Radial spoke head protein 4-like protein A

Overview
NameRadial spoke head protein 4-like protein A
Smed IDSMED30019565
Length (bp)1805
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Radial spoke head protein 4-like protein A (SMED30019565) t-SNE clustered cells

Violin plots show distribution of expression levels for Radial spoke head protein 4-like protein A (SMED30019565) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Radial spoke head protein 4-like protein A (SMED30019565) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Radial spoke head protein 4-like protein A (SMED30019565) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019565

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30019565SMESG000044927.1 SmedASXL_009174SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30019565SMESG000044927.1 dd_Smed_v4_5346_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30019565SMESG000044927.1 dd_Smed_v4_5346_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30019565SMESG000044927.1 dd_Smed_v4_5346_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019565SMESG000044927.1 dd_Smed_v4_5346_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019565SMESG000044927.1 dd_Smed_v4_5346_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30019565SMESG000044927.1 dd_Smed_v4_5346_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30019565SMESG000044927.1 dd_Smed_v4_5346_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019565SMESG000044927.1 Contig37581newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019565SMESG000044927.1 Contig37581uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019565SMESG000044927.1 Contig4560newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019565SMESG000044927.1 Contig4560uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019565SMESG000017482.1 Contig4560newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019565SMESG000017482.1 Contig4560uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30019565SMESG000044927.1 dd_Smed_v6_5346_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30019565SMESG000044927.1 dd_Smed_v4_5346_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30019565SMESG000044927.1 dd_Smed_v4_5346_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Human
Match: RSPH6A (radial spoke head 6 homolog A [Source:HGNC Symbol;Acc:HGNC:14241])

HSP 1 Score: 381.719 bits (979), Expect = 2.684e-123
Identity = 247/492 (50.20%), Postives = 313/492 (63.62%), Query Frame = 3
Query:  162 KTYLTASQLENGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVR----ENRLKSDSYGQDMSIDVGLAEIQKELFSKGDGDEEEAVPEDDIE--TPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------XXWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTFD--NXXXXXXXXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKNXXXXXXXXXXXXX----XXXXXXRGPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTPQEEEALKASK 1583
            K YL  + +    SL+ HL N + KIL +RP + L + E+ +   +      +L +     +M     +AE QK LF++  G  E     ++    TP+PN+M TAF++EQAG+ ++ +E +R+ LAMK+LV  QP+   RFWGKI GI ++Y VAEVEFREGEE  EEEE  E+ E         EEE  ED          S WK PPVIPKEE R+GANK +YFVCNE G PW RLPHVTPAQI   RKIKK+FTG LD  V S PPFPG E N LRAQIARISA TQ+SP+GFY F     +EE E    +D+Y ENPD+  + + EL D S++NWVHHT HILPQGRC W NP QK E+E +  EEE         VE E GP LLTP+S+D  +  L PWT R+S S  P+Y+V VV SNLW GA+A+A GK F N+YIGWG K +  ++ P  PA I  EY  G EI E++DPT +EE+ALKA++
Sbjct:  203 KAYLLQTSINCDLSLYEHLVNLLTKILNQRPEDPLSVLESLNRTTQWEWFHPKLDTLRDDPEMQPTYKMAEKQKALFTRSGGGTEGEQEMEEEVGETPVPNIMETAFYFEQAGVGLSSDESFRIFLAMKQLVEQQPIHTCRFWGKILGIKRSYLVAEVEFREGEEEAEEEEVEEMTEGGEVMEAHGEEEGEEDEEKAVDIVPKSVWKPPPVIPKEESRSGANKYLYFVCNEPGLPWTRLPHVTPAQIVNARKIKKFFTGYLDTPVVSYPPFPGNEANYLRAQIARISAATQVSPLGFYQFSEEEGDEEEEGGAGRDSYEENPDFEGIPVLELVD-SMANWVHHTQHILPQGRCTWVNPLQKTEEEEDLGEEEEKADEGPEEVEQEVGPPLLTPLSEDAEIMHLAPWTTRLSCSLCPQYSVAVVRSNLWPGAYAYASGKKFENIYIGWGHKYSPESFNPALPAPIQQEYPSGPEIMEMSDPTVEEEQALKAAQ 693          
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Human
Match: RSPH4A (radial spoke head component 4A [Source:HGNC Symbol;Acc:HGNC:21558])

HSP 1 Score: 381.719 bits (979), Expect = 2.908e-123
Identity = 248/486 (51.03%), Postives = 327/486 (67.28%), Query Frame = 3
Query:  150 ISALKTYLTASQLENGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVRENRL--KSDSYGQDMSI--DVGLAEIQKELFSKGDGDEEEAVPEDDI-ETPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTF--DNXXXXXXXXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKNXXXXXXXXXXXXXXXXXXXR-GPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTPQEEEALKASK 1583
            I   K YL  +   +G +L+ HL+N + KIL ERP NA+DIFEN S +V+      K D+   +  +     +AE QK LF +G  +  +   ED+I E  LPN+M +AF++EQAG+ +  +E YR+ LA+K+L +T P+++ RFWGKI G+  NY VAEVEFREGE+ EE EEE    E D  ES   E+EE E       +KAP  IPKEE RTGANK VYFVCNE G+PW++LP V PAQI I RKIKK+FTG LDA + S PPFPG E N LRAQIARISAGT +SP+GFY F  +  EEE E E  ++++ ENPD+  + + +L + SLSNWVHH  HIL QGRC W+N  QKNE+E EEE+EE  ++    +  G  LLTPIS+D  ++ + PWT R+SS+ IP+YA+ V+ SNLW GA+AF+ GK F N YIGWG K + +NY P  P  +  EY  G EITE+ DP+ +EE+A +A++
Sbjct:  211 IQNAKAYLLKTSSNSGFNLYDHLSNMLTKILNERPENAVDIFENISQDVKMAHFSKKFDALQNENELLPTYEIAEKQKALFLQGHLEGVDQELEDEIAENALPNVMESAFYFEQAGVGLGTDETYRIFLALKQLTDTHPIQRCRFWGKILGLEMNYIVAEVEFREGEDEEEVEEEDVAEERDNGESEAHEDEEDELPKSF--YKAPQAIPKEESRTGANKYVYFVCNEPGRPWVKLPPVIPAQIVIARKIKKFFTGRLDAPIISYPPFPGNESNYLRAQIARISAGTHVSPLGFYQFGEEEGEEEEEAEGGRNSFEENPDFEGIQVIDLVE-SLSNWVHHVQHILSQGRCNWFNSIQKNEEEEEEEDEEKDDSDYIEQEVGLPLLTPISEDLEIQNIPPWTTRLSSNLIPQYAIAVLQSNLWPGAYAFSNGKKFENFYIGWGHKYSPDNYTPPVPPPVYQEYPSGPEITEMDDPSVEEEQAFRAAQ 693          
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Human
Match: RSPH6A (radial spoke head 6 homolog A [Source:HGNC Symbol;Acc:HGNC:14241])

HSP 1 Score: 357.066 bits (915), Expect = 5.290e-117
Identity = 230/424 (54.25%), Postives = 283/424 (66.75%), Query Frame = 3
Query:  354 LAEIQKELFSKGDGDEEEAVPEDDIE--TPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------XXWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTFD--NXXXXXXXXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKNXXXXXXXXXXXXX----XXXXXXRGPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTPQEEEALKASK 1583
            +AE QK LF++  G  E     ++    TP+PN+M TAF++EQAG+ ++ +E +R+ LAMK+LV  QP+   RFWGKI GI ++Y VAEVEFREGEE  EEEE  E+ E         EEE  ED          S WK PPVIPKEE R+GANK +YFVCNE G PW RLPHVTPAQI   RKIKK+FTG LD  V S PPFPG E N LRAQIARISA TQ+SP+GFY F     +EE E    +D+Y ENPD+  + + EL D S++NWVHHT HILPQGRC W NP QK E+E +  EEE         VE E GP LLTP+S+D  +  L PWT R+S S  P+Y+V VV SNLW GA+A+A GK F N+YIGWG K +  ++ P  PA I  EY  G EI E++DPT +EE+ALKA++
Sbjct:    7 MAEKQKALFTRSGGGTEGEQEMEEEVGETPVPNIMETAFYFEQAGVGLSSDESFRIFLAMKQLVEQQPIHTCRFWGKILGIKRSYLVAEVEFREGEEEAEEEEVEEMTEGGEVMEAHGEEEGEEDEEKAVDIVPKSVWKPPPVIPKEESRSGANKYLYFVCNEPGLPWTRLPHVTPAQIVNARKIKKFFTGYLDTPVVSYPPFPGNEANYLRAQIARISAATQVSPLGFYQFSEEEGDEEEEGGAGRDSYEENPDFEGIPVLELVD-SMANWVHHTQHILPQGRCTWVNPLQKTEEEEDLGEEEEKADEGPEEVEQEVGPPLLTPLSEDAEIMHLAPWTTRLSCSLCPQYSVAVVRSNLWPGAYAYASGKKFENIYIGWGHKYSPESFNPALPAPIQQEYPSGPEIMEMSDPTVEEEQALKAAQ 429          
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Human
Match: RSPH6A (radial spoke head 6 homolog A [Source:HGNC Symbol;Acc:HGNC:14241])

HSP 1 Score: 328.561 bits (841), Expect = 2.660e-103
Identity = 223/461 (48.37%), Postives = 282/461 (61.17%), Query Frame = 3
Query:  162 KTYLTASQLENGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVR----ENRLKSDSYGQDMSIDVGLAEIQKELFSKGDGDEEEAVPEDDIE--TPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------XXWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTFD--NXXXXXXXXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKNXXXXXXXXXXXXX----XXXXXXRGPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPP 1490
            K YL  + +    SL+ HL N + KIL +RP + L + E+ +   +      +L +     +M     +AE QK LF++  G  E     ++    TP+PN+M TAF++EQAG+ ++ +E +R+ LAMK+LV  QP+   RFWGKI GI ++Y VAEVEFREGEE  EEEE  E+ E         EEE  ED          S WK PPVIPKEE R+GANK +YFVCNE G PW RLPHVTPAQI   RKIKK+FTG LD  V S PPFPG E N LRAQIARISA TQ+SP+GFY F     +EE E    +D+Y ENPD+  + + EL D S++NWVHHT HILPQGRC W NP QK E+E +  EEE         VE E GP LLTP+S+D  +  L PWT R+S S  P+Y+V VV SNLW GA+A+A G    +   G      + +  PC P
Sbjct:  203 KAYLLQTSINCDLSLYEHLVNLLTKILNQRPEDPLSVLESLNRTTQWEWFHPKLDTLRDDPEMQPTYKMAEKQKALFTRSGGGTEGEQEMEEEVGETPVPNIMETAFYFEQAGVGLSSDESFRIFLAMKQLVEQQPIHTCRFWGKILGIKRSYLVAEVEFREGEEEAEEEEVEEMTEGGEVMEAHGEEEGEEDEEKAVDIVPKSVWKPPPVIPKEESRSGANKYLYFVCNEPGLPWTRLPHVTPAQIVNARKIKKFFTGYLDTPVVSYPPFPGNEANYLRAQIARISAATQVSPLGFYQFSEEEGDEEEEGGAGRDSYEENPDFEGIPVLELVD-SMANWVHHTQHILPQGRCTWVNPLQKTEEEEDLGEEEEKADEGPEEVEQEVGPPLLTPLSEDAEIMHLAPWTTRLSCSLCPQYSVAVVRSNLWPGAYAYASGNLRTSTSAGVTSTAPRASTRPCQP 662          
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Human
Match: RSPH4A (radial spoke head component 4A [Source:HGNC Symbol;Acc:HGNC:21558])

