRQRFDIIKKLGQGTYGKVQLGINKETGQEVAIKTIKKCKIEAEADLVRIRREVQIMSSVHHPNIIHIYE-VFENREKMVLVMEFAAGGELYDYLSERKVLTEEEARRIFRQVATAVYYCHKHKICHRDLK 195          

HSP 2 Score: 30.0314 bits (66), Expect = 3.570e-11
Identity = 12/19 (63.16%), Postives = 15/19 (78.95%), Query Frame = 1
Query: 1753 DNIVFDGAGNAKLIDFGLS 1809
            +NI+ D  GNAK+ DFGLS
Sbjct:  197 ENILLDEKGNAKIADFGLS 215          
BLAST of Protein kinase domain containing protein vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 65.855 bits (159), Expect = 4.885e-13
Identity = 45/135 (33.33%), Postives = 66/135 (48.89%), Query Frame = 2
Query: 1328 KSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL-----IMNN---SELFKYSGLFK--YKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            ++  N  LGK  G G FGRVF   D  +G++LA+K    D  S      +SAL     ++ N     + +Y G  +  ++  L I M YM GGS+   ++    L E    + + QIL  +  LH   I+HRDIK
Sbjct:  349 RAPTNWRLGKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVSALECEIQLLKNLFHERIVQYYGCLRDTHEKTLSIFMEYMPGGSIKDQLKSYGALTENVTRKYTRQILEGVCYLHSNMIVHRDIK 483          

HSP 2 Score: 28.4906 bits (62), Expect = 4.885e-13
Identity = 12/23 (52.17%), Postives = 16/23 (69.57%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D AGN KL DFG S+ ++ 
Sbjct:  486 NILRDSAGNVKLGDFGASRRLQT 508          
BLAST of Protein kinase domain containing protein vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 65.855 bits (159), Expect = 5.004e-13
Identity = 45/135 (33.33%), Postives = 66/135 (48.89%), Query Frame = 2
Query: 1328 KSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL-----IMNN---SELFKYSGLFK--YKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            ++  N  LGK  G G FGRVF   D  +G++LA+K    D  S      +SAL     ++ N     + +Y G  +  ++  L I M YM GGS+   ++    L E    + + QIL  +  LH   I+HRDIK
Sbjct:  357 RAPTNWRLGKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVSALECEIQLLKNLFHERIVQYYGCLRDTHEKTLSIFMEYMPGGSIKDQLKSYGALTENVTRKYTRQILEGVCYLHSNMIVHRDIK 491          

HSP 2 Score: 28.8758 bits (63), Expect = 5.004e-13
Identity = 12/23 (52.17%), Postives = 16/23 (69.57%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D AGN KL DFG S+ ++ 
Sbjct:  494 NILRDSAGNVKLGDFGASRRLQT 516          
BLAST of Protein kinase domain containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 63.5438 bits (153), Expect = 1.208e-12
Identity = 42/127 (33.07%), Postives = 64/127 (50.39%), Query Frame = 2
Query: 1352 GKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL--------IMNNSELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            GK  G G FGRV+   D+ +G++LA K  + D +S      +SAL         +++  + +Y G  +  +E  L I M YM GGS+   ++    L E    + + QIL  +  LH   I+HRDIK
Sbjct:  347 GKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKNLHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIK 473          

HSP 2 Score: 29.6462 bits (65), Expect = 1.208e-12
Identity = 13/23 (56.52%), Postives = 16/23 (69.57%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D AGN KL DFG SK ++ 
Sbjct:  476 NILRDSAGNVKLGDFGASKRLQT 498          
BLAST of Protein kinase domain containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 63.1586 bits (152), Expect = 1.580e-12
Identity = 42/127 (33.07%), Postives = 64/127 (50.39%), Query Frame = 2
Query: 1352 GKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL--------IMNNSELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            GK  G G FGRV+   D+ +G++LA K  + D +S      +SAL         +++  + +Y G  +  +E  L I M YM GGS+   ++    L E    + + QIL  +  LH   I+HRDIK
Sbjct:  359 GKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKNLHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIK 485          

HSP 2 Score: 29.6462 bits (65), Expect = 1.580e-12
Identity = 13/23 (56.52%), Postives = 16/23 (69.57%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D AGN KL DFG SK ++ 
Sbjct:  488 NILRDSAGNVKLGDFGASKRLQT 510          
BLAST of Protein kinase domain containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 63.1586 bits (152), Expect = 1.686e-12
Identity = 42/127 (33.07%), Postives = 64/127 (50.39%), Query Frame = 2
Query: 1352 GKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL--------IMNNSELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            GK  G G FGRV+   D+ +G++LA K  + D +S      +SAL         +++  + +Y G  +  +E  L I M YM GGS+   ++    L E    + + QIL  +  LH   I+HRDIK
Sbjct:  365 GKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKNLHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIK 491          

HSP 2 Score: 29.6462 bits (65), Expect = 1.686e-12
Identity = 13/23 (56.52%), Postives = 16/23 (69.57%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D AGN KL DFG SK ++ 
Sbjct:  494 NILRDSAGNVKLGDFGASKRLQT 516          
BLAST of Protein kinase domain containing protein vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 66.6254 bits (161), Expect = 2.152e-13
Identity = 45/131 (34.35%), Postives = 63/131 (48.09%), Query Frame = 2
Query: 1340 NMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL--------IMNNSELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            N   GK  G G FGRV+   D+ +G++LA K    D  S      +SAL         +++  + +Y G  + K E  L I M YM GGS+   ++    L E    R + QIL  +  LH   I+HRDIK
Sbjct:  364 NWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEIQLLKNLHHDRIVQYYGSLRDKGEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIK 494          

HSP 2 Score: 29.6462 bits (65), Expect = 2.152e-13
Identity = 13/23 (56.52%), Postives = 16/23 (69.57%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D AGN KL DFG SK ++ 
Sbjct:  497 NILRDSAGNVKLGDFGASKRLQT 519          
BLAST of Protein kinase domain containing protein vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 66.6254 bits (161), Expect = 2.243e-13
Identity = 45/131 (34.35%), Postives = 63/131 (48.09%), Query Frame = 2
Query: 1340 NMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL--------IMNNSELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            N   GK  G G FGRV+   D+ +G++LA K    D  S      +SAL         +++  + +Y G  + K E  L I M YM GGS+   ++    L E    R + QIL  +  LH   I+HRDIK
Sbjct:  346 NWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEIQLLKNLHHDRIVQYYGSLRDKGEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIK 476          

HSP 2 Score: 29.6462 bits (65), Expect = 2.243e-13
Identity = 13/22 (59.09%), Postives = 16/22 (72.73%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMK 1821
            NI+ D AGN KL DFG SK ++
Sbjct:  479 NILRDSAGNVKLGDFGASKRLQ 500          
BLAST of Protein kinase domain containing protein vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 65.855 bits (159), Expect = 1.110e-12
Identity = 45/135 (33.33%), Postives = 66/135 (48.89%), Query Frame = 2
Query: 1328 KSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL-----IMNN---SELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            ++  N  LGK  G G FGRV+   D  +G++LA+K    D  SL     ++AL     ++ N     + +Y G  +   E  L I M YM GGS+   ++    L E    + + QIL  +  LH   I+HRDIK
Sbjct:  334 RAPSNWRLGKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPDSLETSKEVNALECEIQLLKNLLHERIVQYYGCLRDSQEKTLSIFMEYMPGGSIKDQLKAYGALTEFVTRKYTRQILEGVHYLHSNMIVHRDIK 468          

HSP 2 Score: 28.1054 bits (61), Expect = 1.110e-12
Identity = 12/23 (52.17%), Postives = 16/23 (69.57%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D +GN KL DFG SK ++ 
Sbjct:  471 NILRDSSGNVKLGDFGASKRLQT 493          
BLAST of Protein kinase domain containing protein vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 65.0846 bits (157), Expect = 1.587e-12
Identity = 45/135 (33.33%), Postives = 66/135 (48.89%), Query Frame = 2
Query: 1328 KSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL-----IMNN---SELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            ++  N  LGK  G G FGRV+   D  +G++LA+K    D  SL     ++AL     ++ N     + +Y G  +   E  L I M YM GGS+   ++    L E    + + QIL  +  LH   I+HRDIK
Sbjct:  362 RAPSNWRLGKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPDSLETSKEVNALECEIQLLKNLLHERIVQYYGCLRDSQEKTLSIFMEYMPGGSIKDQLKAYGALTEFVTRKYTRQILEGVHYLHSNMIVHRDIK 496          

HSP 2 Score: 28.1054 bits (61), Expect = 1.587e-12
Identity = 12/23 (52.17%), Postives = 16/23 (69.57%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D +GN KL DFG SK ++ 
Sbjct:  499 NILRDSSGNVKLGDFGASKRLQT 521          
BLAST of Protein kinase domain containing protein vs. Ensembl Xenopus
Match: dennd1a (DENN domain containing 1A [Source:Xenbase;Acc:XB-GENE-5729862])

HSP 1 Score: 64.3142 bits (155), Expect = 2.095e-12
Identity = 43/135 (31.85%), Postives = 65/135 (48.15%), Query Frame = 2
Query: 1328 KSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL--------IMNNSELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            ++ EN  LGK  G G FG V+   D+  G++LA+K    D  S      ++AL        +  +  + +Y G  +  +E  L I + YM GGS+   ++    L E    R + QIL  +  LH   I+HRDIK
Sbjct:  349 QAPENWRLGKLLGRGAFGEVYLCYDVDKGRELAVKQVPFDPDSQETSKEVNALECEIQLLKLHRHERIVQYYGCLRDPTERKLSIFVEYMPGGSIKDQLKAYGALTENVTRRYTRQILQGVSYLHGNMIVHRDIK 483          

HSP 2 Score: 28.8758 bits (63), Expect = 2.095e-12
Identity = 13/23 (56.52%), Postives = 16/23 (69.57%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D AGN KL DFG SK ++ 
Sbjct:  486 NILRDSAGNVKLGDFGASKRIQT 508          
BLAST of Protein kinase domain containing protein vs. Ensembl Mouse
Match: Map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:MGI Symbol;Acc:MGI:1346874])

HSP 1 Score: 64.6994 bits (156), Expect = 5.740e-13
Identity = 43/131 (32.82%), Postives = 63/131 (48.09%), Query Frame = 2
Query: 1340 NMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL--------IMNNSELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            N   GK  G G FGRV+   D+ +G++LA K    D  S      +SAL         + +  + +Y G  + ++E  L I M YM GGS+   ++    L E    + + QIL  +  LH   I+HRDIK
Sbjct:  361 NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAEKILTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIK 491          