HSP 1 Score: 267.7 bits (683), Expect = 7.366e-81
Identity = 182/357 (50.98%), Postives = 235/357 (65.83%), Query Frame = 3
Query:  150 ISALKTYLTASQLENGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVRENRL--KSDSYGQDMSI--DVGLAEIQKELFSKGDGDEEEAVPEDDI-ETPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTF--DNXXXXXXXXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQ 1199
            I   K YL  +   +G +L+ HL+N + KIL ERP NA+DIFEN S +V+      K D+   +  +     +AE QK LF +G  +  +   ED+I E  LPN+M +AF++EQAG+ +  +E YR+ LA+K+L +T P+++ RFWGKI G+  NY VAEVEFREGE+ EE EEE    E D  ES   E+EE E       +KAP  IPKEE RTGANK VYFVCNE G+PW++LP V PAQI I RKIKK+FTG LDA + S PPFPG E N LRAQIARISAGT +SP+GFY F  +  EEE E E  ++++ ENPD+  + + +L + SLSNWVHH  HIL Q R   + P Q
Sbjct:  211 IQNAKAYLLKTSSNSGFNLYDHLSNMLTKILNERPENAVDIFENISQDVKMAHFSKKFDALQNENELLPTYEIAEKQKALFLQGHLEGVDQELEDEIAENALPNVMESAFYFEQAGVGLGTDETYRIFLALKQLTDTHPIQRCRFWGKILGLEMNYIVAEVEFREGEDEEEVEEEDVAEERDNGESEAHEDEEDELPKSF--YKAPQAIPKEESRTGANKYVYFVCNEPGRPWVKLPPVIPAQIVIARKIKKFFTGRLDAPIISYPPFPGNESNYLRAQIARISAGTHVSPLGFYQFGEEEGEEEEEAEGGRNSFEENPDFEGIQVIDLVE-SLSNWVHHVQHILSQ-RFRIYPPGQ 563          
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Fly
Match: CG3121 (gene:FBgn0034957 transcript:FBtr0072161)

HSP 1 Score: 123.25 bits (308), Expect = 3.966e-29
Identity = 108/334 (32.34%), Postives = 150/334 (44.91%), Query Frame = 3
Query:  759 IPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFY---------TFDNXXXXXXXXT----------------IQDN---YIENPDYAPLHLKELADPSLSNWVHHTNHIL-PQGRCVWWNPTQKNXXXXXXXXXXXXXXXXXXXR------------------------------GPSLLTPISQDFSVEGLQPWTVRISSSRIPEYA-VTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKE-ITEIADPTPQEEEALKA 1577
            IP E    G N+  YFV N     WI LP VTP QI ++R+IKK+ TG L+A+V S P FPG E + LR  I RI+AGT I+P+G+Y          FD EEEE  EE                 I+DN    ++N  Y    L  LA P    WVH  ++IL  QGR VW++  +  ++  +     +    +                                  GPS+L+  + D + E    W  R++S    +   + V+ SN+W GA+ F F K   ++Y+GWG K    N        +  E+    E   E  DPT +EEEA KA
Sbjct:  346 IPPEFIGKGCNRYSYFVVNSLFDDWIELPIVTPRQIVVSRQIKKFLTGDLEADVISYPCFPGKEKHYLRTLIGRITAGTYIAPVGYYRRMTKKEQRMFDGEEEEEGEEEEEEEEEEEFNEGEEEQIEDNDVMLLKNEKYEAEPLGSLATPVA--WVHVRSNILNQQGRVVWYDEEKARKEREKALALYLKMQMLGEMEEEVEEEEDEEEGEEEGEEEGMIEGFNQPELGPSILSSCANDMNPEVPVSWLARMTSKYTNQKERMLVMQSNVWPGAYTFIFEKTCESIYLGWGHKYYARNIPFKHLPMVQEEFPHNPEDFVEANDPTVEEEEAYKA 677          

HSP 2 Score: 67.781 bits (164), Expect = 1.703e-11
Identity = 47/178 (26.40%), Postives = 82/178 (46.07%), Query Frame = 3
Query:  153 SALKTYLTASQLENGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVRENRLK-------SDSYGQDMSIDVGLAEIQK---------ELFSKGDGDEEEAVPEDDIETPLPNMML-----------TAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYY 605
            S L+ Y T S    G +LF HL++ IK++++ERP N +D FE +S NVRE +         S  + +  S  V    +Q          E     D   E+    +D+   + + M              F++ Q G  ++ +++++++ AM +L     + + RFWG I G+  +YY
Sbjct:   89 SILQKYSTLS----GDNLFDHLSDIIKRVIDERPPNVIDFFEEFSRNVREQKFHLPERFPPSGVFDEVRSFRVAKKILQSMKLPYVVEGEDLMGEDLSVEDLRTNEDMRIVIDDSMRYFVTFNERVQQLQFYWTQCGFSISNDDIFQLASAMNRLQTHPSIMQCRFWGCINGLKASYY 262          
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Zebrafish
Match: rsph4a (radial spoke head component 4A [Source:ZFIN;Acc:ZDB-GENE-030131-7437])

HSP 1 Score: 335.109 bits (858), Expect = 8.537e-108
Identity = 219/497 (44.06%), Postives = 314/497 (63.18%), Query Frame = 3
Query:  135 NSVEMISALKTYLTASQLENGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVRENRL--KSDSYGQDMSID--VGLAEIQKELF--SKGDGDEEEAVPEDDIETPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----XXWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTFDNXXXXXXXXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQK----NXXXXXXXXXXXXXXXXXXXRGPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTPQEEEALKAS 1580
            N ++  ++ K ++  +  +   +L+ HL   + ++++ERP NA+D+ E+ S  ++ + L  K D+     S    + LAE QK LF  + GDG + E   E+ +++PLPN+   AFF+EQAG+ + REE+ R+ LA+K LV+TQ + + RFWGKI G   NY VAE EFREGE  E+E  E    E++R E  Q+ ++E E +        S++K    +PKE   TGANK  YFVC E G PW+RLP VTP QI + R+I+++FTG LDA V S PPFPG E N LRAQIARISAGT +SP+GFY F  +E E +   ++D++ ENP +  + + E+A+ SL+ WVHH  HIL QGRCVW N T+K     +++ E+EE E     +E E GP LLTP+S+D  +    PW+  +SS+ IP++A+ V+ SNLW GA+A+  GK+F N+YIGWG K     + P  P     E+  G E TE  DP+ +EE+ALKA+
Sbjct:   11 NRLQTAASFKAFMMKNSTKTNLNLYDHLVRLLTRVMDERPENAVDVMEDMSLELKGSVLQEKQDTLRDSPSSSPALVLAEQQKTLFMHTAGDGGDHE---EELVDSPLPNVAELAFFFEQAGVGLGREEIQRIFLALKHLVDTQLLLRCRFWGKILGTQGNYLVAEGEFREGEGEEDEGTEQTPEEDEREEELQEGKDEAELVEAADPLPKSTYKPSASVPKEGNHTGANKFTYFVCQEPGMPWVRLPVVTPVQITVARQIRRFFTGKLDAPVVSYPPFPGNEANYLRAQIARISAGTHVSPLGFYQFGEDEGEDDG--LRDSFEENPTFEGIQVNEMAE-SLNLWVHHVQHILTQGRCVWVNVTKKPVDDVDEDAEDEEREEEPDELEPEVGPPLLTPLSEDAKLNDTPPWSSMMSSNIIPQFAIAVLRSNLWPGAYAYCSGKNFGNIYIGWGLKFIGEPFTPVLPPPPQSEFPSGPETTEALDPSVEEEQALKAA 501          
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Xenopus
Match: cc2d2a (coiled-coil and C2 domain containing 2A [Source:Xenbase;Acc:XB-GENE-5909177])

HSP 1 Score: 343.199 bits (879), Expect = 7.486e-111
Identity = 235/472 (49.79%), Postives = 310/472 (65.68%), Query Frame = 3
Query:  192 NGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVRENRLKSDS----YGQDMSIDVGLAEIQKELFSKGDGDEEEAVPEDDI-ETPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTF-DNXXXXXXXXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKNXXXXXXXXXXXXXXXXXXXR----GPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTPQEEEALK 1574
            +G SL+ HL+  + +IL ERP NAL++FE+ S  +  +RLK  S      ++ S     AE+Q+ LFS+GDG+ EE+  E ++ E+PLPN++  A   +Q G+ + R+E  R+SLA+K+L +T P++   FWGKI G   +Y VAEV+     ++  EE  E E   E  ++  ++E EE EDLPPKS+++ PPVIPKEE  TGANK VY+VC+EAG  W+RLP VTPAQI   RKI+  FTG LDA V + PPFPG EINLLRAQIARISAGT +SP+G+Y F + E EE EE  ++D Y ENPD+  + + EL + SLSNWVHH  HILPQGRCVW N + K+E+E +EEE E  E   E E     GP LLTP+S+D  +    PWT  +S+  IP YA+ V+ SNLW GA+  +  K F N+YIGWG K     Y+P  P     EY  G EITE  DPT +EE+ALK
Sbjct:   27 SGLSLYEHLSALLSRILSERPPNALEVFESLSAELHWSRLKQGSDVLRAPREESHTCRKAEVQRALFSRGDGEGEESEAEGEMTESPLPNLLDLAHLLQQGGVNLGRDEAVRISLALKRLTDTHPLQVCHFWGKILGSGGSYLVAEVQFREGEDDEAEEGGEEEEKGEVEDDVEEEENEEAEDLPPKSTYRPPPVIPKEENGTGANKHVYYVCSEAGAEWVRLPPVTPAQISAARKIRHLFTGNLDAPVITYPPFPGTEINLLRAQIARISAGTHVSPLGYYQFGEEEGEEEEEGAVRDTYEENPDFEGIPVSELVE-SLSNWVHHVQHILPQGRCVWVNTSVKSEEEEDEEEAEEEEKEEENEPEPEVGPPLLTPLSEDAEIGQTPPWTAFLSTHLIPHYALAVLRSNLWPGAYTVSSAKKFENIYIGWGLKYMPEGYSPPAPPAPQAEYPSGPEITESTDPTVEEEQALK 497          
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Mouse
Match: Rsph4a (radial spoke head 4 homolog A (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:3027894])

HSP 1 Score: 384.415 bits (986), Expect = 2.069e-124
Identity = 241/489 (49.28%), Postives = 325/489 (66.46%), Query Frame = 3
Query:  150 ISALKTYLTASQLENGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVR----ENRLKSDSYGQDMSIDVGLAEIQKELFSKG--DGDEEEAVPEDDIETPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTF-DNXXXXXXXXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKNXXXXXXXXXXXXXXXX----XXXRGPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTPQEEEALKASK 1583
            I   K YL ++  ++G +L+ HL+  + KIL+ERP +A+DI EN S +V+      +L +     +M     +AE QK LF +G  +G + E + E+  E+ LPN+M +A+++EQAG+ +  +E YRV LA+K+L +T P+++ RFWGKI G+  NY     E    +  +EEE E E + E+R+    +  EE E+  PKS +KAP VIPKEE RTGANK VYFVCN  G+PW+RLP VTPAQI   RKIKK+FTG LDA V S PPFPG E N LRAQIARISAGT +SP+GFY F + E EE E E  +D+Y ENPD+  + + +L + SLSNWVHH  +ILPQGRC W+NP QK+EDE EEEEE+  +       E E GP LLTPIS+D  ++ +  WT ++SS+ IP+YA+ V+ SNLW GA+AF+ GK F N YIGWG K    NY P  P  +  EY  G EITE+ DP+ +EE+A + ++
Sbjct:  210 IQNAKAYLLSTSSKSGLNLYDHLSKVLTKILDERPADAVDIIENISQDVKMAHFNKKLDTLHNEYEMLPAYEIAETQKALFLQGHLEGADSE-LEEEMAESSLPNVMESAYYFEQAGVGLGTDETYRVFLALKQLTDTHPIQRCRFWGKILGLEMNY--IVAEVEFRDGEDEEEVEEEGIAEERDNGGSEAGEEEEEELPKSLYKAPQVIPKEESRTGANKYVYFVCNVPGRPWVRLPSVTPAQIVTARKIKKFFTGRLDAAVISYPPFPGNESNYLRAQIARISAGTHVSPLGFYQFGEEEGEEEEVEGGRDSYEENPDFEGIQVIDLVE-SLSNWVHHVQYILPQGRCNWFNPIQKDEDEEEEEEEDEEKGEEPDYIEQEVGPPLLTPISEDLGIQNIPSWTTQLSSNLIPQYAIAVLRSNLWPGAYAFSNGKKFENFYIGWGHKYCVENYTPPSPPPVYQEYPSGPEITEMNDPSVEEEQAFRMTQ 694          
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Mouse
Match: Rsph6a (radial spoke head 6 homolog A (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:1927643])

HSP 1 Score: 378.252 bits (970), Expect = 2.949e-122
Identity = 244/491 (49.69%), Postives = 321/491 (65.38%), Query Frame = 3
Query:  150 ISALKTYLTASQLENGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVR----ENRLKSDSYGQDMSIDVGLAEIQKELFSKGDGDEEEAVPEDDIETPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXXXXXXXXXXXXXXXXXXX------XXXXXXXXXXXXXXXXXXXXXXXWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTF--DNXXXXXXXXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKN----XXXXXXXXXXXXXXXXXXXRGPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTPQEEEALK 1574
            I   K YL  + +    SL+ HL N + KIL +RP + L I E+ +  ++      +L +     +M     +AE QK LF +G G+ E+ + E+  ++P+PN+M TAF++EQAG+ ++ +E +R+ LA+K+LV  QP+   RFWGKI G+ ++Y VAEVEFREGEE  EEEE  E++      E    E  +++EE+  D  PK  WK PP+IPKEE R+G NK +YFVCNE G+PW RLPHVTPAQI   RKIKK+FTG LD  V S PPFPG E N LRAQIARISA T ISP+GFY F  +  +EE E    +D++ ENPD+  + + EL D S++NWVHHT HILPQGRC W NP QK     E   EEE+ +     VE E GP LLTP+S+D  +  L PWT R+S S  P+Y+V +V SNLW GA+A+A GK F N+YIGWG K +  N+ P  PA I  EY  G EITE++DPT +EE+ALK
Sbjct:  192 IQNAKAYLLRTSMSCNLSLYEHLVNLLTKILNQRPEDPLSILESLNRTMQWEWFHPKLDTLRDDPEMQPTYEMAEKQKALFIRGGGEGEQEMEEEVTDSPVPNIMETAFYFEQAGVGLSSDESFRIFLALKQLVEQQPIHMCRFWGKILGLSRSYLVAEVEFREGEEEGEEEEVEEMMEGGEVLETHGEEEGEEDEEKVVDSVPKPQWKPPPIIPKEESRSGTNKYLYFVCNEPGRPWTRLPHVTPAQIVCARKIKKFFTGFLDTPVISYPPFPGNEANYLRAQIARISAATHISPLGFYQFGEEEGDEEEEGGAGRDSFEENPDFEGIPVLELVD-SMANWVHHTQHILPQGRCTWVNPLQKTEEEEELGEEEEKADEAMEEVEQEVGPPLLTPLSEDAEIMHLSPWTTRLSCSLSPQYSVAIVRSNLWPGAYAYATGKKFENIYIGWGHKYSPENFNPMLPALIQQEYPSGPEITEMSDPTVEEEQALK 681          
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Mouse
Match: Rsph6a (radial spoke head 6 homolog A (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:1927643])

HSP 1 Score: 125.176 bits (313), Expect = 2.977e-30
Identity = 70/138 (50.72%), Postives = 89/138 (64.49%), Query Frame = 3
Query: 1173 RCVWWNPTQKNXXXXXXX----XXXXXXXXXXXXRGPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTPQEEEALK 1574
            RC W NP QK E+E E      + +     VE E GP LLTP+S+D  +  L PWT R+S S  P+Y+V +V SNLW GA+A+A GK F N+YIGWG K +  N+ P  PA I  EY  G EITE++DPT +EE+ALK
Sbjct:  289 RCTWVNPLQKTEEEEELGEEEEKADEAMEEVEQEVGPPLLTPLSEDAEIMHLSPWTTRLSCSLSPQYSVAIVRSNLWPGAYAYATGKKFENIYIGWGHKYSPENFNPMLPALIQQEYPSGPEITEMSDPTVEEEQALK 426          
BLAST of Radial spoke head protein 4-like protein A vs. UniProt/SwissProt
Match: sp|Q8BYM7|RSH4A_MOUSE (Radial spoke head protein 4 homolog A OS=Mus musculus OX=10090 GN=Rsph4a PE=1 SV=2)

HSP 1 Score: 384.415 bits (986), Expect = 1.447e-123
Identity = 241/489 (49.28%), Postives = 325/489 (66.46%), Query Frame = 3
Query:  150 ISALKTYLTASQLENGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVR----ENRLKSDSYGQDMSIDVGLAEIQKELFSKG--DGDEEEAVPEDDIETPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTF-DNXXXXXXXXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKNXXXXXXXXXXXXXXXX----XXXRGPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTPQEEEALKASK 1583
            I   K YL ++  ++G +L+ HL+  + KIL+ERP +A+DI EN S +V+      +L +     +M     +AE QK LF +G  +G + E + E+  E+ LPN+M +A+++EQAG+ +  +E YRV LA+K+L +T P+++ RFWGKI G+  NY     E    +  +EEE E E + E+R+    +  EE E+  PKS +KAP VIPKEE RTGANK VYFVCN  G+PW+RLP VTPAQI   RKIKK+FTG LDA V S PPFPG E N LRAQIARISAGT +SP+GFY F + E EE E E  +D+Y ENPD+  + + +L + SLSNWVHH  +ILPQGRC W+NP QK+EDE EEEEE+  +       E E GP LLTPIS+D  ++ +  WT ++SS+ IP+YA+ V+ SNLW GA+AF+ GK F N YIGWG K    NY P  P  +  EY  G EITE+ DP+ +EE+A + ++
Sbjct:  210 IQNAKAYLLSTSSKSGLNLYDHLSKVLTKILDERPADAVDIIENISQDVKMAHFNKKLDTLHNEYEMLPAYEIAETQKALFLQGHLEGADSE-LEEEMAESSLPNVMESAYYFEQAGVGLGTDETYRVFLALKQLTDTHPIQRCRFWGKILGLEMNY--IVAEVEFRDGEDEEEVEEEGIAEERDNGGSEAGEEEEEELPKSLYKAPQVIPKEESRTGANKYVYFVCNVPGRPWVRLPSVTPAQIVTARKIKKFFTGRLDAAVISYPPFPGNESNYLRAQIARISAGTHVSPLGFYQFGEEEGEEEEVEGGRDSYEENPDFEGIQVIDLVE-SLSNWVHHVQYILPQGRCNWFNPIQKDEDEEEEEEEDEEKGEEPDYIEQEVGPPLLTPISEDLGIQNIPSWTTQLSSNLIPQYAIAVLRSNLWPGAYAFSNGKKFENFYIGWGHKYCVENYTPPSPPPVYQEYPSGPEITEMNDPSVEEEQAFRMTQ 694          
BLAST of Radial spoke head protein 4-like protein A vs. UniProt/SwissProt
Match: sp|Q9H0K4|RSH6A_HUMAN (Radial spoke head protein 6 homolog A OS=Homo sapiens OX=9606 GN=RSPH6A PE=1 SV=1)