HSP 2 Score: 29.6462 bits (65), Expect = 5.740e-13
Identity = 13/23 (56.52%), Postives = 16/23 (69.57%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D AGN KL DFG SK ++ 
Sbjct:  494 NILRDSAGNVKLGDFGASKRLQT 516          
BLAST of Protein kinase domain containing protein vs. Ensembl Mouse
Match: Map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346873])

HSP 1 Score: 63.929 bits (154), Expect = 4.664e-12
Identity = 43/135 (31.85%), Postives = 66/135 (48.89%), Query Frame = 2
Query: 1328 KSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL-----IMNN---SELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            ++  N  LGK  G G FGRV+   D+ +G++LA+K    +  S      ++AL     ++ N     + +Y G  +   E  L I M YM GGS+   ++    L E    + + QIL  +  LH   I+HRDIK
Sbjct:  351 RAPTNWRLGKLLGQGAFGRVYLCYDVDTGRELAVKQVQFNPESPETSKEVNALECEIQLLKNLLHERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIK 485          

HSP 2 Score: 27.335 bits (59), Expect = 4.664e-12
Identity = 12/23 (52.17%), Postives = 15/23 (65.22%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D  GN KL DFG SK ++ 
Sbjct:  488 NILRDSTGNIKLGDFGASKRLQT 510          
BLAST of Protein kinase domain containing protein vs. Ensembl Mouse
Match: Prkaa1 (protein kinase, AMP-activated, alpha 1 catalytic subunit [Source:MGI Symbol;Acc:MGI:2145955])

HSP 1 Score: 59.3066 bits (142), Expect = 4.761e-11
Identity = 39/127 (30.71%), Postives = 66/127 (51.97%), Query Frame = 2
Query: 1349 LGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISALI---MNNSELFKYSGLFK------YKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            LG   G G FG+V   +  ++G ++A+K  N  K    R + +   I   + N +LF++  + K        S++++ M Y++GG L  YI     L EKE+ R+  QIL  ++  H   ++HRD+K
Sbjct:   29 LGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQK---IRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLK 152          

HSP 2 Score: 28.4906 bits (62), Expect = 4.761e-11
Identity = 11/25 (44.00%), Postives = 16/25 (64.00%), Query Frame = 1
Query: 1750 ADNIVFDGAGNAKLIDFGLSKWMKN 1824
             +N++ D   NAK+ DFGLS  M +
Sbjct:  153 PENVLLDAHMNAKIADFGLSNMMSD 177          
BLAST of Protein kinase domain containing protein vs. Ensembl Mouse
Match: Prkaa1 (protein kinase, AMP-activated, alpha 1 catalytic subunit [Source:MGI Symbol;Acc:MGI:2145955])

HSP 1 Score: 59.3066 bits (142), Expect = 4.881e-11
Identity = 39/127 (30.71%), Postives = 66/127 (51.97%), Query Frame = 2
Query: 1349 LGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISALI---MNNSELFKYSGLFK------YKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            LG   G G FG+V   +  ++G ++A+K  N  K    R + +   I   + N +LF++  + K        S++++ M Y++GG L  YI     L EKE+ R+  QIL  ++  H   ++HRD+K
Sbjct:   20 LGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQK---IRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLK 143          

HSP 2 Score: 28.4906 bits (62), Expect = 4.881e-11
Identity = 11/25 (44.00%), Postives = 16/25 (64.00%), Query Frame = 1
Query: 1750 ADNIVFDGAGNAKLIDFGLSKWMKN 1824
             +N++ D   NAK+ DFGLS  M +
Sbjct:  144 PENVLLDAHMNAKIADFGLSNMMSD 168          
BLAST of Protein kinase domain containing protein vs. Ensembl Mouse
Match: Prkaa2 (protein kinase, AMP-activated, alpha 2 catalytic subunit [Source:MGI Symbol;Acc:MGI:1336173])

HSP 1 Score: 55.0694 bits (131), Expect = 8.056e-10
Identity = 37/127 (29.13%), Postives = 64/127 (50.39%), Query Frame = 2
Query: 1349 LGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISALI---MNNSELFKYSGLFK------YKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            LG   G G FG+V   +  ++G ++A+K  N  K    R + +   I   + N +LF++  + K        ++ ++ M Y++GG L  YI     + E EA R+  QIL  ++  H   ++HRD+K
Sbjct:   18 LGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQK---IRSLDVVGKIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEVEARRLFQQILSAVDYCHRHMVVHRDLK 141          

HSP 2 Score: 28.4906 bits (62), Expect = 8.056e-10
Identity = 11/25 (44.00%), Postives = 16/25 (64.00%), Query Frame = 1
Query: 1750 ADNIVFDGAGNAKLIDFGLSKWMKN 1824
             +N++ D   NAK+ DFGLS  M +
Sbjct:  142 PENVLLDAQMNAKIADFGLSNMMSD 166          
BLAST of Protein kinase domain containing protein vs. UniProt/SwissProt
Match: sp|Q61084|M3K3_MOUSE (Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus OX=10090 GN=Map3k3 PE=1 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 3.480e-12
Identity = 43/131 (32.82%), Postives = 63/131 (48.09%), Query Frame = 2
Query: 1340 NMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL--------IMNNSELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            N   GK  G G FGRV+   D+ +G++LA K    D  S      +SAL         + +  + +Y G  + ++E  L I M YM GGS+   ++    L E    + + QIL  +  LH   I+HRDIK
Sbjct:  361 NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAEKILTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIK 491          

HSP 2 Score: 29.6462 bits (65), Expect = 3.480e-12
Identity = 13/23 (56.52%), Postives = 16/23 (69.57%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D AGN KL DFG SK ++ 
Sbjct:  494 NILRDSAGNVKLGDFGASKRLQT 516          
BLAST of Protein kinase domain containing protein vs. UniProt/SwissProt
Match: sp|Q99759|M3K3_HUMAN (Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP3K3 PE=1 SV=2)

HSP 1 Score: 64.3142 bits (155), Expect = 3.869e-12
Identity = 43/131 (32.82%), Postives = 63/131 (48.09%), Query Frame = 2
Query: 1340 NMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL--------IMNNSELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            N   GK  G G FGRV+   D+ +G++LA K    D  S      +SAL         + +  + +Y G  + ++E  L I M YM GGS+   ++    L E    + + QIL  +  LH   I+HRDIK
Sbjct:  361 NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIK 491          

HSP 2 Score: 29.6462 bits (65), Expect = 3.869e-12
Identity = 13/22 (59.09%), Postives = 16/22 (72.73%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMK 1821
            NI+ D AGN KL DFG SK ++
Sbjct:  494 NILRDSAGNVKLGDFGASKRLQ 515          
BLAST of Protein kinase domain containing protein vs. UniProt/SwissProt
Match: sp|Q9Y2U5|M3K2_HUMAN (Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2)

HSP 1 Score: 65.855 bits (159), Expect = 4.903e-12
Identity = 44/135 (32.59%), Postives = 66/135 (48.89%), Query Frame = 2
Query: 1328 KSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL-----IMNN---SELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            ++  N  LGK  G G FGRV+   D+ +G++LA+K    D  S      ++AL     ++ N     + +Y G  +   E  L I M YM GGS+   ++    L E    + + QIL  +  LH   I+HRDIK
Sbjct:  351 RAPTNWRLGKLLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLLHERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIK 485          

HSP 2 Score: 27.7202 bits (60), Expect = 4.903e-12
Identity = 12/23 (52.17%), Postives = 15/23 (65.22%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D  GN KL DFG SK ++ 
Sbjct:  488 NILRDSTGNVKLGDFGASKRLQT 510          
BLAST of Protein kinase domain containing protein vs. UniProt/SwissProt
Match: sp|Q5RDH5|AAPK1_PONAB (5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii OX=9601 GN=PRKAA1 PE=2 SV=2)

HSP 1 Score: 59.3066 bits (142), Expect = 2.684e-10
Identity = 39/127 (30.71%), Postives = 66/127 (51.97%), Query Frame = 2
Query: 1349 LGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISALI---MNNSELFKYSGLFK------YKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            LG   G G FG+V   +  ++G ++A+K  N  K    R + +   I   + N +LF++  + K        S++++ M Y++GG L  YI     L EKE+ R+  QIL  ++  H   ++HRD+K
Sbjct:   24 LGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQK---IRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLK 147          

HSP 2 Score: 28.4906 bits (62), Expect = 2.684e-10
Identity = 11/25 (44.00%), Postives = 16/25 (64.00%), Query Frame = 1
Query: 1750 ADNIVFDGAGNAKLIDFGLSKWMKN 1824
             +N++ D   NAK+ DFGLS  M +
Sbjct:  148 PENVLLDAHMNAKIADFGLSNMMSD 172          
BLAST of Protein kinase domain containing protein vs. UniProt/SwissProt
Match: sp|Q13131|AAPK1_HUMAN (5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens OX=9606 GN=PRKAA1 PE=1 SV=4)

HSP 1 Score: 59.3066 bits (142), Expect = 2.728e-10
Identity = 39/127 (30.71%), Postives = 66/127 (51.97%), Query Frame = 2
Query: 1349 LGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISALI---MNNSELFKYSGLFK------YKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            LG   G G FG+V   +  ++G ++A+K  N  K    R + +   I   + N +LF++  + K        S++++ M Y++GG L  YI     L EKE+ R+  QIL  ++  H   ++HRD+K
Sbjct:   29 LGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQK---IRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLK 152          

HSP 2 Score: 28.4906 bits (62), Expect = 2.728e-10
Identity = 11/25 (44.00%), Postives = 16/25 (64.00%), Query Frame = 1
Query: 1750 ADNIVFDGAGNAKLIDFGLSKWMKN 1824
             +N++ D   NAK+ DFGLS  M +
Sbjct:  153 PENVLLDAHMNAKIADFGLSNMMSD 177          
BLAST of Protein kinase domain containing protein vs. TrEMBL
Match: A0A3Q1GWM2 (Mitogen-activated protein kinase kinase kinase 2 OS=Acanthochromis polyacanthus OX=80966 PE=4 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 2.176e-11
Identity = 47/135 (34.81%), Postives = 65/135 (48.15%), Query Frame = 2
Query: 1328 KSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL-----IMNN---SELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            ++  N  LGK  G G FGRVF   D  +G++LA+K    D  S      +SAL     ++ N     + +Y G  +   E  L I M YM GGS+   ++    L E    R + QIL  +  LH   I+HRDIK
Sbjct:  354 RAPTNWRLGKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPESPETSKEVSALECEIQLLKNLCHERIVQYYGCLRDSMERTLSIFMEYMPGGSIKDQLKSYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIK 488          