HSP 1 Score: 381.719 bits (979), Expect = 1.289e-122
Identity = 247/492 (50.20%), Postives = 313/492 (63.62%), Query Frame = 3
Query:  162 KTYLTASQLENGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVR----ENRLKSDSYGQDMSIDVGLAEIQKELFSKGDGDEEEAVPEDDIE--TPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------XXWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTFD--NXXXXXXXXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKNXXXXXXXXXXXXX----XXXXXXRGPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTPQEEEALKASK 1583
            K YL  + +    SL+ HL N + KIL +RP + L + E+ +   +      +L +     +M     +AE QK LF++  G  E     ++    TP+PN+M TAF++EQAG+ ++ +E +R+ LAMK+LV  QP+   RFWGKI GI ++Y VAEVEFREGEE  EEEE  E+ E         EEE  ED          S WK PPVIPKEE R+GANK +YFVCNE G PW RLPHVTPAQI   RKIKK+FTG LD  V S PPFPG E N LRAQIARISA TQ+SP+GFY F     +EE E    +D+Y ENPD+  + + EL D S++NWVHHT HILPQGRC W NP QK E+E +  EEE         VE E GP LLTP+S+D  +  L PWT R+S S  P+Y+V VV SNLW GA+A+A GK F N+YIGWG K +  ++ P  PA I  EY  G EI E++DPT +EE+ALKA++
Sbjct:  203 KAYLLQTSINCDLSLYEHLVNLLTKILNQRPEDPLSVLESLNRTTQWEWFHPKLDTLRDDPEMQPTYKMAEKQKALFTRSGGGTEGEQEMEEEVGETPVPNIMETAFYFEQAGVGLSSDESFRIFLAMKQLVEQQPIHTCRFWGKILGIKRSYLVAEVEFREGEEEAEEEEVEEMTEGGEVMEAHGEEEGEEDEEKAVDIVPKSVWKPPPVIPKEESRSGANKYLYFVCNEPGLPWTRLPHVTPAQIVNARKIKKFFTGYLDTPVVSYPPFPGNEANYLRAQIARISAATQVSPLGFYQFSEEEGDEEEEGGAGRDSYEENPDFEGIPVLELVD-SMANWVHHTQHILPQGRCTWVNPLQKTEEEEDLGEEEEKADEGPEEVEQEVGPPLLTPLSEDAEIMHLAPWTTRLSCSLCPQYSVAVVRSNLWPGAYAYASGKKFENIYIGWGHKYSPESFNPALPAPIQQEYPSGPEIMEMSDPTVEEEQALKAAQ 693          
BLAST of Radial spoke head protein 4-like protein A vs. UniProt/SwissProt
Match: sp|Q5TD94|RSH4A_HUMAN (Radial spoke head protein 4 homolog A OS=Homo sapiens OX=9606 GN=RSPH4A PE=1 SV=1)

HSP 1 Score: 381.719 bits (979), Expect = 1.396e-122
Identity = 248/486 (51.03%), Postives = 327/486 (67.28%), Query Frame = 3
Query:  150 ISALKTYLTASQLENGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVRENRL--KSDSYGQDMSI--DVGLAEIQKELFSKGDGDEEEAVPEDDI-ETPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTF--DNXXXXXXXXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKNXXXXXXXXXXXXXXXXXXXR-GPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTPQEEEALKASK 1583
            I   K YL  +   +G +L+ HL+N + KIL ERP NA+DIFEN S +V+      K D+   +  +     +AE QK LF +G  +  +   ED+I E  LPN+M +AF++EQAG+ +  +E YR+ LA+K+L +T P+++ RFWGKI G+  NY VAEVEFREGE+ EE EEE    E D  ES   E+EE E       +KAP  IPKEE RTGANK VYFVCNE G+PW++LP V PAQI I RKIKK+FTG LDA + S PPFPG E N LRAQIARISAGT +SP+GFY F  +  EEE E E  ++++ ENPD+  + + +L + SLSNWVHH  HIL QGRC W+N  QKNE+E EEE+EE  ++    +  G  LLTPIS+D  ++ + PWT R+SS+ IP+YA+ V+ SNLW GA+AF+ GK F N YIGWG K + +NY P  P  +  EY  G EITE+ DP+ +EE+A +A++
Sbjct:  211 IQNAKAYLLKTSSNSGFNLYDHLSNMLTKILNERPENAVDIFENISQDVKMAHFSKKFDALQNENELLPTYEIAEKQKALFLQGHLEGVDQELEDEIAENALPNVMESAFYFEQAGVGLGTDETYRIFLALKQLTDTHPIQRCRFWGKILGLEMNYIVAEVEFREGEDEEEVEEEDVAEERDNGESEAHEDEEDELPKSF--YKAPQAIPKEESRTGANKYVYFVCNEPGRPWVKLPPVIPAQIVIARKIKKFFTGRLDAPIISYPPFPGNESNYLRAQIARISAGTHVSPLGFYQFGEEEGEEEEEAEGGRNSFEENPDFEGIQVIDLVE-SLSNWVHHVQHILSQGRCNWFNSIQKNEEEEEEEDEEKDDSDYIEQEVGLPLLTPISEDLEIQNIPPWTTRLSSNLIPQYAIAVLQSNLWPGAYAFSNGKKFENFYIGWGHKYSPDNYTPPVPPPVYQEYPSGPEITEMDDPSVEEEQAFRAAQ 693          
BLAST of Radial spoke head protein 4-like protein A vs. UniProt/SwissProt
Match: sp|Q8CDR2|RSH6A_MOUSE (Radial spoke head protein 6 homolog A OS=Mus musculus OX=10090 GN=Rsph6a PE=1 SV=1)

HSP 1 Score: 378.252 bits (970), Expect = 2.063e-121
Identity = 244/491 (49.69%), Postives = 321/491 (65.38%), Query Frame = 3
Query:  150 ISALKTYLTASQLENGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVR----ENRLKSDSYGQDMSIDVGLAEIQKELFSKGDGDEEEAVPEDDIETPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXXXXXXXXXXXXXXXXXXX------XXXXXXXXXXXXXXXXXXXXXXXWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTF--DNXXXXXXXXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKN----XXXXXXXXXXXXXXXXXXXRGPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTPQEEEALK 1574
            I   K YL  + +    SL+ HL N + KIL +RP + L I E+ +  ++      +L +     +M     +AE QK LF +G G+ E+ + E+  ++P+PN+M TAF++EQAG+ ++ +E +R+ LA+K+LV  QP+   RFWGKI G+ ++Y VAEVEFREGEE  EEEE  E++      E    E  +++EE+  D  PK  WK PP+IPKEE R+G NK +YFVCNE G+PW RLPHVTPAQI   RKIKK+FTG LD  V S PPFPG E N LRAQIARISA T ISP+GFY F  +  +EE E    +D++ ENPD+  + + EL D S++NWVHHT HILPQGRC W NP QK     E   EEE+ +     VE E GP LLTP+S+D  +  L PWT R+S S  P+Y+V +V SNLW GA+A+A GK F N+YIGWG K +  N+ P  PA I  EY  G EITE++DPT +EE+ALK
Sbjct:  192 IQNAKAYLLRTSMSCNLSLYEHLVNLLTKILNQRPEDPLSILESLNRTMQWEWFHPKLDTLRDDPEMQPTYEMAEKQKALFIRGGGEGEQEMEEEVTDSPVPNIMETAFYFEQAGVGLSSDESFRIFLALKQLVEQQPIHMCRFWGKILGLSRSYLVAEVEFREGEEEGEEEEVEEMMEGGEVLETHGEEEGEEDEEKVVDSVPKPQWKPPPIIPKEESRSGTNKYLYFVCNEPGRPWTRLPHVTPAQIVCARKIKKFFTGFLDTPVISYPPFPGNEANYLRAQIARISAATHISPLGFYQFGEEEGDEEEEGGAGRDSFEENPDFEGIPVLELVD-SMANWVHHTQHILPQGRCTWVNPLQKTEEEEELGEEEEKADEAMEEVEQEVGPPLLTPLSEDAEIMHLSPWTTRLSCSLSPQYSVAIVRSNLWPGAYAYATGKKFENIYIGWGHKYSPENFNPMLPALIQQEYPSGPEITEMSDPTVEEEQALK 681          
BLAST of Radial spoke head protein 4-like protein A vs. UniProt/SwissProt
Match: sp|A1L0Z6|RSH6A_XENTR (Radial spoke head protein 6 homolog A OS=Xenopus tropicalis OX=8364 GN=rsph6a PE=2 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 4.428e-110
Identity = 235/472 (49.79%), Postives = 310/472 (65.68%), Query Frame = 3
Query:  192 NGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVRENRLKSDS----YGQDMSIDVGLAEIQKELFSKGDGDEEEAVPEDDI-ETPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTF-DNXXXXXXXXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKNXXXXXXXXXXXXXXXXXXXR----GPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTPQEEEALK 1574
            +G SL+ HL+  + +IL ERP NAL++FE+ S  +  +RLK  S      ++ S     AE+Q+ LFS+GDG+ EE+  E ++ E+PLPN++  A   +Q G+ + R+E  R+SLA+K+L +T P++   FWGKI G   +Y VAEV+     ++  EE  E E   E  ++  ++E EE EDLPPKS+++ PPVIPKEE  TGANK VY+VC+EAG  W+RLP VTPAQI   RKI+  FTG LDA V + PPFPG EINLLRAQIARISAGT +SP+G+Y F + E EE EE  ++D Y ENPD+  + + EL + SLSNWVHH  HILPQGRCVW N + K+E+E +EEE E  E   E E     GP LLTP+S+D  +    PWT  +S+  IP YA+ V+ SNLW GA+  +  K F N+YIGWG K     Y+P  P     EY  G EITE  DPT +EE+ALK
Sbjct:   30 SGLSLYEHLSALLSRILSERPPNALEVFESLSAELHWSRLKQGSDVLRAPREESHTCRKAEVQRALFSRGDGEGEESEAEGEMTESPLPNLLDLAHLLQQGGVNLGRDEAVRISLALKRLTDTHPLQVCHFWGKILGSGGSYLVAEVQFREGEDDEAEEGGEEEEKGEVEDDVEEEENEEAEDLPPKSTYRPPPVIPKEENGTGANKHVYYVCSEAGAEWVRLPPVTPAQISAARKIRHLFTGNLDAPVITYPPFPGTEINLLRAQIARISAGTHVSPLGYYQFGEEEGEEEEEGAVRDTYEENPDFEGIPVSELVE-SLSNWVHHVQHILPQGRCVWVNTSVKSEEEEDEEEAEEEEKEEENEPEPEVGPPLLTPLSEDAEIGQTPPWTAFLSTHLIPHYALAVLRSNLWPGAYTVSSAKKFENIYIGWGLKYMPEGYSPPAPPAPQAEYPSGPEITESTDPTVEEEQALK 500          
BLAST of Radial spoke head protein 4-like protein A vs. TrEMBL
Match: A0A0B7B924 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF167247 PE=4 SV=1)

HSP 1 Score: 429.483 bits (1103), Expect = 4.549e-141
Identity = 259/481 (53.85%), Postives = 333/481 (69.23%), Query Frame = 3
Query:  162 KTYLTASQLENGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVRENRLKS--DSYGQ--DMSIDVGLAEIQKELFSKG-DGDEEEAVPEDDIETPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--WKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTFDNXXXXXXXXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKNXXXXXXXXXXXXXXXXXXXR---GPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTPQEEEALK 1574
            K+YL  +    G +L+ HL+  + KIL+ERP+N +DIFE+ S + +  +  +  D+     D S +V LA+IQ++LF+K  D  E+E + E+D+ETPLPN+M   FF+EQAG+ +NREE+ RV LA+K LV+T P++  RFWGKIFG  QNYY+AEVE+REGEE EEEE+E E   ED    + D   + E+        +K PP+IPKE+ +TGAN+KVYF+CN+ GKPWIRLP V P QI   R+IKKY TG LDA V S PPFPG E N LR+QIARISAGT ISP+GFY FD EEEE EE   +D+++EN D+  +  KEL DPSLSNWVHH +HILPQGRC WWNP QKNE+E ++EEEE  +   +      GP LLTP+S+D  +  L  W+  +SSS IP+Y++ V+ SNLW GAHAFAF K F N+YIG+G K    NY P PP  I  E+    EITE  DPTP+EE ALK
Sbjct:   29 KSYLLTASTNTGMNLYDHLSRVLGKILDERPDNVIDIFEDISKDEKRTKFTASQDTIQDKVDRSTEVALAQIQRKLFTKATDDGEDELIREEDVETPLPNLMEICFFFEQAGIGLNREEMVRVWLALKSLVDTHPLQHVRFWGKIFGTEQNYYIAEVEYREGEEEEEEEDEPEETPEDELSIKDDAALKEEEEDDTPKPDFKPPPIIPKEDNKTGANRKVYFICNDPGKPWIRLPSVQPQQIITARQIKKYMTGRLDAAVVSYPPFPGNESNYLRSQIARISAGTHISPLGFYQFDEEEEEEEEAEGRDHFVENIDFEGVPAKELIDPSLSNWVHHVHHILPQGRCTWWNPIQKNEEELDDEEEEEEKEEPDEPEPEVGPPLLTPVSEDDGIGSLPSWSPALSSSLIPQYSIAVMHSNLWPGAHAFAFEKKFENIYIGFGHKYKPENYTPPPPPAIQEEFPSLPEITEADDPTPEEEAALK 509          
BLAST of Radial spoke head protein 4-like protein A vs. TrEMBL
Match: R7UDR4 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_150439 PE=4 SV=1)

HSP 1 Score: 427.943 bits (1099), Expect = 1.882e-140
Identity = 247/480 (51.46%), Postives = 331/480 (68.96%), Query Frame = 3
Query:  123 NDSQNSVEMISALKTYLTASQLENGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVRENRLKSD----SYGQDMSIDVGLAEIQKELFSKGDGDEEEAVPEDDIETPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX----XWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTFDNXXXXXXXXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKN---XXXXXXXXXXXXXXXXXXXRGPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEI 1529
            N+ +N  +  +  K+YL     + G SL+ HL   + +IL+ERP + +D FE+ S + ++ +  S+        D S +V LAEIQ++LFSKG+G++ E +PE+D+ETPLPN+M   +++EQAG+ +NREE+ R+ LA+K LV+  P++  RFWGKIFG  QNY +AEVE+REGE+ EEEEEE E   E+    + ++++E E+          +K PPV+PKEE RTGANKK YF+CN+ GKPW++LP VTPAQI + RK+KK+FTG LDA V   PPFPG E N LRAQIAR+SAGT ISP+GFY FD EEEE EE   +D ++EN ++  + ++EL DPSLSNWVHH  HILPQGRC WWNP QKN    ++ EE+EE       E E GP LLTP+S+D  V+ + PWT +ISS  +P+YA++V+ SNLW GAHAFA  K F NVYIGWG K   +NY+P P   I  E+  G EI
Sbjct:    7 NNEKNGSDQFTNAKSYLLQVSTKTGLSLYEHLAAVLSRILDERPKDVVDTFEDLSRDQKKAKFTSEVDTVQDKIDKSTEVALAEIQEKLFSKGEGEDAEEIPEEDVETPLPNLMELCYYFEQAGVGLNREEMVRIWLALKNLVDNHPLQHVRFWGKIFGTEQNYIIAEVEYREGEDEEEEEEEAEETHEEDTTEKDNDDDEDEENEEDDIPKPDYKPPPVVPKEENRTGANKKTYFICNDPGKPWVKLPSVTPAQISLARKVKKFFTGRLDAPVVCYPPFPGNEANYLRAQIARVSAGTHISPLGFYQFDEEEEEEEEGGGRDTFVENLEFEGIPVRELVDPSLSNWVHHVQHILPQGRCQWWNPVQKNEDDFEDEEEDEEREEPDEPEPEEGPPLLTPLSEDNEVDSMPPWTPKISSKLVPQYAISVMHSNLWPGAHAFATEKKFENVYIGWGHKYASDNYSPPPVPAIQEEFSSGPEI 486          
BLAST of Radial spoke head protein 4-like protein A vs. TrEMBL
Match: A0A2C9K7T3 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106056903 PE=4 SV=1)

HSP 1 Score: 425.246 bits (1092), Expect = 1.842e-139
Identity = 260/486 (53.50%), Postives = 332/486 (68.31%), Query Frame = 3
Query:  162 KTYLTASQLENGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVRENRLKSD----SYGQDMSIDVGLAEIQKELFSK-GDGDEEEAVPEDDIETPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------XWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTFD-NXXXXXXXXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKNXXXXXXXXXXXXXXXXXXXR---GPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTPQEEEALK 1574
            K YL  S    G +++ HL+  + KIL+ERP+N +DIFE+ S + +  +  SD        D S +V LA+IQ++LF++ G+  EEE   ++D+ETPLPN+M   FF+EQA + +NREEV R+ LAMK LV+  P++  RFWGKI G  QNYYVAEVE+REG+E E+EEEETE  +E+  +  +D  EE ED   +        +K+PPV+PKEE RTGANKK YFVCN+ GKPW++LP V+P QI   R+IKKYFTG LDA V S PPFPG E N LR+QIARISAGT ISP GFY FD  EEEE E E  +D+++EN D+  + ++ELADPSLSNWVHH  HILPQGRC WWNP QK E++FEE+EEE      +      GP LLTPI++D  V G+  WT  +SS  I +++V V+ SNLW GAHAFA  K F N+YIG+G K    NY P  P  I  E+  G EITE  DPTP+EE AL+
Sbjct:   22 KAYLLQSSTATGLNVYDHLSRVLGKILDERPDNVVDIFEDISKDCKRTKFTSDVDTIQDKVDRSTEVALAQIQRKLFTRVGEDGEEEVAQDEDVETPLPNLMELCFFFEQAAIGLNREEVVRIWLAMKNLVDNHPLQHVRFWGKILGTEQNYYVAEVEYREGDEEEDEEEETEEAKEEDKDIDKDAGEEGEDEETEEDDIPKPDFKSPPVVPKEENRTGANKKTYFVCNDPGKPWVKLPMVSPNQISAARQIKKYFTGRLDAPVVSYPPFPGNEANYLRSQIARISAGTHISPSGFYQFDEEEEEEEEGEGGRDHFVENIDFEGIPVRELADPSLSNWVHHVQHILPQGRCSWWNPVQKAEEDFEEDEEEEEREEPDEPEPEVGPPLLTPIAEDEEVGGMPAWTPTLSSQLISQFSVAVMHSNLWPGAHAFAIDKKFENIYIGYGHKYKPENYTPPNPPPIQEEFPSGPEITEADDPTPEEEAALR 507          
BLAST of Radial spoke head protein 4-like protein A vs. TrEMBL
Match: V4ABQ0 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_118662 PE=4 SV=1)

HSP 1 Score: 422.55 bits (1085), Expect = 2.659e-138
Identity = 260/484 (53.72%), Postives = 347/484 (71.69%), Query Frame = 3
Query:  144 EMISALKTYLTASQLENGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVRENRL--KSDSYGQ--DMSIDVGLAEIQKELFSKGDGDEEEAVPEDDIETPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTFDNXXXXXXXXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKN---XXXXXXXXXXXXXXXXXXXRGPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTPQEEEALK 1574
            E I A K+YL  +    G +L+ HL+  + ++L+ERPNN  DI E+ S++ + ++   K+D+     D S +V LA++QK+LFSKG+G+EEE  P++++ETPLPN+M  +F++EQA + +NREEV RV LA+K LV+  P++  RFWGKI G  QNYYVAEVE+REG+E EEEEEE E    +++++ + EEE  ED  PK  +K+P + PKE+ RTG NKK YFVCNE GKPW++LP V P Q+ + RKIKK+FTG LDA V   PPF G E N LRAQIARISAGT ISP+GFY FD EEEE EE   +D+++EN D+  + ++ELADPSL+NWVHH  HILPQGRC WWNP QK+    ++ +EEEE       E E GP LLTPI++D  V G+ PWT ++SS+ IP+Y++ V+ SNLW GAHAFAF K F N+YIG+G K  Q+N++P PP  +  E+  G EITE  DPTP+EE AL+
Sbjct:   26 EFIKA-KSYLLTASTNTGMNLYDHLSKVLNRVLDERPNNVADIIEDISNDTKRSKFTSKADTVQDKVDKSTEVALAQLQKKLFSKGEGEEEEPQPDEEVETPLPNLMELSFYFEQAAIGLNREEVIRVWLALKNLVDNHPLQHVRFWGKILGTEQNYYVAEVEYREGDEEEEEEEENEEDTTEKDDAEEGEEETEEDDIPKPEFKSPALPPKEDNRTGVNKKTYFVCNEPGKPWVKLPAVNPTQVSVARKIKKFFTGRLDAPVVCYPPFTGNESNYLRAQIARISAGTHISPLGFYQFDEEEEEEEEGEARDHFVENLDFEGITVRELADPSLTNWVHHVQHILPQGRCSWWNPVQKSEDDFEDEDEEEEREEPDEPEPEVGPPLLTPIAEDDEVGGMSPWTPKLSSNIIPQYSIAVMHSNLWPGAHAFAFEKKFENIYIGYGHKYAQDNFSPVPPPAVQEEFPSGPEITEGEDPTPEEEAALR 508          
BLAST of Radial spoke head protein 4-like protein A vs. TrEMBL
Match: A0A267GEL0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011913g4 PE=4 SV=1)