HSP 2 Score: 31.5722 bits (70), Expect = 2.176e-11
Identity = 12/23 (52.17%), Postives = 16/23 (69.57%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D  GN KL DFG S+W++ 
Sbjct:  491 NILRDSVGNVKLGDFGASRWLQT 513          
BLAST of Protein kinase domain containing protein vs. TrEMBL
Match: A0A3Q1GTU5 (Mitogen-activated protein kinase kinase kinase 2 OS=Acanthochromis polyacanthus OX=80966 PE=4 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 2.339e-11
Identity = 47/135 (34.81%), Postives = 65/135 (48.15%), Query Frame = 2
Query: 1328 KSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL-----IMNN---SELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            ++  N  LGK  G G FGRVF   D  +G++LA+K    D  S      +SAL     ++ N     + +Y G  +   E  L I M YM GGS+   ++    L E    R + QIL  +  LH   I+HRDIK
Sbjct:  381 RAPTNWRLGKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPESPETSKEVSALECEIQLLKNLCHERIVQYYGCLRDSMERTLSIFMEYMPGGSIKDQLKSYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIK 515          

HSP 2 Score: 31.5722 bits (70), Expect = 2.339e-11
Identity = 12/23 (52.17%), Postives = 16/23 (69.57%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D  GN KL DFG S+W++ 
Sbjct:  518 NILRDSVGNVKLGDFGASRWLQT 540          
BLAST of Protein kinase domain containing protein vs. TrEMBL
Match: T2M6M6 (Mitogen-activated protein kinase kinase kinase 3 OS=Hydra vulgaris OX=6087 GN=MAP3K3 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 4.727e-11
Identity = 45/125 (36.00%), Postives = 67/125 (53.60%), Query Frame = 2
Query: 1355 KEFGAGGFGRVFFYQDIISGKQLAMK---TANSDKSSL------YRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            ++ G+GGFG V+   D+ +GK+LAMK   T + + ++L       R+I +    +N+  + +Y G  +  + + I M YM GGS+   I     L EKE     +QIL  I  LH   IIHRDIK
Sbjct:  371 RQIGSGGFGTVYLCVDLNTGKELAMKYIETGHINTAALKEVEILQREISLYK-TLNHERIVEYYGTIQANTSISIFMEYMEGGSIHDKISKIGALDEKETSCYCFQILEGINYLHSKNIIHRDIK 494          

HSP 2 Score: 30.0314 bits (66), Expect = 4.727e-11
Identity = 12/22 (54.55%), Postives = 16/22 (72.73%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMK 1821
            NI+ D +GN KL DFG SK ++
Sbjct:  497 NILLDSSGNCKLADFGASKQIQ 518          
BLAST of Protein kinase domain containing protein vs. TrEMBL
Match: G0UZH0 (Protein kinase domain-containing protein OS=Trypanosoma congolense (strain IL3000) OX=1068625 GN=TCIL3000_11_1730 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 4.864e-11
Identity = 63/230 (27.39%), Postives = 107/230 (46.52%), Query Frame = 2
Query: 1067 RPVSEYIELRNEYS---SQLXXXXXXXXXXXXAPFLTLLLTQGT-----VLDAKCEIAQKLGVSIKDLYCINHWNHDKAEEDKIYKEGF------YMFEIIKSMENMNLGKEFGAGGFGRVFFYQDIISGKQL-AMKTA--NSDKSSLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEAL-RISYQILIQIEKLHELKIIHRDIK 1702
            R +SE +E R  Y    ++   + +  +     P L  +L  G+       + K E++  LG+S +     +  N      D  + E        Y F+IIK           GAGGFG V  YQ ++S  QL A+K     S   ++ R++ + + +  N    +Y G  + ++  YI M Y++GGS+  +I+   G FE+ A+ R    +L  ++ +H+  I+HRDIK
Sbjct:  122 RDLSEAVEGRGRYDDILAEATGRQVSGRLLESEPALPCVLESGSRGSGEADEGKVELSSTLGISTEPTS-TSQRNSSNLPVDPTHGEAAEVKPRQYKFKIIK---------RLGAGGFGTV--YQAMLSNGQLVAVKVMQMTSKPKAIDREVHVLSSLPPNPHCVRYLGSTRSRNHYYIIMEYISGGSI-KFIRKSTGRFEEAAMQRCVKMVLEGLKHMHQHNIVHRDIK 338          

HSP 2 Score: 28.4906 bits (62), Expect = 4.864e-11
Identity = 14/29 (48.28%), Postives = 18/29 (62.07%), Query Frame = 1
Query: 1750 ADNIVFDGAGNAKLIDFGLSKWMK--NST 1830
             DN++ D  G AK++DFG  K M   NST
Sbjct:  339 GDNVLLDEKGCAKIVDFGSCKVMNHVNST 367          
BLAST of Protein kinase domain containing protein vs. TrEMBL
Match: A0A078B1I8 (Protein kinase domain containing protein OS=Stylonychia lemnae OX=5949 GN=Contig16599.g17674 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.658e-11
Identity = 44/128 (34.38%), Postives = 69/128 (53.91%), Query Frame = 2
Query: 1349 LGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL------IMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIKRLGL 1714
            LG++ G G FG+V     +++G+++A+K    DK +   D+   A       I+ +  + +   + +   ELY+ M Y  GG L  +I  +K L EKEA R  +QI+  IE LH+L I HRD+K   L
Sbjct:   50 LGRDLGKGTFGKVKVGTHVLTGEKVAVKILEKDKIADVSDVERVAREIHILKIVRHPHVVQLYEIIETSKELYLMMEYARGGELFEHIVHRKRLREKEASRFLHQIISGIEYLHKLGICHRDLKPENL 177          

HSP 2 Score: 28.1054 bits (61), Expect = 5.658e-11
Identity = 11/25 (44.00%), Postives = 17/25 (68.00%), Query Frame = 1
Query: 1753 DNIVFDGAGNAKLIDFGLSKWMKNS 1827
            +N++ D   N K++DFGLS   KN+
Sbjct:  175 ENLLMDEHNNVKIVDFGLSNTYKNN 199          
BLAST of Protein kinase domain containing protein vs. Ensembl Cavefish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:103026704])

HSP 1 Score: 65.4698 bits (158), Expect = 5.334e-13
Identity = 45/135 (33.33%), Postives = 66/135 (48.89%), Query Frame = 2
Query: 1328 KSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL-----IMNN---SELFKYSGLFK--YKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            ++  N  LGK  G G FGRVF   D  +G++LA+K    D  S      +SAL     ++ N     + +Y G  +  ++  L I M YM GGS+   ++    L E    + + QIL  +  LH   I+HRDIK
Sbjct:  354 RAPTNWRLGKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVSALECEIQLLKNLFHERIVQYYGCLRDTHERTLSIFMEYMPGGSIKDQLKSYGALTENVTRKYTRQILEGVCYLHSNMIVHRDIK 488          

HSP 2 Score: 28.8758 bits (63), Expect = 5.334e-13
Identity = 12/23 (52.17%), Postives = 16/23 (69.57%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D AGN KL DFG S+ ++ 
Sbjct:  491 NILRDSAGNVKLGDFGASRRLQT 513          
BLAST of Protein kinase domain containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 60.8474 bits (146), Expect = 6.251e-12
Identity = 41/127 (32.28%), Postives = 62/127 (48.82%), Query Frame = 2
Query: 1352 GKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL--------IMNNSELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            GK  G G FGRV+   D+ +G++LA K    D +S      +S L         +++  + +Y G  +  +E  L I M YM GGS+   ++    L E    + + QIL  +  LH   I+HRDIK
Sbjct:  359 GKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEIQLLKNLHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIK 485          

HSP 2 Score: 29.6462 bits (65), Expect = 6.251e-12
Identity = 13/23 (56.52%), Postives = 16/23 (69.57%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D AGN KL DFG SK ++ 
Sbjct:  488 NILRDSAGNVKLGDFGASKRLQT 510          
BLAST of Protein kinase domain containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 60.8474 bits (146), Expect = 6.251e-12
Identity = 41/127 (32.28%), Postives = 62/127 (48.82%), Query Frame = 2
Query: 1352 GKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL--------IMNNSELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            GK  G G FGRV+   D+ +G++LA K    D +S      +S L         +++  + +Y G  +  +E  L I M YM GGS+   ++    L E    + + QIL  +  LH   I+HRDIK
Sbjct:  359 GKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEIQLLKNLHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIK 485          

HSP 2 Score: 29.6462 bits (65), Expect = 6.251e-12
Identity = 13/23 (56.52%), Postives = 16/23 (69.57%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D AGN KL DFG SK ++ 
Sbjct:  488 NILRDSAGNVKLGDFGASKRLQT 510          
BLAST of Protein kinase domain containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 60.8474 bits (146), Expect = 6.251e-12
Identity = 41/127 (32.28%), Postives = 62/127 (48.82%), Query Frame = 2
Query: 1352 GKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL--------IMNNSELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            GK  G G FGRV+   D+ +G++LA K    D +S      +S L         +++  + +Y G  +  +E  L I M YM GGS+   ++    L E    + + QIL  +  LH   I+HRDIK
Sbjct:  359 GKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEIQLLKNLHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIK 485          

HSP 2 Score: 29.6462 bits (65), Expect = 6.251e-12
Identity = 13/23 (56.52%), Postives = 16/23 (69.57%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D AGN KL DFG SK ++ 
Sbjct:  488 NILRDSAGNVKLGDFGASKRLQT 510          
BLAST of Protein kinase domain containing protein vs. Ensembl Cavefish
Match: prkaa1 (protein kinase AMP-activated catalytic subunit alpha 1 [Source:NCBI gene;Acc:103022500])

HSP 1 Score: 57.7658 bits (138), Expect = 1.357e-10
Identity = 38/127 (29.92%), Postives = 65/127 (51.18%), Query Frame = 2
Query: 1349 LGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISALI---MNNSELFKYSGLFK------YKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            LG   G G FG+V   Q  ++  Q+A+K  N  K    R + +   I   + N +LF++  + K        +++++ M Y++GG L  YI     L EKE+ R+  QI+  ++  H   ++HRD+K
Sbjct:   19 LGDTLGVGTFGKVKVGQHELTKHQVAVKILNRQK---IRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMVMEYVSGGELFDYICKNGKLDEKESRRLFQQIISAVDYCHRHMVVHRDLK 142          

HSP 2 Score: 28.1054 bits (61), Expect = 1.357e-10
Identity = 11/25 (44.00%), Postives = 16/25 (64.00%), Query Frame = 1
Query: 1750 ADNIVFDGAGNAKLIDFGLSKWMKN 1824
             +N++ D   NAK+ DFGLS  M +
Sbjct:  143 PENVLLDAHMNAKIADFGLSNMMSD 167          
BLAST of Protein kinase domain containing protein vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 62.003 bits (149), Expect = 2.381e-12
Identity = 41/135 (30.37%), Postives = 64/135 (47.41%), Query Frame = 2
Query: 1328 KSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL--------IMNNSELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            ++  N   GK  G G FGRV+   D  +G++LA+K    D  S+     ++AL         + +  + +Y G  +   +  L I M YM GGS+   ++    L E    + + QIL  +  LH   I+HRDIK
Sbjct:  354 RAPTNWQRGKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPGSVETSKEVNALECEIQLLKNLQHERIVQYFGCLRDPQQKTLSIFMEYMPGGSIKDQLRAYGALTENVTRKYTRQILEGVSFLHGNMIVHRDIK 488          

HSP 2 Score: 27.7202 bits (60), Expect = 2.381e-12
Identity = 12/23 (52.17%), Postives = 15/23 (65.22%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D  GN KL DFG SK ++ 
Sbjct:  491 NILRDSTGNVKLGDFGASKRLQT 513          
BLAST of Protein kinase domain containing protein vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 56.6102 bits (135), Expect = 2.798e-9
Identity = 45/178 (25.28%), Postives = 84/178 (47.19%), Query Frame = 2
Query: 1187 TVLDAKCEIAQKLGVSIKDLYCINHWNHDKAEEDKIYKEGFYMFEIIKSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTAN------SDKSSLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
             V D   E+  K G S++   C +  ++  + ED     G       + + N  L K  G G F +V   +  ++G+++A+K  +      S    L+R++ I   ++N+  + K   + + +  LY+ M Y +GG +  Y+     + EKEA     QI+  ++  H+  I+HRD+K
Sbjct:   26 AVGDGPAEVGNKAGQSLR---CRSPLSN--SAEDAQPPSG-----QTQRVGNYRLLKTIGKGNFAKVKLAKHTLTGQEVAVKIIDKTQLNTSSLQKLFREVRIMK-VLNHPNIVKLFEVIEMEKTLYLVMEYSSGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLK 192          

HSP 2 Score: 22.7126 bits (47), Expect = 2.798e-9
Identity = 9/20 (45.00%), Postives = 13/20 (65.00%), Query Frame = 1
Query: 1750 ADNIVFDGAGNAKLIDFGLS 1809
            A+N++ D   N K+ DFG S
Sbjct:  193 AENLLLDADMNIKIADFGFS 212          
BLAST of Protein kinase domain containing protein vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 53.1434 bits (126), Expect = 9.989e-9
Identity = 34/122 (27.87%), Postives = 63/122 (51.64%), Query Frame = 2
Query: 1355 KEFGAGGFGRVFFYQDIISGKQLAMKTAN------SDKSSLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            K  G G F +V   +  ++G+++A+K  +      S    L+R++ I   I+N+  + K   + + +  LY+ M Y +GG +  Y+     + EKEA     QI+  ++  H+  I+HRD+K
Sbjct:   58 KTIGKGNFAKVKLARHTLTGREVAVKIIDKTQLNPSSLQKLFREVRI-MKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLK 178          

HSP 2 Score: 23.8682 bits (50), Expect = 9.989e-9
Identity = 9/20 (45.00%), Postives = 13/20 (65.00%), Query Frame = 1
Query: 1750 ADNIVFDGAGNAKLIDFGLS 1809
            A+N++ D   N K+ DFG S
Sbjct:  179 AENLLLDADMNIKIADFGFS 198          
BLAST of Protein kinase domain containing protein vs. Ensembl Sea Lamprey
Match: stk33 (serine/threonine kinase 33 [Source:ZFIN;Acc:ZDB-GENE-040724-242])

HSP 1 Score: 55.8398 bits (133), Expect = 1.066e-8
Identity = 32/125 (25.60%), Postives = 64/125 (51.20%), Query Frame = 2
Query: 1346 NLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSS------LYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
             LG++ G+G FG V+    + +G + A+KT N +++       L R++ I   + + + +     + +    +Y+ M     G L + ++ +K L E EA  +++ +   I  LH+  I+HRD+K
Sbjct:    6 RLGRQLGSGSFGTVYEATHVETGVKWAIKTVNKERAGSSGVRLLEREVVILKRVQHQN-IIHLEEVLETHKRVYLVMELCELGELRAVLEQRKRLSEAEARHVAHSLAGAIAYLHKHDIVHRDLK 129          
BLAST of Protein kinase domain containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006410.1 (pep scaffold:Pmarinus_7.0:GL476370:17405:31068:-1 gene:ENSPMAG00000005688.1 transcript:ENSPMAT00000006410.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 4.280e-8
Identity = 36/134 (26.87%), Postives = 68/134 (50.75%), Query Frame = 2
Query: 1319 EIIKSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDK------SSLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            E +  + N  L K  G G F +V   + I++G+++A+K  +  +        L+R++ I    +N+  + K   + + +  LY+ M Y +GG +  Y+     + EKEA     QI+  ++  H+  I+HRD+K
Sbjct:   31 EELPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRI-MKCLNHPNIVKLYEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKNIVHRDLK 163          
BLAST of Protein kinase domain containing protein vs. Ensembl Yeast
Match: SSK2 (MAP kinase kinase kinase of HOG1 mitogen-activated signaling pathway; interacts with Ssk1p, leading to autophosphorylation and activation of Ssk2p which phosphorylates Pbs2p; also mediates actin cytoskeleton recovery from osmotic stress; a HOG-independent function of Ssk2p mediates the calcium-sensitive phenotype of the ptp2 msg5 double disruptant; SSK2 has a paralog, SSK22, that arose from the whole genome duplication [Source:SGD;Acc:S000005314])

HSP 1 Score: 59.3066 bits (142), Expect = 2.937e-10
Identity = 45/144 (31.25%), Postives = 75/144 (52.08%), Query Frame = 2
Query: 1310 YMFEIIKSMENMNLGKE----FGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIF------ISAL-IMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISY--QILIQIEKLHELKIIHRDIK 1702
            Y+  +  S+ N+++  +     G G FGRV+   D+ +G+ LA+K  N   S   + IF      +S L I+N+  +  Y G+  ++ ++ I M Y  GGSL + ++   G  E E +   Y  Q+L  +  LHE  I+HRD+K
Sbjct: 1251 YLVSLASSISNVSMRWQKRNFIGGGTFGRVYSAVDLDNGEILAVKEINIQDSKSMQKIFPLIKEEMSVLEILNHPNIVSYYGVEVHRDKVNIFMEYCEGGSLAALLE--HGRIEDEMVTQVYTLQLLEGLAYLHESGIVHRDVK 1392          

HSP 2 Score: 22.3274 bits (46), Expect = 2.937e-10
Identity = 10/25 (40.00%), Postives = 15/25 (60.00%), Query Frame = 1
Query: 1750 ADNIVFDGAGNAKLIDFGLSKWMKN 1824
             +NI+ D  G  K +DFG +K + N
Sbjct: 1393 PENILLDFNGVIKYVDFGAAKKIAN 1417          
BLAST of Protein kinase domain containing protein vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 51.2174 bits (121), Expect = 1.577e-8
Identity = 39/123 (31.71%), Postives = 60/123 (48.78%), Query Frame = 2
Query: 1352 GKEFGAGGFGRVFFYQDIISGKQLAMKTAN--SDKSSLYRDIFISAL----IMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            G   G GGF R F  +D  SG+  A KT    S KS   R   +S +     M++  + ++   F+  S +YI +     GSL   ++ +K L E E    + QI   I+ +H  ++IHRD+K
Sbjct:   85 GHFLGEGGFARCFQIKDD-SGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFTTQICGAIKYMHSRRVIHRDLK 206          

HSP 2 Score: 24.6386 bits (52), Expect = 1.577e-8
Identity = 11/27 (40.74%), Postives = 16/27 (59.26%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKNSTDE 1836
            NI FD   N K+ DFGL+  + N ++ 
Sbjct:  209 NIFFDSNYNLKIGDFGLAAVLANESER 235          
BLAST of Protein kinase domain containing protein vs. Ensembl Yeast
Match: CBK1 (Serine/threonine protein kinase of the the RAM signaling network; Ndr/LATS family member; binds regulatory subunit Mob2p; involved in regulation of cellular morphogenesis, polarized growth, and septum destruction; phosphorylation by Cbk1p regulates localization and activity of Ace2p transcription factor and Ssd1p translational repressor; Cbk1p activity is regulated by both phosphorylation and specific localization; relocalizes to cytoplasm upon DNA replication stress [Source:SGD;Acc:S000005105])

HSP 1 Score: 40.817 bits (94), Expect = 9.819e-8
Identity = 42/134 (31.34%), Postives = 63/134 (47.01%), Query Frame = 2
Query: 1337 ENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLY-----------RDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRI-SYQILIQIEKLHELKIIHRDIK 1702
            E+ +  K  G G FG V   Q   +GK  AMKT    KS +Y           RD+   +       L+ YS  F+    LY+ M ++ GG L + +  +  LF ++  R    + ++ IE +H+L  IHRDIK
Sbjct:  350 EDFHTVKVIGKGAFGEVRLVQKKDTGKIYAMKTL--LKSEMYKKDQLAHVKAERDVLAGSDSPWVVSLY-YS--FQDAQYLYLIMEFLPGGDLMTMLI-RWQLFTEDVTRFYMAECILAIETIHKLGFIHRDIK 477          

HSP 2 Score: 32.3426 bits (72), Expect = 9.819e-8
Identity = 16/34 (47.06%), Postives = 20/34 (58.82%), Query Frame = 1
Query: 1753 DNIVFDGAGNAKLIDFGLSKWMKNSTDENILEKL 1854
            DNI+ D  G+ KL DFGLS     + D N  +KL
Sbjct:  479 DNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKL 512          
BLAST of Protein kinase domain containing protein vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 46.595 bits (109), Expect = 1.551e-7
Identity = 36/130 (27.69%), Postives = 67/130 (51.54%), Query Frame = 2
Query: 1352 GKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISALIMNNSE-----------LFKYSGLFKYKSELY-IAMPYMTGGSLTSYIQGKKGLFEKEALR-ISYQILIQIEKLHELKIIHRDIK 1702
            G+  G G FG V+   ++ +G+ +A+K     K S   +  +S +    SE           + +Y G F+ K+ +Y + + Y+ GGS+ S I+   G F++  ++ ++ Q+L  +  LH   I+HRD+K
Sbjct: 1178 GEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNIVQYLG-FENKNNIYSLFLEYVAGGSVGSLIR-MYGRFDEPLIKHLTTQVLKGLAYLHSKGILHRDMK 1305          