HSP 1 Score: 417.927 bits (1073), Expect = 1.202e-136
Identity = 249/470 (52.98%), Postives = 326/470 (69.36%), Query Frame = 3
Query:  162 KTYLTASQLENGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVRENRLKSDS---YGQ-DMSIDVGLAEIQKELFSKGDGDEEEAVPEDDIETPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTFDNXXXXXXXXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQ--KNXXXXXXXXXXXXXXXXXXXRGPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTP 1553
            KTYL ++    G +L+ HL  C++KILEERP + +DIFE+ S   + +RL  D     G+ D S ++ LAEIQK LF++ DGD++EA+ EDD +  LPN++  AFF+EQ G+ ++++E+YR+ L++KKLV+ +P+EK RFWGK+ G  QNYYVAEVEFREGE  EE EEE E   +D+++   +EEE  +D P  +   APPV PKEE  TGANK  YFVCNE GK WIRLP+ TPAQI + R+IKK+FTG LDA + + PPFPG E N LRAQIARISAGT +SP  FYTF  EEEE E+    ++  ENP+Y P  ++ LADP    W HH  HILPQGR  WWNP Q  ++E+  +EEEE+  +   + E GP LLT +S+D  ++G+QPWTVR+SS  +  +AVTVVSSNLW GAHA A GK   N+YIGWG K    NY+P PP  ++ E+V   E+ E  DPTP
Sbjct:   26 KTYLLSTTNSTGINLYEHLVTCLRKILEERPRDVVDIFEDISKECKRSRLAGDGDSLRGKLDRSTEIALAEIQKRLFNRPDGDDDEAMGEDDADPRLPNLLQLAFFFEQGGVGIDKDEIYRIWLSLKKLVDEKPIEKLRFWGKVLGTEQNYYVAEVEFREGEGEEEAEEEAEPERDDKDDEEGEEEETEDDTPKPNFKPAPPV-PKEEPGTGANKYAYFVCNEPGKAWIRLPNATPAQIHVARRIKKFFTGRLDAPIVTYPPFPGTEANYLRAQIARISAGTHVSPKDFYTFGEEEEEEEDGVGHESCAENPEYEPPPVRALADPEA--WAHHVLHILPQGRTRWWNPVQIDEDEELEDEEEEKEEQPQPQPEVGPPLLTSLSEDAPIDGMQPWTVRLSSGLVQRFAVTVVSSNLWPGAHAVASGKVCENIYIGWGHKFTSENYSPAPPPPVMAEFVSDPELKETDDPTP 492          
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Cavefish
Match: rsph4a (radial spoke head component 4A [Source:ZFIN;Acc:ZDB-GENE-030131-7437])

HSP 1 Score: 335.88 bits (860), Expect = 3.550e-108
Identity = 228/484 (47.11%), Postives = 309/484 (63.84%), Query Frame = 3
Query:  159 LKTYLTASQLENGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVRENRLKSDSYGQDMSI-----DVGLAEIQKELFSKGDGDEEEAVPEDDIETPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTFDNXXXXXXXXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKNXXX----XXXXXXXXXXXXXXXXRGPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTPQEEEALKAS 1580
             K +L  S  +  ++ + HL   + K+++ERP NA+D+FE+ S  V+ N+L+ D+     SI        LA+ QK LF +G GDE+E   E   ETPLPN++  +FF++QA + + REE  R+ LA+K+LV+TQ +++ RFWGKI G   NY VAEVE R+ EE + EE + +  EE+  +  +       +    KS++K PP +P E   +G NK  YFVC E G PW+RLP VTPAQI + R+I+K FTG LDA + + PPFPG E N LRAQIARISAGTQ+SP+GFY F+ EEEE  EE  +DN+IENP++  + + ++ + SLS WVHH  HI  QGRCVW   ++K E+E     E EE E      E E GP LLTP+S+D +V    PW+ RISS+ IPEYA+  V SNLW GA+A+A G +F N+YIGWG K     Y P  P     EY    EITE+ DP+ +EE+ALKA+
Sbjct:   21 FKAFLLKSSTKTNQN-YDHLARVLTKVMDERPPNAVDVFEDISLQVKANQLQ-DNQSTLRSIPENNAAFALAQEQKALFIRGAGDEQE---EGMAETPLPNLVEQSFFFDQAEVGLGREETQRIFLALKQLVDTQHLQRCRFWGKILGREANYIVAEVECRDEEEEQAEETQKDEEEEEARDEDEVGVGVHINDLLPKSTYKPPPSVPMEARSSGTNKFSYFVCREPGLPWVRLPDVTPAQIVVARQIRKLFTGHLDAPIITYPPFPGNEANYLRAQIARISAGTQVSPLGFYVFEEEEEEEAEEGARDNFIENPEFEGIPVPDMVE-SLSTWVHHVQHINKQGRCVWVRISEKTEEELDDEAEGEEREEEPDEPEPEVGPPLLTPLSED-AVNNTPPWSTRISSNLIPEYAIAYVRSNLWPGAYAYASG-NFENIYIGWGLKYLGEPYTPPMPPTPQQEYPSEPEITEVLDPSVEEEQALKAA 496          
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Sea Lamprey
Match: rsph4a (radial spoke head component 4A [Source:ZFIN;Acc:ZDB-GENE-030131-7437])

HSP 1 Score: 273.478 bits (698), Expect = 5.955e-85
Identity = 152/283 (53.71%), Postives = 198/283 (69.96%), Query Frame = 3
Query:  741 WKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTFDNXXXXXXXXTI--QDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKNXXXXXXXXXXXXXXXXXXXR-----GPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTPQEEEA 1568
            +K PPV  +E  R GAN+  YFV NE GKPW +LP VTPAQI   R+I++ FTG LDA V S PPFPG E NLLRAQIARISAGTQ+SP+GFY F+ +EEE EE+ +  ++  IENPD+  + ++EL D +L+NWVHHT HILPQGRCVW NP Q++ED  EEE+EE  E T E +      GP LLTP+S+D  +EG  PWT R+SS+ +P++A +V+ SNLW G++A+  GK F N+Y+GWG K     ++P        EY GG E+ E  DP+ +EE+A
Sbjct:  202 YKPPPVTRREAMRFGANRYTYFVTNEPGKPWEKLPWVTPAQIVTARRIRRLFTGHLDAPVISYPPFPGNEANLLRAQIARISAGTQVSPLGFYQFEEDEEEGEEDAVGGRETCIENPDFEGIPVRELVD-NLANWVHHTQHILPQGRCVWINPKQRSEDPEEEEQEEDEEDTEEPDEPEPEVGPPLLTPLSEDAEIEGTAPWTARLSSTAVPQHAFSVLRSNLWPGSYAYCKGKIFENLYMGWGVKYVAGGFSPALVPMPCSEYAGGPEVAEEKDPSVEEEQA 483          

HSP 2 Score: 108.227 bits (269), Expect = 3.430e-25
Identity = 48/136 (35.29%), Postives = 89/136 (65.44%), Query Frame = 3
Query:  207 FSHLTNCIKKILEERPNNALDIFENYSDNVRENRLK--SDSYGQDMSIDVG--LAEIQKELFSKGDGDEEEAVPEDDIETPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNY 602
            + HL + + ++L+ERPN ALD+FE  S  V+ +R+   + ++  + + +    LA++Q+ LF   +   ++   ++ +E+PLPN++  AF++EQAG+ + REE +R+ LA+K+LV+ QP+++ RFWGK+      Y
Sbjct:    1 YDHLASLLSRLLDERPNGALDMFEELSREVKRSRMAGVATTFRDERTTNAQDELAKLQRGLFPAANDKTDDDPDDEMVESPLPNLLEQAFYWEQAGVGLGREETFRILLALKQLVDEQPLQRCRFWGKVLATQGAY 136          
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Nematostella
Match: EDO47350 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMI3])

HSP 1 Score: 382.874 bits (982), Expect = 4.921e-127
Identity = 246/485 (50.72%), Postives = 332/485 (68.45%), Query Frame = 3
Query:  150 ISALKTYLTASQLENGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVRENRLKSDSYGQDMSIDVGLAEIQKELFSKGDGDEEEAVPED-DIETPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTFDNXXXXXXXXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKNXXXXXXXXXXXXXXXXXXXR---GPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTPQEEEALKASK 1583
            I   K YL  +   + K+L+ HL+  I K+L+ERPNN +D+ E++S+ V+    +        + D   AE+Q++LF K    E      + D+ETPLP++M  AF++EQAG+ ++REE++R+ L++K+LV+++P++   FWGK+FGI  NYY+AEVE+REGEE EEEEEE    EE+  E  ++EE+E         KS WK PPVIPKEE R GANKKVYFV  E GKPWI+LP VTPAQI I+R+I+K+ TG LDA + S PPFPG E N LRAQIARISAG+ ISP G+Y F+ EEEE EE   +D+Y+ N D+  ++++ELADPSL+NWVHH  HILPQGRCVW NP +K E+EFEEEEE+     VE  +   GP+LL  ++ D  V G+  WT  +SS  +P+YA+ V+ SN W GA+AFA  K F N+YIGWG K + +NY P PP   + EY    E+TE+ DPT +EE ALK ++
Sbjct:    9 IQNAKAYLLKNNASSNKNLYDHLSEVISKVLDERPNNCVDVLEDFSNKVKIGEKEKVEDESAKAQDKETAEMQQKLFEKEGAGEGGEPEAEEDVETPLPDLMNLAFYFEQAGIGLSREEMFRIFLSLKQLVDSKPLQTVHFWGKLFGIENNYYIAEVEYREGEEEEEEEEEEGEGEEEEKEKEENEEDEEVAEEDDTPKSDWKPPPVIPKEENRAGANKKVYFVTTEPGKPWIKLPPVTPAQIGISRQIRKFLTGRLDAPIVSYPPFPGNETNYLRAQIARISAGSHISPAGYYMFEEEEEEEEEGEERDSYMLNVDFEGINVRELADPSLNNWVHHVQHILPQGRCVWHNPIEKTEEEFEEEEEDEERDEVEEPKKETGPTLLMSVADDEPVNGMPAWTPYVSSELLPKYALAVMRSNRWPGAYAFAKDKKFENIYIGWGHKYDASNYTPPPPPPTMEEYPTVPEVTEVDDPTVEEERALKKAQ 493          
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Nematostella
Match: EDO48571 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIU6])