HSP 2 Score: 25.7942 bits (55), Expect = 1.551e-7
Identity = 11/25 (44.00%), Postives = 17/25 (68.00%), Query Frame = 1
Query: 1750 ADNIVFDGAGNAKLIDFGLSKWMKN 1824
            ADN++ D  G  K+ DFG+S+  K+
Sbjct: 1306 ADNLLLDQDGICKISDFGISRKSKD 1330          
BLAST of Protein kinase domain containing protein vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 48.1358 bits (113), Expect = 2.256e-7
Identity = 37/119 (31.09%), Postives = 63/119 (52.94%), Query Frame = 2
Query: 1361 FGAGGFGRVFFYQDIISGKQLAMKTANSDKSS-----LYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
             G G FG V+   ++ +G+  A+K  N D  S     + R+I   A +   S + +Y G +   + L+I M +  GGSL S ++  K + EK    I  ++L+ ++ +H+  +IHRDIK
Sbjct:   29 IGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISNITRYYGSYLKDTSLWIIMEHCAGGSLRSLLRPGK-IDEKYIGVIMRELLVALKCIHKDNVIHRDIK 146          

HSP 2 Score: 23.8682 bits (50), Expect = 2.256e-7
Identity = 9/27 (33.33%), Postives = 16/27 (59.26%), Query Frame = 1
Query: 1750 ADNIVFDGAGNAKLIDFGLSKWMKNST 1830
            A N++    GN KL DFG++  +  ++
Sbjct:  147 AANVLITNEGNVKLCDFGVAAQVNQTS 173          
BLAST of Protein kinase domain containing protein vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 65.0846 bits (157), Expect = 1.463e-12
Identity = 45/133 (33.83%), Postives = 68/133 (51.13%), Query Frame = 2
Query: 1334 MENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDK--SSLYRDI--------FISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            M N   GK  GAG FG+V+   D+ +G++LA+K   + +  SS   ++        F+ A    N  + +Y G+      +YI M Y+ GGS+  +I+    L E    + S QIL  I  LH  +I+HRDIK
Sbjct:    1 MNNWRKGKLLGAGAFGQVYMCHDLDTGRELAVKQIETGQLNSSTKNEVKALEGEIEFMKAF--RNERIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIK 131          

HSP 2 Score: 25.7942 bits (55), Expect = 1.463e-12
Identity = 12/23 (52.17%), Postives = 15/23 (65.22%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D  GN KL DFG SK ++ 
Sbjct:  134 NILRDLYGNVKLADFGASKRLQT 156          
BLAST of Protein kinase domain containing protein vs. Ensembl Nematostella
Match: EDO36169 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJE6])

HSP 1 Score: 59.3066 bits (142), Expect = 2.485e-9
Identity = 37/130 (28.46%), Postives = 67/130 (51.54%), Query Frame = 2
Query: 1331 SMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISALIMNNSELFKYSGLFK------YKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            ++ N NLG+  G G FG+V      ++G ++A+K  N +K      +      + N +LF++  + K        +++++ M Y++GG L  YI     L EK+A R   QI+  ++  H   ++HRD+K
Sbjct:   16 AIGNYNLGETLGVGTFGKVKLAVHQLTGHKVAIKILNRNKIKSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMVMEYVSGGELFEYILKHGKLEEKDARRFFQQIISGVDYCHRHMVVHRDLK 145          
BLAST of Protein kinase domain containing protein vs. Ensembl Nematostella
Match: EDO37677 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF23])

HSP 1 Score: 51.2174 bits (121), Expect = 8.385e-9
Identity = 38/134 (28.36%), Postives = 59/134 (44.03%), Query Frame = 2
Query: 1331 SMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKS---------SLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRIS-YQILIQIEKLHELKIIHRDIK 1702
            S  + N+    G G FG V   +D  +G   AMKT    ++            R+I  +A   NN  +      F+    LY+ M Y  GG L S +     +FE++  R    +I++ I  LH +  +HRD+K
Sbjct:   78 SKNDFNVVNTIGRGHFGEVQVVKDKATGDVYAMKTLKKSQTLSEEAVAFFEEEREIMATA---NNPWITSLQYAFQDSHSLYLVMDYHPGGDLLSLLSKYDDIFEEDMARFYLAEIVMAIHSLHTMGFVHRDVK 208          

HSP 2 Score: 26.9498 bits (58), Expect = 8.385e-9
Identity = 13/37 (35.14%), Postives = 20/37 (54.05%), Query Frame = 1
Query: 1750 ADNIVFDGAGNAKLIDFGLSKWMKNSTDENILEKLKA 1860
             DN++ D  G+ KL DFG S  +  S D+ +  K+  
Sbjct:  209 PDNVLIDRTGHIKLADFGSSARL--SADKKVFSKMPV 243          
BLAST of Protein kinase domain containing protein vs. Ensembl Nematostella
Match: EDO40703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6E0])

HSP 1 Score: 55.4546 bits (132), Expect = 1.884e-8
Identity = 35/123 (28.46%), Postives = 59/123 (47.97%), Query Frame = 2
Query: 1352 GKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSS------LYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            G+  G G FG V   + I +G + A+K  N +K+       L R++ I   I +   L     +++    +Y+ M     G L   ++ KK   EKE   +  Q++  +  LH+L I+HRD+K
Sbjct:   30 GQVLGRGSFGVVNEAKHIETGTRWAIKAVNKEKAGSSAVKLLEREVMIMKKIYHE-HLIHLEEIYETSKRMYLVMELCDAGGLDKMLERKKRFTEKETWTVIKQLVSAVAYLHDLDIVHRDLK 151          
BLAST of Protein kinase domain containing protein vs. Ensembl Nematostella
Match: EDO30768 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZV3])

HSP 1 Score: 51.6026 bits (122), Expect = 9.160e-8
Identity = 33/122 (27.05%), Postives = 61/122 (50.00%), Query Frame = 2
Query: 1355 KEFGAGGFGRVFFYQDIISGKQLAMKTAN------SDKSSLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            K  G G F +V   + + +GK++A+K  +      S    L+R++ I    +++  + K   + +    LY+ M Y +GG +  Y+     + EKEA     QI+  ++  H+  +IHRD+K
Sbjct:   42 KTIGKGNFAKVKLAKHVPTGKEVAIKIIDKTQLNPSSLQKLFREVRIMKF-LDHPNIVKLYEVIETDKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHVIHRDLK 162          

HSP 2 Score: 23.0978 bits (48), Expect = 9.160e-8
Identity = 9/20 (45.00%), Postives = 13/20 (65.00%), Query Frame = 1
Query: 1750 ADNIVFDGAGNAKLIDFGLS 1809
            A+N++ D   N K+ DFG S
Sbjct:  163 AENLLLDADMNIKIADFGFS 182          
BLAST of Protein kinase domain containing protein vs. Ensembl Medaka
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:101160297])

HSP 1 Score: 63.929 bits (154), Expect = 4.906e-12
Identity = 45/135 (33.33%), Postives = 65/135 (48.15%), Query Frame = 2
Query: 1328 KSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL-----IMNN---SELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            ++  N  LGK  G G FGRV+   D  +G++LA+K    D  S      +SAL     ++ N     + +Y G  +   E  L I M +M GGS+   ++    L E    R + QIL  +  LH   I+HRDIK
Sbjct:  384 RAPTNWRLGKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPESPETSKEVSALECEIQLLKNLCHERIVQYYGCLRDTMERTLSIFMEHMPGGSIKDQLKSYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIK 518          

HSP 2 Score: 26.9498 bits (58), Expect = 4.906e-12
Identity = 11/23 (47.83%), Postives = 15/23 (65.22%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D  GN KL DFG S+ ++ 
Sbjct:  521 NILRDSVGNVKLGDFGASRRLQT 543          
BLAST of Protein kinase domain containing protein vs. Ensembl Medaka
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101169290])

HSP 1 Score: 59.6918 bits (143), Expect = 1.284e-11
Identity = 42/127 (33.07%), Postives = 61/127 (48.03%), Query Frame = 2
Query: 1352 GKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL--------IMNNSELFKYSGLFKYKSE--LYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            GK  G G FG V+   D+ +G++LA K    D  S      +SAL         +++  + +Y G  +  SE  L I M YM GGS+   ++    L E    + + QIL  +  LH   I+HRDIK
Sbjct:  356 GKLLGQGAFGLVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEIQLLKNLHHERIVQYYGCLRDHSEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIK 482          

HSP 2 Score: 29.6462 bits (65), Expect = 1.284e-11
Identity = 13/23 (56.52%), Postives = 16/23 (69.57%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D AGN KL DFG SK ++ 
Sbjct:  485 NILRDSAGNVKLGDFGASKRLQT 507          
BLAST of Protein kinase domain containing protein vs. Ensembl Medaka
Match: prkaa1 (protein kinase AMP-activated catalytic subunit alpha 1 [Source:NCBI gene;Acc:101162057])

HSP 1 Score: 58.151 bits (139), Expect = 1.050e-10
Identity = 38/127 (29.92%), Postives = 65/127 (51.18%), Query Frame = 2
Query: 1349 LGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISALI---MNNSELFKYSGLFK------YKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            LG   G G FG+V   Q  ++  Q+A+K  N  K    R + +   I   + N +LF++  + K        +++++ M Y++GG L  YI     L EKE+ R+  QI+  ++  H   ++HRD+K
Sbjct:   19 LGDTLGVGTFGKVKVGQHELTKHQVAVKILNRQK---IRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMVMEYVSGGELFDYICKNGKLDEKESRRLFQQIISAVDYCHRHMVVHRDLK 142          

HSP 2 Score: 28.4906 bits (62), Expect = 1.050e-10
Identity = 11/25 (44.00%), Postives = 16/25 (64.00%), Query Frame = 1
Query: 1750 ADNIVFDGAGNAKLIDFGLSKWMKN 1824
             +N++ D   NAK+ DFGLS  M +
Sbjct:  143 PENVLLDAHMNAKIADFGLSNMMSD 167          
BLAST of Protein kinase domain containing protein vs. Ensembl Medaka
Match: chek1 (checkpoint kinase 1 [Source:NCBI gene;Acc:101170780])

HSP 1 Score: 56.9954 bits (136), Expect = 7.621e-10
Identity = 33/128 (25.78%), Postives = 71/128 (55.47%), Query Frame = 2
Query: 1334 MENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKS-----SLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            +++ ++ +  G G +G V    +  + + +A+K  ++ ++     ++ ++I I   I+N+  + ++ G  +  + +Y+ + Y TGG L   I+   G+ E++A R   Q++  +E LH+L I HRDIK
Sbjct:    6 VQDWDVVQTLGEGAYGEVRLLVNRQTEEAVAVKVIDTSQAEECAENVKKEICIHK-ILNHCNIVRFFGHRREGTTVYLFLEYCTGGELFDRIEPDVGMPERDAHRFFQQLIAAVEYLHKLGITHRDIK 132          

HSP 2 Score: 26.1794 bits (56), Expect = 7.621e-10
Identity = 13/35 (37.14%), Postives = 18/35 (51.43%), Query Frame = 1
Query: 1750 ADNIVFDGAGNAKLIDFGLSKWMKNSTDENILEKL 1854
             +NI+ D   N KL DFGL+   +    E  L +L
Sbjct:  133 PENILLDDKDNLKLTDFGLATMFRFKGRERRLNRL 167          
BLAST of Protein kinase domain containing protein vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 54.6842 bits (130), Expect = 1.606e-9
Identity = 39/131 (29.77%), Postives = 60/131 (45.80%), Query Frame = 2
Query: 1340 NMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISAL--------IMNNSELFKYSGLFKY--KSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            N   GK  G G FG V+   D  +G++LA K    D         ++AL         + +  + +Y G  +   + +L I + +M GGS+   ++    L EK   R + QIL  +  LH   I+HRDIK
Sbjct:  326 NWRQGKLLGRGAFGEVYLCYDADTGRELAAKQVPFDPDCQETSKEVNALECEIQLLKNLRHDRIVQYYGCLRDLDQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVSYLHSNMIVHRDIK 456          

HSP 2 Score: 27.7202 bits (60), Expect = 1.606e-9
Identity = 12/23 (52.17%), Postives = 16/23 (69.57%), Query Frame = 1
Query: 1756 NIVFDGAGNAKLIDFGLSKWMKN 1824
            NI+ D +GN KL DFG SK ++ 
Sbjct:  459 NILRDSSGNVKLGDFGASKRIQT 481          
BLAST of Protein kinase domain containing protein vs. Planmine SMEST
Match: SMESG000024532.1 (SMESG000024532.1)

HSP 1 Score: 1078.93 bits (2789), Expect = 0.000e+0
Identity = 544/544 (100.00%), Postives = 544/544 (100.00%), Query Frame = 2
Query:   71 MKISVVNGENLSVKFVIEIDKHSYVGDIKHKIDKILNGQGKWEKEHLRFIYKNIILHDEYIKRYKVCESDEIWFGKIENYLRSDDVIIEVFLAGCSPVLIWLIVKINHSITVIRSMIEIVQSKLINIYDWNGREMQNVQIVSDIDPIGYYRLIVSYEDERGKWLSFEDCVRQHDEFTFRFCLNSEFEFEDMTEINTVNLINKIRTIMSLNDVIDARLKENLSNIPSGVVNSKLLFYYNIQLRILDICQEFWKSTKDSPYYINYNIIKSFELSILVALHQYSHSRQKDPENKDKSFNGIVIDALDYLVKHLHDHCKDLKYHQKLFFDHFLLVPRPVSEYIELRNEYSSQLXXXXXXXXXXXXAPFLTLLLTQGTVLDAKCEIAQKLGVSIKDLYCINHWNHDKAEEDKIYKEGFYMFEIIKSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            MKISVVNGENLSVKFVIEIDKHSYVGDIKHKIDKILNGQGKWEKEHLRFIYKNIILHDEYIKRYKVCESDEIWFGKIENYLRSDDVIIEVFLAGCSPVLIWLIVKINHSITVIRSMIEIVQSKLINIYDWNGREMQNVQIVSDIDPIGYYRLIVSYEDERGKWLSFEDCVRQHDEFTFRFCLNSEFEFEDMTEINTVNLINKIRTIMSLNDVIDARLKENLSNIPSGVVNSKLLFYYNIQLRILDICQEFWKSTKDSPYYINYNIIKSFELSILVALHQYSHSRQKDPENKDKSFNGIVIDALDYLVKHLHDHCKDLKYHQKLFFDHFLLVPRPVSEYIELRNEYSSQLITKIIINKKDNIAPFLTLLLTQGTVLDAKCEIAQKLGVSIKDLYCINHWNHDKAEEDKIYKEGFYMFEIIKSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK
Sbjct:    1 MKISVVNGENLSVKFVIEIDKHSYVGDIKHKIDKILNGQGKWEKEHLRFIYKNIILHDEYIKRYKVCESDEIWFGKIENYLRSDDVIIEVFLAGCSPVLIWLIVKINHSITVIRSMIEIVQSKLINIYDWNGREMQNVQIVSDIDPIGYYRLIVSYEDERGKWLSFEDCVRQHDEFTFRFCLNSEFEFEDMTEINTVNLINKIRTIMSLNDVIDARLKENLSNIPSGVVNSKLLFYYNIQLRILDICQEFWKSTKDSPYYINYNIIKSFELSILVALHQYSHSRQKDPENKDKSFNGIVIDALDYLVKHLHDHCKDLKYHQKLFFDHFLLVPRPVSEYIELRNEYSSQLITKIIINKKDNIAPFLTLLLTQGTVLDAKCEIAQKLGVSIKDLYCINHWNHDKAEEDKIYKEGFYMFEIIKSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 544          

HSP 2 Score: 80.1073 bits (196), Expect = 2.401e-15
Identity = 38/39 (97.44%), Postives = 38/39 (97.44%), Query Frame = 1
Query: 1750 ADNIVFDGAGNAKLIDFGLSKWMKNSTDENILEKLKAYA 1866
             DNIVFDGAGNAKLIDFGLSKWMKNSTDENILEKLKAYA
Sbjct:  545 PDNIVFDGAGNAKLIDFGLSKWMKNSTDENILEKLKAYA 583          
BLAST of Protein kinase domain containing protein vs. Planmine SMEST
Match: SMESG000024532.1 (SMESG000024532.1)

HSP 1 Score: 832.402 bits (2149), Expect = 0.000e+0
Identity = 424/432 (98.15%), Postives = 427/432 (98.84%), Query Frame = 2
Query:   71 MKISVVNGENLSVKFVIEIDKHSYVGDIKHKIDKILNGQGKWEKEHLRFIYKNIILHDEYIKRYKVCESDEIWFGKIENYLRSDDVIIEVFLAGCSPVLIWLIVKINHSITVIRSMIEIVQSKLINIYDWNGREMQNVQIVSDIDPIGYYRLIVSYEDERGKWLSFEDCVRQHDEFTFRFCLNSEFEFEDMTEINTVNLINKIRTIMSLNDVIDARLKENLSNIPSGVVNSKLLFYYNIQLRILDICQEFWKSTKDSPYYINYNIIKSFELSILVALHQYSHSRQKDPENKDKSFNGIVIDALDYLVKHLHDHCKDLKYHQKLFFDHFLLVPRPVSEYIELRNEYSSQLXXXXXXXXXXXXAPFLTLLLTQGTVLDAKCEIAQKLGVSIKDLYCINHWNHDKAEEDKIYKEGFYMFEIIKSMENMNLGKEFG 1366
            MKISVVNGENLSVKFVIEIDKHSYVGDIKHKIDKILNGQGKWEKEHLRFIYKNIILHDEYIKRYKVCESDEIWFGKIENYLRSDDVIIEVFLAGCSPVLIWLIVKINHSITVIRSMIEIVQSKLINIYDWNGREMQNVQIVSDIDPIGYYRLIVSYEDERGKWLSFEDCVRQHDEFTFRFCLNSEFEFEDMTEINTVNLINKIRTIMSLNDVIDARLKENLSNIPSGVVNSKLLFYYNIQLRILDICQEFWKSTKDSPYYINYNIIKSFELSILVALHQYSHSRQKDPENKDKSFNGIVIDALDYLVKHLHDHCKDLKYHQKLFFDHFLLVPRPVSEYIELRNEYSSQLITKIIINKKDNIAPFLTLLLTQGTVLDAKCEIAQKLGVSIKDLYCINHWNHDKAEEDKIYKEGFYMFEIIKS+++     EFG
Sbjct:    1 MKISVVNGENLSVKFVIEIDKHSYVGDIKHKIDKILNGQGKWEKEHLRFIYKNIILHDEYIKRYKVCESDEIWFGKIENYLRSDDVIIEVFLAGCSPVLIWLIVKINHSITVIRSMIEIVQSKLINIYDWNGREMQNVQIVSDIDPIGYYRLIVSYEDERGKWLSFEDCVRQHDEFTFRFCLNSEFEFEDMTEINTVNLINKIRTIMSLNDVIDARLKENLSNIPSGVVNSKLLFYYNIQLRILDICQEFWKSTKDSPYYINYNIIKSFELSILVALHQYSHSRQKDPENKDKSFNGIVIDALDYLVKHLHDHCKDLKYHQKLFFDHFLLVPRPVSEYIELRNEYSSQLITKIIINKKDNIAPFLTLLLTQGTVLDAKCEIAQKLGVSIKDLYCINHWNHDKAEEDKIYKEGFYMFEIIKSIQHGEY--EFG 430          
BLAST of Protein kinase domain containing protein vs. Planmine SMEST
Match: SMESG000024565.1 (SMESG000024565.1)