HSP 1 Score: 352.829 bits (904), Expect = 4.169e-115
Identity = 218/499 (43.69%), Postives = 316/499 (63.33%), Query Frame = 3
Query:  150 ISALKTYLTASQLENGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVRENRLKSD----SYGQDMSIDVGLAEIQKELFSK--------GDGDEEEAVPEDDIETPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXXXXX-----XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTFDNXXXXXXXXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKNXXXXXXXXXXXXXXXXXXXR----GPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTPQEEEALKASK 1583
            I   K+YL  +   +  +++ HL + + ++L +RP  + +I +    + +    K +       QD S +V LA  Q+ LF +         + + +  + ED +E+PLP++M  A ++EQAG+ +NREE +R+ LA+K+LV++ P+   R WGKI G+  NY +AEVEF E       E  +E E     +  +++    + +  +D  PK+ +K P  +PKEE RTG NKK YFVC EAGKPW+RLP VTPAQI++ R+IKK+FTG LDA V S PPFPG E N LRAQIARISA T ISP+G+Y F+ EEEE +E   +D ++ N ++  L + ++ DPS +NWVHH  +ILPQGRC W+NP+QK ++E  EEE+E  E     E     GP LLTP+S+D  V+G+ PW    SS+ +P+Y+++V+ SNLW GAHAFA  + F N+Y+GWG K   +NY+P PP     EY  G +ITE  DP+ +EE+ALKA++
Sbjct:   16 IHNAKSYLLKTSASSNINVYDHLASVLTQLLTDRPEASTEILDELVRDKKRAVFKPNFDTIQDQQDDSTEVLLARTQQTLFERRPEKSFIEPEPEPDPELDEDLLESPLPDIMELANYFEQAGVGLNREETFRIFLALKQLVDSHPIRSCRLWGKILGLQGNYIIAEVEFHEGEDPLDMEEPQEHEHILTPDYRKSKHHLKDFDVEDDDIPKADYKPPSFVPKEENRTGCNKKTYFVCTEAGKPWVRLPSVTPAQIRVARQIKKFFTGNLDAPVVSYPPFPGNEANFLRAQIARISATTHISPLGYYMFEEEEEEEDEAAARDTFVVNQEFEGLTVGDMTDPSCANWVHHVQYILPQGRCSWFNPSQKKDEEEMEEEDEEEEREEPDEPEPETGPPLLTPLSEDGEVDGMPPWATHKSSTLVPQYSISVMHSNLWPGAHAFALERKFENIYVGWGQKYAADNYSPPPPPVPQEEYPSGPDITEAEDPSVEEEKALKAAQ 514          
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Medaka
Match: rsph4a (radial spoke head protein 4 homolog A [Source:NCBI gene;Acc:101159735])

HSP 1 Score: 276.944 bits (707), Expect = 2.338e-86
Identity = 184/437 (42.11%), Postives = 262/437 (59.95%), Query Frame = 3
Query:  153 SALKTYLTASQLENGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVRENRLKSD--SYGQDMSIDVG--LAEIQKELFSKGDGDEEEAVPEDDIETPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTFDNXXXXXXXXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQK----NXXXXXXXXXXXXXXXXXXXRGPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVY 1439
            ++ K +L  S   + ++L+ HL   + KI++ERP++A+D+ E+ S  ++    K    S    ++  VG  LAE Q  LF        E   +  +ET  PN+  +AF+ EQAG+ + REE+ R+ LA+K LV +  + + R WGKI G   +Y +AE E+ EG+E +  +E+ +  EE+ + ++++E +          +  PP++PKE   TGAN+  YFVCNE G PW++LP V+PAQI   R I K FTG LD+ V S PPFPG E N LRAQIARISAGTQ+SP GFY    EE E EEE   D  + NP++  +   E+A  SLS+WVHH  HIL QGRC W N   K    + +E E  E++      E E GP LLT +SQD  +    PW++R+SS+  P++AV V+ SNLW GA A++ GK F N+Y
Sbjct:   25 ASFKAFLQKSSSRSDRNLYDHLVLLLAKIMDERPDDAVDVLEDMSLELKRASFKDTQRSLRDHVTPSVGERLAEQQLLLFKHAQDFNHE---DPTVETGFPNVNESAFYLEQAGVGLGREEMQRILLALKLLVESHGLPQCRLWGKILGTESSYIIAEAEYTEGDEEQSTDEDLQEEEEEESGTQENETDPVPRST----YLHPPMVPKEALGTGANRFFYFVCNEPGLPWVKLPSVSPAQITAARHICKGFTGRLDSPVLSYPPFPGKEANYLRAQIARISAGTQVSPSGFYQTVEEEGEEEEEMAHDQCLVNPEFEGVSSLEMAQ-SLSSWVHHIQHILKQGRCTWVNTAMKVEEDSIEEEEAAEKDEQADEPEPEYGPPLLTNLSQDAEMFHTPPWSLRLSSTITPQHAVAVLRSNLWPGAFAYSNGKRFENIY 453          
BLAST of Radial spoke head protein 4-like protein A vs. Planmine SMEST
Match: SMESG000044927.1 (SMESG000044927.1)

HSP 1 Score: 875.159 bits (2260), Expect = 0.000e+0
Identity = 503/505 (99.60%), Postives = 504/505 (99.80%), Query Frame = 3
Query:   75 MSIKSFEINESKSYDRNDSQNSVEMISALKTYLTASQLENGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVRENRLKSDSYGQDMSIDVGLAEIQKELFSKGDGDEEEAVPEDDIETPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTFDNXXXXXXXXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKNXXXXXXXXXXXXXXXXXXXRGPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTPQEEEALKASKTV 1589
            MSIKSFEINESKSYDRNDSQNSVEMISALKTYLT +QLENGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVRENRLKSDSYGQDMSIDVGLAEIQKELFSKGDGDEEEAVPEDDIETPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYVAEVEFREGEEIEEEEEETEVVEEDRNESRQDEEEEPEDLPPKSSWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTFDNEEEEAEEETIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKNEDEFEEEEEEVMETTVEAERGPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTPQEEEALKASKTV
Sbjct:    1 MSIKSFEINESKSYDRNDSQNSVEMISALKTYLTVNQLENGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVRENRLKSDSYGQDMSIDVGLAEIQKELFSKGDGDEEEAVPEDDIETPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYVAEVEFREGEEIEEEEEETEVVEEDRNESRQDEEEEPEDLPPKSSWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTFDNEEEEAEEETIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKNEDEFEEEEEEVMETTVEAERGPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTPQEEEALKASKTV 505          
BLAST of Radial spoke head protein 4-like protein A vs. Planmine SMEST
Match: SMESG000044179.1 (SMESG000044179.1)

HSP 1 Score: 343.969 bits (881), Expect = 4.816e-111
Identity = 216/484 (44.63%), Postives = 302/484 (62.40%), Query Frame = 3
Query:  162 KTYLTASQLENGKSLFSHLTNCIKKILEERPNNA-LDIFENYSDNVREN---RLKSDSYGQDMSIDVGLAEIQKELFSKGDGDEEEAVPEDDIE--TPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---------WKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTFDNXXXXXX--XXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKNXXXXXXXXXXXXXXXXXXX---RGPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTP 1553
            K++L     + G SL+  L   I+K+ EE+ +N  ++I E      REN   +  +     + S++  LAE+QK LF     +      +DD+E  T LPN+M T +++EQA + +NREE  R+ LAMK LV  QP+   RFWGK+FG  +NYY+ E E  EG++   +E +    +ED+    + E  +  +   +           WK+P ++P EE   G NKKVYFVCN  G+ W RL  VTPAQI  +R I+KY TG LD+++ S PPFPG E + LRA I+RISA T ISP+GFYTFD EEEEAE  ++  +  ++E+P++  + L++L DPSL+NW HH  +ILPQGR  WWNPT KN +E EEEE+E  +  ++      GP LLTPI++D  V G+  W+  +SS+ +P+YAV V+SSNLW GAHAFA GK F+N+YIGWG K    N+ P   A +  E++ G+EITEI DPTP
Sbjct:   33 KSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHI--DDDLEEKTKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEELEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDEEEEEAEEEDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTEEIEEEEDEEEKEEMDEPEPESGPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPTP 514          
BLAST of Radial spoke head protein 4-like protein A vs. Planmine SMEST
Match: SMESG000079294.1 (SMESG000079294.1)

HSP 1 Score: 328.561 bits (841), Expect = 2.509e-106
Identity = 199/416 (47.84%), Postives = 270/416 (64.90%), Query Frame = 3
Query:  354 LAEIQKELFSKGDGDEEEAVPEDDIE--TPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---------WKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTFDNXXXXXX--XXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKNXXXXXXXXXXXXXXXXXXX---RGPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTP 1553
            LAE+QK LF     +      +DD+E  T LPN+M T +++EQA + +NREE  R+ LAMK LV  QP+   RFWGK+FG  +NYY+ E E  EG++   +E +    +ED+    + E  +  +   +           WK+P ++P EE   G NKKVYFVCN  G+ W RL  VTPAQI  +R I+KY TG LD+++ S PPFPG E + LRA I+RISA T ISP+GFYTFD EEEEAE  ++  +  ++E+P++  + L++L DPSL+NW HH  +ILPQGR  WWNPT KN +E EEEE+E  +  ++      GP LLTPI++D  V G+  W+  +SS+ +P+YAV V+SSNLW GAHAFA GK F+N+YIGWG K    N+ P   A +  E++ G+EITEI DPTP
Sbjct:    5 LAELQKSLFENASFNIHHI--DDDLEEKTKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEELEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDEEEEEAEEEDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTEEIEEEEDEEEKEEMDEPEPESGPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPTP 418          
BLAST of Radial spoke head protein 4-like protein A vs. Planmine SMEST
Match: SMESG000018289.1 (SMESG000018289.1)

HSP 1 Score: 188.734 bits (478), Expect = 2.812e-52
Identity = 136/285 (47.72%), Postives = 178/285 (62.46%), Query Frame = 3
Query:  768 EEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTFDNXXXXXXXXTIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKNXXXXXXXXXXXXXXXXXXXRGPS---------LLTPISQDFSVEGLQPWTVRISSSRIP-EYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKE---ITEIADPTPQEEEALKASK 1583
            EE   GANK +YF CNE GKPW RLP VTP QI ++R+I K+FTG    +V S PPFPG EINLL  Q+ RISA T +SP GFY   +EEEE EE+ + +N I+  ++ P  L+EL DP L+ WVHH  HIL QGRC + +P  K+E+E EEEEEE  E   E               LL+P+ +D  + G   W VRISS  +P +YAV  +SS  W GAHAFA G++F N+Y+G+G K   +NY+P    +I+ EYV  +    + E  DPT ++E  L+A K
Sbjct:  245 EEKGRGANKNIYFACNEPGKPWFRLPRVTPEQITVSRQITKFFTGRPGEDVISFPPFPGKEINLLAVQVIRISAATYVSPSGFYE-MDEEEEPEEDEVPENLIQAEEFEPPELEELLDPELTGWVHHGLHILKQGRCQYADPKAKDEEEEEEEEEEEEEEEEEGAEEAEEEEPEEGPPLLSPLEEDDPINGNPAWRVRISSLLVPPKYAVVCLSSLRWPGAHAFAQGQNFANLYLGFGHKYIADNYSPIDLPKIMKEYVHPERKPPLKEALDPTIEDEAKLEAMK 528          