HSP 1 Score: 367.466 bits (942), Expect = 6.197e-118
Identity = 225/570 (39.47%), Postives = 334/570 (58.60%), Query Frame = 2
Query:   71 MKISVVNGENLSVKFVIEIDKHSYVGDIKHKIDKILNGQGKWEKEHLRFIYKNIILHDE-YIKRYKVCESDEIWFGKIENYLRSDDVIIEVFLAGCSPVLIWLIVKINHSITVIRSMIEIVQSKLINIYDWNGREMQNVQIVSDIDPIGYYRLIVSYEDERGKWLSFEDCVRQHDEFT----FRFCLNSEFEFEDM--TEINTV-NLINKIRTIMSLNDVIDARLKENLSNIPSGVVNSKLLFYYNIQLRILDICQEFWKSTKDSPYYINYNIIKSF-ELSILVALHQYSHSRQKDPENKDKSFNGIVIDALDYLV------KHLHDHCKDLKYHQKL-----------FFDHFLLVPRPVSEYIELRNEYSSQLXXXXXXXXXXXXAPFLTLLLTQGTVLDAKCEIAQKLGVSIKDLYCINHWNHDKAEEDKIYKEGFYMFEIIKSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            MKI V+  EN  +K  I+++++S V +I++K+DKI  G+ KW K  ++ ++KNII+ DE  I  YK+CE DEI   +IENYL SDDVI+EVFL+G  P +I+LIV+ N+SI+ I+SMIE +Q ++INI D+ G +M   Q V++     YYRLIV Y  +     +FEDC++Q+ +F     + F L     +E +  T IN V   +N+I+ IM  ND  + RLKENLS  PS  +    +F  +I  RI DIC ++W+ +++      + +I  F  +++L+ LHQY    +   E   K+FN IV+DAL Y V      + +   C+   Y   L           + D FL   R  SE+ E+ N Y ++    +          F +      T+++AK  +AQK GV + DLY I   N DK  + + Y E    F ++ +MEN +  KEF  G FG+VF  QD IS ++L +K +   + SL+RDIFI   + N+S+LF+YS + K    + +AMPY++GGSLTS IQ +K + E E ++ISYQIL QI +LH L+I+HRDIK
Sbjct:    1 MKIFVIRVENPEIKIEIKLEEYSLVRNIRNKLDKIFPGRVKWNKHFIKLVHKNIIMDDEKSIGWYKLCEGDEILCVRIENYLCSDDVILEVFLSGFVPEVIYLIVQRNYSISKIKSMIERIQCEIINICDFTGNKMTGSQTVTETSSCAYYRLIVKYGRKETCISTFEDCLKQYHKFRIIHYYDFILRLRHLYECLFETRINEVIKQMNEIKAIMLSNDPFEIRLKENLSEFPSAFIKCHSIFCDDISSRIWDICDDYWQLSRNVIENDEWIVIGLFFRMALLIVLHQYLEHERNHCEIATKTFNSIVVDALGYSVTLLIKIRQMESFCETAGYSFDLIGELMEDICVKWMDPFLSTSRYYSEFDEVFNRYYNKTFASLKFGNGSVEFHFHS---DPQTIIEAKEAMAQKCGVKVNDLYAIYQRNEDKPTDGEPYDETILDFVLMINMENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 567          

HSP 2 Score: 61.2326 bits (147), Expect = 1.625e-9
Identity = 30/39 (76.92%), Postives = 33/39 (84.62%), Query Frame = 1
Query: 1750 ADNIVFDGAGNAKLIDFGLSKWMKNSTDENILEKLKAYA 1866
             DNI+ DGAGNAKLIDFGLSK M+N T E +LEKLKAYA
Sbjct:  568 PDNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYA 606          
BLAST of Protein kinase domain containing protein vs. Planmine SMEST
Match: SMESG000071997.1 (SMESG000071997.1)

HSP 1 Score: 306.99 bits (785), Expect = 4.541e-95
Identity = 209/566 (36.93%), Postives = 319/566 (56.36%), Query Frame = 2
Query:   71 MKISVVNGENLSVKFVIEIDKHSYVGDIKHKIDKILNGQGKWEKEHLRFIY------KNIILHD-EYIKRYKVCESDEIWFGKIENYLRSDDVIIEVFLAGCSPVLIWLIVKINHSITVIRSMIEIVQSKLINIYDWNGREMQNVQIVSDIDPIGYYRLIVSYEDERGKWLSFEDCVRQHDEFTFRFCLN-------SEFEFEDMTEINTVNLIN---KIRTIMSLNDVIDARLKENLSNIPSGVVNSKLLFYYNIQLRILDICQEFWKSTKDSPYYINYNIIKS----FELSILVALHQYSHSRQKDPENKDKSFNGIVIDALDYLVKHLHDHCKDLKYHQKLFFDHFLLVPRPVSEY-IELRNEYSSQLXXXXXXXXXXXXAPFLTLLLTQGTVLDAKCEIAQKLGVSIKDLYCINHWNHDKAEEDKIYKEGFYMFEIIKSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            MKI VVNGEN   K  IEI+  ++V +IK ++            E  R  Y       N +L+D +++ RY + ++DEIW G +EN+++ DDVI+E+FL+G +P + WL+VK+N S++ IR+ +  ++  +INI++ +G+ M++ Q+V+DID  GYYRLI+S        L+F++C + +     RF  +       ++F  E + E     LI    +IR IMS NDVID RL +NLS+     + SKLLF  +I  R+L+IC  +W   K   Y+    +       F LS+L  L + S+S      + DKSF GI+IDALD  V  L +  + LK   KL+ D F L+    SE+  +  + YS +    +    +++    L +     T+ +AK  IA     S +DLY I+  NHD+  E   + +G  + E+++ ME+    +E G G FG V  YQ+ ISG +  +K  N  K SLYRD FI A  ++ S L +YS + K +   ++AMPYM GG+L+ +I   +   E++  +ISYQIL QI KLH+L+IIHRDIK
Sbjct:    1 MKIFVVNGENGGEKTAIEIEGLTFVSEIKLRL-----------PEECRVNYFWLINSNNFLLNDNDHLSRYNLSDNDEIWHGSLENFIKKDDVIVEIFLSGWTPFISWLVVKVNQSMSEIRAALVRIEPDIINIFNGDGQLMEDNQLVTDIDRDGYYRLIISCGRGANMNLAFDECYKFYKLHILRFKYSKSHLLYYAQFYSEGIQEQTRYQLIYQMIRIREIMSSNDVIDTRLNKNLSDFLF-FIKSKLLFQQDISARLLEICYSYWFLIK---YFYTSEVWAVVGLYFRLSLLNVLSECSNSVVNLGVSADKSFGGIIIDALDNFVLFLSEFGEILKSSAKLWTDLFSLITLAGSEFDDQFDDSYSKESSCTVKSGGRNHQ---LVIFSNPRTIAEAKEAIAVANKTSEQDLYVIDGQNHDEPSERDRFSQGI-IIEMMRGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIIKKLNDVKCSLYRDAFIGAK-LSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGECQNEEDIFKISYQILAQINKLHKLEIIHRDIK 546          
BLAST of Protein kinase domain containing protein vs. Planmine SMEST
Match: SMESG000024843.1 (SMESG000024843.1)

HSP 1 Score: 286.96 bits (733), Expect = 1.149e-88
Identity = 174/430 (40.47%), Postives = 250/430 (58.14%), Query Frame = 2
Query:  449 IYDWNGREMQNVQIVSDIDPIGYYRLIVSYEDERGKWLSFEDCVRQHDEFTFRFCLNSE--FEFEDMTEINTVNLIN---KIRTIMSLNDVIDARLKENLSNIPSGVVNSKLLFYYNIQLRILDICQEFWKSTKDSPYYINYNI------IKSFELS-ILVALHQYSHSRQKDPENKDKSFNGIVIDALDYLVKHLHDHCKDLKYHQKLFFDHFLLVPRPVSEYIELRNEYSSQLXXXXXXXXXXXXAPFLTLLLTQGTVLDAKCEIAQKLGVSIKDLYCINHWNHDKAEEDKIYKEGFYMFEIIKSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 1702
            ++D  G EMQN Q V+DID  GYYRLIV+   E    L+F++C  QHD         SE  +EFE  +EI  V +IN   KIR I+S ND ID RL ENLS+ P   V    LF ++I  RI DIC E+ K  K  P+ + + +      +K F L+ +LV + +YS + Q DP+N  KSFN I++DALD LV+HL + C+D K+  K + + F L+ +   +  EL  ++   +I   I +++      + + L   T+L+A   +A K  +  +DLY INHW  DK  +   Y +    FE++  M +     E   GGFG+VF  +D ISGKQ+ MK     K SL+R+I I +++  + EL KYS + + +  +++ MPY+ GG+LTS IQ  K L E E +RIS+QIL QI +LH+ KIIH DIK
Sbjct:    1 MWDCKGNEMQNNQSVTDIDAFGYYRLIVNCGQEADDNLTFDECCNQHDRCKIILYYYSENWWEFEKFSEIARVKIINQIKKIRQIISSNDTIDPRLNENLSHFPKAFVKQNYLFGHDITKRIWDICNEYRKLMKSYPFSVQFCLNDEWHAMKLFFLTALLVTMRKYSDAVQNDPKNTKKSFNDILVDALDCLVRHLMNPCEDWKHAAKRWLNSFFLITQSDGDMDELFVKFDPSMIIVRIKSEEYE----MDVELNPKTILEATKAVANKFRIDRQDLYSINHWIPDKPNDGDPYFQPMTFFELMSKMADFENLNELANGGFGKVFICEDKISGKQVVMKKLIDVKDSLHREILIGSILF-DKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVIRISHQILTQISELHKSKIIHCDIK 425          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP3K38.316e-1332.82mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K38.382e-1332.82mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K38.382e-1332.82mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K38.815e-1332.82mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K38.961e-1332.82mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase domain containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-824.064e-1026.52pep chromosome:WBcel235:IV:7424498:7444660:1 gene:... [more]
unc-824.468e-1026.52pep chromosome:WBcel235:IV:7428926:7444648:1 gene:... [more]
unc-824.800e-1026.52pep chromosome:WBcel235:IV:7428926:7444648:1 gene:... [more]
unc-824.956e-1026.52pep chromosome:WBcel235:IV:7428926:7444648:1 gene:... [more]
unc-825.329e-1026.52pep chromosome:WBcel235:IV:7431348:7444648:1 gene:... [more]
back to top
BLAST of Protein kinase domain containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nuak13.513e-1127.27gene:FBgn0262617 transcript:FBtr0337050[more]
Nuak13.514e-1127.27gene:FBgn0262617 transcript:FBtr0305355[more]
Nuak13.562e-1127.27gene:FBgn0262617 transcript:FBtr0337049[more]
Nuak13.563e-1127.27gene:FBgn0262617 transcript:FBtr0305356[more]
Nuak13.570e-1127.27gene:FBgn0262617 transcript:FBtr0305354[more]
back to top
BLAST of Protein kinase domain containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k24.885e-1333.33mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k25.004e-1333.33mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k31.208e-1233.07mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k31.580e-1233.07mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k31.686e-1233.07mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase domain containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
samd82.152e-1334.35sterile alpha motif domain containing 8 [Source:Xe... [more]
samd82.243e-1334.35sterile alpha motif domain containing 8 [Source:Xe... [more]
MAP3K21.110e-1233.33mitogen-activated protein kinase kinase kinase 2 [... [more]
MAP3K21.587e-1233.33mitogen-activated protein kinase kinase kinase 2 [... [more]
dennd1a2.095e-1231.85DENN domain containing 1A [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Protein kinase domain containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map3k35.740e-1332.82mitogen-activated protein kinase kinase kinase 3 [... [more]
Map3k24.664e-1231.85mitogen-activated protein kinase kinase kinase 2 [... [more]
Prkaa14.761e-1130.71protein kinase, AMP-activated, alpha 1 catalytic s... [more]
Prkaa14.881e-1130.71protein kinase, AMP-activated, alpha 1 catalytic s... [more]
Prkaa28.056e-1029.13protein kinase, AMP-activated, alpha 2 catalytic s... [more]
back to top
BLAST of Protein kinase domain containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q61084|M3K3_MOUSE3.480e-1232.82Mitogen-activated protein kinase kinase kinase 3 O... [more]
sp|Q99759|M3K3_HUMAN3.869e-1232.82Mitogen-activated protein kinase kinase kinase 3 O... [more]
sp|Q9Y2U5|M3K2_HUMAN4.903e-1232.59Mitogen-activated protein kinase kinase kinase 2 O... [more]
sp|Q5RDH5|AAPK1_PONAB2.684e-1030.715'-AMP-activated protein kinase catalytic subunit ... [more]
sp|Q13131|AAPK1_HUMAN2.728e-1030.715'-AMP-activated protein kinase catalytic subunit ... [more]
back to top
BLAST of Protein kinase domain containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q1GWM22.176e-1134.81Mitogen-activated protein kinase kinase kinase 2 O... [more]
A0A3Q1GTU52.339e-1134.81Mitogen-activated protein kinase kinase kinase 2 O... [more]
T2M6M64.727e-1136.00Mitogen-activated protein kinase kinase kinase 3 O... [more]
G0UZH04.864e-1127.39Protein kinase domain-containing protein OS=Trypan... [more]
A0A078B1I85.658e-1134.38Protein kinase domain containing protein OS=Stylon... [more]
back to top
BLAST of Protein kinase domain containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k25.334e-1333.33mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k36.251e-1232.28mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k36.251e-1232.28mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k36.251e-1232.28mitogen-activated protein kinase kinase kinase 3 [... [more]
prkaa11.357e-1029.92protein kinase AMP-activated catalytic subunit alp... [more]
back to top
BLAST of Protein kinase domain containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k22.381e-1230.37mitogen-activated protein kinase kinase kinase 2 [... [more]
MARK32.798e-925.28microtubule affinity regulating kinase 3 [Source:H... [more]
MARK39.989e-927.87microtubule affinity regulating kinase 3 [Source:H... [more]
stk331.066e-825.60serine/threonine kinase 33 [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000006410.14.280e-826.87pep scaffold:Pmarinus_7.0:GL476370:17405:31068:-1 ... [more]
back to top
BLAST of Protein kinase domain containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SSK22.937e-1031.25MAP kinase kinase kinase of HOG1 mitogen-activated... [more]
CDC51.577e-831.71Polo-like kinase; controls targeting and activatio... [more]
CBK19.819e-831.34Serine/threonine protein kinase of the the RAM sig... [more]
BCK11.551e-727.69MAPKKK acting in the protein kinase C signaling pa... [more]
KIC12.256e-731.09Protein kinase of the PAK/Ste20 family, required f... [more]
back to top
BLAST of Protein kinase domain containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO414101.463e-1233.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361692.485e-928.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376778.385e-928.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407031.884e-828.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO307689.160e-827.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k24.906e-1233.33mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k31.284e-1133.07mitogen-activated protein kinase kinase kinase 3 [... [more]
prkaa11.050e-1029.92protein kinase AMP-activated catalytic subunit alp... [more]
chek17.621e-1025.78checkpoint kinase 1 [Source:NCBI gene;Acc:10117078... [more]
map3k221.606e-929.77mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase domain containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024532.12.401e-15100.00SMESG000024532.1[more]
SMESG000024532.10.000e+098.15SMESG000024532.1[more]
SMESG000024565.16.197e-11839.47SMESG000024565.1[more]
SMESG000071997.14.541e-9536.93SMESG000071997.1[more]
SMESG000024843.11.149e-8840.47SMESG000024843.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019571 ID=SMED30019571|Name=Protein kinase domain containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1866bp
CAGTTGTCAAATAATGTGAAATTAAAATTAATATTTATTTTATGTTTTTC
TAGTGTTAAACAATTGAAAAATGAAAATATCTGTGGTAAACGGCGAAAAT
TTGTCCGTAAAGTTCGTAATCGAAATTGACAAACATTCATATGTGGGCGA
CATAAAACATAAAATAGACAAAATCCTAAACGGTCAAGGAAAATGGGAGA
AAGAACATTTGAGATTTATTTACAAAAATATCATTTTACATGACGAATAT
ATCAAGCGATACAAAGTATGTGAGAGTGATGAAATTTGGTTCGGAAAAAT
TGAGAATTATTTGAGGAGTGATGATGTCATTATCGAAGTGTTCCTAGCAG
GATGTTCGCCTGTCTTGATCTGGCTGATCGTGAAAATTAATCATTCAATC
ACAGTGATTAGATCAATGATAGAAATCGTTCAATCTAAGCTAATCAATAT
TTATGATTGGAACGGACGCGAAATGCAAAACGTTCAAATTGTCAGCGATA
TCGACCCGATTGGATATTATCGATTGATTGTAAGCTACGAAGATGAAAGA
GGGAAATGGCTATCGTTTGAGGATTGCGTCCGACAGCATGATGAATTCAC
ATTTAGATTTTGTTTAAATAGCGAATTTGAATTTGAAGATATGACAGAAA
TCAACACGGTGAACCTAATCAACAAAATCAGGACAATTATGTCATTGAAT
GATGTAATCGATGCCAGACTCAAAGAAAATTTATCGAACATTCCTTCTGG
TGTTGTAAATTCAAAACTTTTATTTTATTATAACATTCAATTACGTATCT
TGGATATTTGTCAAGAATTTTGGAAATCAACGAAAGATTCACCTTATTAC
ATTAATTACAATATCATAAAATCCTTTGAGTTATCAATATTGGTTGCTCT
CCATCAGTATTCCCATTCCCGACAGAAGGATCCAGAAAATAAGGATAAAT
CATTCAATGGAATTGTGATCGATGCTTTGGATTATCTGGTCAAGCATTTA
CATGATCATTGTAAAGATTTGAAATATCATCAAAAATTATTTTTTGACCA
CTTCCTACTTGTTCCGCGGCCTGTTTCGGAATATATTGAATTGCGCAACG
AATATTCCAGTCAATTAATTACAAAAATAATAATAAATAAGAAGGATAAT
ATAGCTCCTTTTCTAACGCTTCTTTTAACTCAAGGGACAGTTCTTGACGC
TAAATGTGAAATAGCTCAAAAGTTGGGAGTAAGCATCAAAGATTTGTATT
GCATCAACCATTGGAATCATGATAAAGCCGAAGAAGACAAAATCTACAAA
GAGGGATTTTATATGTTTGAAATAATCAAGAGCATGGAGAATATGAATTT
GGGTAAGGAATTTGGGGCAGGAGGCTTTGGCCGAGTATTCTTTTATCAAG
ATATCATATCTGGGAAACAATTGGCTATGAAAACGGCAAATAGTGATAAA
TCCAGTCTCTATCGAGATATATTTATTAGTGCACTAATAATGAATAATTC
CGAACTGTTCAAATACTCCGGATTATTCAAATATAAAAGCGAACTATATA
TTGCCATGCCGTACATGACAGGGGGCTCGCTCACCTCGTATATCCAGGGA
AAGAAAGGTCTATTTGAAAAGGAAGCATTGAGAATATCTTATCAAATCCT
CATACAAATAGAGAAATTGCACGAGTTAAAAATTATTCATCGCGACATCA
AACGTTTGGGGTTGTCTGAATATTATTTTATATTATTTTGTATAATTCAG
CCGACAATATCGTTTTCGACGGAGCGGGAAATGCAAAATTAATTGACTTT
GGACTTAGTAAATGGATGAAAAACTCTACAGATGAAAACATTTTAGAAAA
ACTGAAGGCCTACGCC
back to top

protein sequence of SMED30019571-orf-1

>SMED30019571-orf-1 ID=SMED30019571-orf-1|Name=SMED30019571-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=574bp
MKISVVNGENLSVKFVIEIDKHSYVGDIKHKIDKILNGQGKWEKEHLRFI
YKNIILHDEYIKRYKVCESDEIWFGKIENYLRSDDVIIEVFLAGCSPVLI
WLIVKINHSITVIRSMIEIVQSKLINIYDWNGREMQNVQIVSDIDPIGYY
RLIVSYEDERGKWLSFEDCVRQHDEFTFRFCLNSEFEFEDMTEINTVNLI
NKIRTIMSLNDVIDARLKENLSNIPSGVVNSKLLFYYNIQLRILDICQEF
WKSTKDSPYYINYNIIKSFELSILVALHQYSHSRQKDPENKDKSFNGIVI
DALDYLVKHLHDHCKDLKYHQKLFFDHFLLVPRPVSEYIELRNEYSSQLI
TKIIINKKDNIAPFLTLLLTQGTVLDAKCEIAQKLGVSIKDLYCINHWNH
DKAEEDKIYKEGFYMFEIIKSMENMNLGKEFGAGGFGRVFFYQDIISGKQ
LAMKTANSDKSSLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMT
GGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIKRLGLSE
YYFILFCIIQPTISFSTEREMQN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 425..571
e-value: 3.1E-5
score: -61.5
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 428..544
e-value: 4.7E-16
score: 58.9
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 425..573
score: 18.591
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 417..545
e-value: 3.4E-23
score: 84.3
NoneNo IPR availablePANTHERPTHR24347SERINE/THREONINE-PROTEIN KINASEcoord: 398..544
NoneNo IPR availablePANTHERPTHR24347:SF412CALCIUM/CALMODULIN DEPENDENT PROTEIN KINASE Icoord: 398..544
NoneNo IPR availableCDDcd00180PKccoord: 432..544
e-value: 2.07582E-17
score: 79.2367
NoneNo IPR availableCDDcd01805Ubl_Rad23coord: 1..70
e-value: 0.00731721
score: 33.6847
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 413..544