HSP 2 Score: 116.316 bits (290), Expect = 3.227e-27
Identity = 66/163 (40.49%), Postives = 99/163 (60.74%), Query Frame = 3
Query:  162 KTYLTASQLENGKSLFSHLTNCIKKILEERPNNALDIFENYSDNVRENRLKSDS---YGQ-DMSIDVGLAEIQKELFSKGDGDEEEAV---PED--------DIETPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYY 605
            K YL +   + G +L+ HL + IK +LE  PNNA+D FE  S  V+  R+ ++    +G+ D S +V LA+IQK+LF +     +  +   PE+        + E+PLPN+ML  FF+EQAG+ +NREE++RV + MK+L     + K  FWGK+ G+ QNYY
Sbjct:   20 KGYLQSLSNQTGLNLYDHLVSLIKYLLEHHPNNAVDGFEQISQEVKRLRMGNNDDMMHGKLDPSTEVDLAQIQKKLFWRKLPTADMPIDTEPENPDEIEDDDEEESPLPNLMLNVFFFEQAGVGVNREEIFRVWMGMKQLAKKSRLSKVTFWGKVLGLSQNYY 182          
The following BLAST results are available for this feature:
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RSPH6A2.684e-12350.20radial spoke head 6 homolog A [Source:HGNC Symbol;... [more]
RSPH4A2.908e-12351.03radial spoke head component 4A [Source:HGNC Symbol... [more]
RSPH6A5.290e-11754.25radial spoke head 6 homolog A [Source:HGNC Symbol;... [more]
RSPH6A2.660e-10348.37radial spoke head 6 homolog A [Source:HGNC Symbol;... [more]
RSPH4A7.366e-8150.98radial spoke head component 4A [Source:HGNC Symbol... [more]
back to top
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG31213.966e-2932.34gene:FBgn0034957 transcript:FBtr0072161[more]
back to top
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rsph4a8.537e-10844.06radial spoke head component 4A [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cc2d2a7.486e-11149.79coiled-coil and C2 domain containing 2A [Source:Xe... [more]
back to top
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Rsph4a2.069e-12449.28radial spoke head 4 homolog A (Chlamydomonas) [Sou... [more]
Rsph6a2.949e-12249.69radial spoke head 6 homolog A (Chlamydomonas) [Sou... [more]
Rsph6a2.977e-3050.72radial spoke head 6 homolog A (Chlamydomonas) [Sou... [more]
back to top
BLAST of Radial spoke head protein 4-like protein A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BYM7|RSH4A_MOUSE1.447e-12349.28Radial spoke head protein 4 homolog A OS=Mus muscu... [more]
sp|Q9H0K4|RSH6A_HUMAN1.289e-12250.20Radial spoke head protein 6 homolog A OS=Homo sapi... [more]
sp|Q5TD94|RSH4A_HUMAN1.396e-12251.03Radial spoke head protein 4 homolog A OS=Homo sapi... [more]
sp|Q8CDR2|RSH6A_MOUSE2.063e-12149.69Radial spoke head protein 6 homolog A OS=Mus muscu... [more]
sp|A1L0Z6|RSH6A_XENTR4.428e-11049.79Radial spoke head protein 6 homolog A OS=Xenopus t... [more]
back to top
BLAST of Radial spoke head protein 4-like protein A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B7B9244.549e-14153.85Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
R7UDR41.882e-14051.46Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A2C9K7T31.842e-13953.50Uncharacterized protein OS=Biomphalaria glabrata O... [more]
V4ABQ02.659e-13853.72Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A267GEL01.202e-13652.98Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rsph4a3.550e-10847.11radial spoke head component 4A [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rsph4a5.955e-8553.71radial spoke head component 4A [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO473504.921e-12750.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485714.169e-11543.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Radial spoke head protein 4-like protein A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rsph4a2.338e-8642.11radial spoke head protein 4 homolog A [Source:NCBI... [more]
back to top
BLAST of Radial spoke head protein 4-like protein A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000044927.10.000e+099.60SMESG000044927.1[more]
SMESG000044179.14.816e-11144.63SMESG000044179.1[more]
SMESG000079294.12.509e-10647.84SMESG000079294.1[more]
SMESG000018289.12.812e-5247.72SMESG000018289.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019565 ID=SMED30019565|Name=Radial spoke head protein 4-like protein A|organism=Schmidtea mediterranea sexual|type=transcript|length=1805bp
TAGTAACGAAGCTGGTAATATTTTACAATTTATTATTTTTATACTTAAAA
CTATTTTAAAATTAATCATTTCTCATGTCAATAAAAAGCTTTGAAATCAA
TGAATCCAAGAGCTACGATAGAAATGATTCTCAAAATAGTGTTGAAATGA
TAAGTGCACTGAAAACCTATTTAACTGCCAGCCAGTTAGAAAATGGAAAA
TCACTATTCTCTCATTTGACAAATTGTATCAAGAAAATTTTGGAAGAAAG
ACCAAACAATGCGCTTGACATTTTCGAGAACTACAGTGACAATGTGAGAG
AAAACAGACTGAAATCAGATAGTTATGGCCAAGACATGTCAATTGATGTC
GGCTTGGCTGAAATTCAGAAGGAATTATTTTCAAAAGGAGATGGAGATGA
AGAGGAAGCAGTTCCAGAAGATGACATTGAGACTCCATTGCCAAACATGA
TGCTAACCGCATTTTTCTATGAACAAGCTGGTTTAGTAATGAATAGAGAA
GAAGTCTATCGAGTTTCGTTGGCCATGAAAAAACTTGTAAATACTCAACC
AGTTGAAAAGGCTCGTTTCTGGGGAAAGATTTTCGGAATTCATCAAAATT
ATTACGTAGCAGAGGTCGAGTTTAGAGAGGGAGAAGAAATTGAAGAGGAA
GAAGAAGAAACTGAAGTTGTGGAAGAAGACAGAAATGAAAGCAGGCAAGA
TGAAGAAGAAGAACCAGAAGACTTGCCACCAAAATCTAGTTGGAAAGCTC
CTCCAGTAATACCAAAAGAGGAATTCAGAACTGGTGCCAATAAAAAGGTG
TATTTTGTCTGTAACGAGGCGGGAAAACCTTGGATTCGTCTGCCACATGT
GACACCGGCTCAGATTCAAATTACTAGAAAAATAAAAAAGTATTTCACTG
GAATGCTTGATGCTGAAGTCAAAAGCTCTCCTCCTTTTCCCGGTTTGGAA
ATCAACTTGCTAAGAGCACAAATTGCTCGAATCAGCGCAGGAACTCAAAT
CTCACCTATCGGTTTCTATACATTTGATAATGAGGAGGAAGAAGCCGAAG
AGGAAACTATTCAGGACAATTATATTGAAAATCCAGATTATGCACCTCTT
CATTTGAAAGAACTGGCAGATCCCTCCTTGTCAAATTGGGTGCACCACAC
GAACCATATATTACCTCAAGGTCGTTGTGTATGGTGGAATCCTACACAAA
AGAATGAAGATGAATTTGAGGAGGAAGAAGAAGAAGTTATGGAAACTACC
GTTGAAGCAGAAAGAGGGCCGTCTTTATTGACACCAATAAGTCAGGATTT
TTCAGTGGAAGGCTTGCAACCTTGGACTGTTAGAATATCTTCGTCAAGGA
TTCCAGAATATGCGGTAACTGTGGTTTCATCAAACTTATGGCTTGGGGCT
CATGCTTTTGCCTTTGGAAAACACTTTAACAATGTCTACATTGGTTGGGG
CTTCAAGGAGAATCAGAATAATTATGCTCCATGTCCTCCTGCTGAAATAT
TGGTGGAGTATGTTGGTGGGAAGGAGATTACCGAAATCGCTGATCCCACC
CCTCAGGAAGAAGAAGCTTTAAAAGCGTCAAAGACTGTAGAGAATGAAGA
AGAACTAGAGGAGGAAGACGAAGAAAACTGATAAATTTTAAGTAGCCTTT
GTTGTAGAATGTCTGAAATAAAATTTGATTTCCACGAAAAAGTTAATAAA
CTTCAATTAAATGTCAAAATTTCTTCTTTATATTATTAGTAAATTTGTAG
TAATTGATTTCAATTAATTTTTGAAATGGAACTTTCATTGTTTCATTGGA
TTGAG
back to top

protein sequence of SMED30019565-orf-1

>SMED30019565-orf-1 ID=SMED30019565-orf-1|Name=SMED30019565-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=519bp
MSIKSFEINESKSYDRNDSQNSVEMISALKTYLTASQLENGKSLFSHLTN
CIKKILEERPNNALDIFENYSDNVRENRLKSDSYGQDMSIDVGLAEIQKE
LFSKGDGDEEEAVPEDDIETPLPNMMLTAFFYEQAGLVMNREEVYRVSLA
MKKLVNTQPVEKARFWGKIFGIHQNYYVAEVEFREGEEIEEEEEETEVVE
EDRNESRQDEEEEPEDLPPKSSWKAPPVIPKEEFRTGANKKVYFVCNEAG
KPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQI
ARISAGTQISPIGFYTFDNEEEEAEEETIQDNYIENPDYAPLHLKELADP
SLSNWVHHTNHILPQGRCVWWNPTQKNEDEFEEEEEEVMETTVEAERGPS
LLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKH
FNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTPQEEEALK
ASKTVENEEELEEEDEEN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0001534radial spoke
GO:0005622intracellular
GO:0005929cilium
Vocabulary: biological process
TermDefinition
GO:0060271cilium morphogenesis
GO:0060294cilium movement involved in cell motility
GO:0008150biological_process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR006802Radial_spoke
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 507..518
NoneNo IPR availableCOILSCoilCoilcoord: 189..209
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 186..212
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 186..229
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 486..518
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 489..507
NoneNo IPR availablePANTHERPTHR13159:SF4RADIAL SPOKE HEAD PROTEIN 4 HOMOLOG Acoord: 26..517
IPR006802Radial spokehead-like proteinPFAMPF04712Radial_spokecoord: 27..502
e-value: 6.6E-177
score: 589.4
IPR006802Radial spokehead-like proteinPANTHERPTHR13159RADIAL SPOKEHEAD-RELATEDcoord: 26..517