Transmembrane protein 26

Overview
NameTransmembrane protein 26
Smed IDSMED30019533
Length (bp)1354
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane protein 26 (SMED30019533) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane protein 26 (SMED30019533) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane protein 26 (SMED30019533) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane protein 26 (SMED30019533) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019533

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30019533SMESG000001147.1 dd_Smed_v4_30929_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019533SMESG000001147.1 dd_Smed_v4_30929_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30019533SMESG000001147.1 dd_Smed_v4_30929_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30019533SMESG000001147.1 dd_Smed_v4_30929_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane protein 26 vs. Ensembl Human
Match: TMEM26 (transmembrane protein 26 [Source:HGNC Symbol;Acc:HGNC:28550])

HSP 1 Score: 55.0694 bits (131), Expect = 5.066e-8
Identity = 30/78 (38.46%), Postives = 44/78 (56.41%), Query Frame = 3
Query:   78 RALIVRLCFASHGLISICLLYKYTYRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEM 311
             AL  RL F  H L+ +  + +      Y+ LA+    LF E+ +TL  K G  +KWF P++F YL S+VPS+W  E+
Sbjct:    8 NALATRLLFLLHSLVGVWRVTEVKKEPRYWLLALLNLLLFLETALTLKFKRGRGYKWFSPAIFLYLISIVPSLWLLEL 85          
BLAST of Transmembrane protein 26 vs. Ensembl Human
Match: TMEM26 (transmembrane protein 26 [Source:HGNC Symbol;Acc:HGNC:28550])

HSP 1 Score: 54.6842 bits (130), Expect = 1.639e-7
Identity = 47/162 (29.01%), Postives = 76/162 (46.91%), Query Frame = 3
Query:   78 RALIVRLCFASHGLISICLLYKYTYRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEM----ELFDFRAFAMEKRIEQLKTTSFNETSEKEERLTVDFEEMEKSVRI----------------SEQXXXXXXXXGRWFLPKG 503
             AL  RL F  H L+ +  + +      Y+ LA+    LF E+ +TL  K G  +KWF P++F YL S+VPS+W  E+    +    +A    +     +   FN+T    E+ T   +++ ++ ++                  Q  LL+LI+GRW LP G
Sbjct:    8 NALATRLLFLLHSLVGVWRVTEVKKEPRYWLLALLNLLLFLETALTLKFKRGRGYKWFSPAIFLYLISIVPSLWLLELHHETQYCSIQAEGTSQNTS--RKEDFNQTLTSNEQ-TSRADDLIETAKVFVNNLSTVCEKVWTLGLHQTFLLMLIIGRWLLPIG 166          
BLAST of Transmembrane protein 26 vs. Ensembl Human
Match: TMEM26 (transmembrane protein 26 [Source:HGNC Symbol;Acc:HGNC:28550])

HSP 1 Score: 54.6842 bits (130), Expect = 1.639e-7
Identity = 47/162 (29.01%), Postives = 76/162 (46.91%), Query Frame = 3
Query:   78 RALIVRLCFASHGLISICLLYKYTYRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEM----ELFDFRAFAMEKRIEQLKTTSFNETSEKEERLTVDFEEMEKSVRI----------------SEQXXXXXXXXGRWFLPKG 503
             AL  RL F  H L+ +  + +      Y+ LA+    LF E+ +TL  K G  +KWF P++F YL S+VPS+W  E+    +    +A    +     +   FN+T    E+ T   +++ ++ ++                  Q  LL+LI+GRW LP G
Sbjct:    8 NALATRLLFLLHSLVGVWRVTEVKKEPRYWLLALLNLLLFLETALTLKFKRGRGYKWFSPAIFLYLISIVPSLWLLELHHETQYCSIQAEGTSQNTS--RKEDFNQTLTSNEQ-TSRADDLIETAKVFVNNLSTVCEKVWTLGLHQTFLLMLIIGRWLLPIG 166          
BLAST of Transmembrane protein 26 vs. Ensembl Celegans
Match: Y119C1B.3 (pep chromosome:WBcel235:I:4550401:4552758:1 gene:WBGene00022469.1 transcript:Y119C1B.3.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y119C1B.3)

HSP 1 Score: 73.9442 bits (180), Expect = 2.251e-26
Identity = 50/148 (33.78%), Postives = 78/148 (52.70%), Query Frame = 2
Query:  536 FSYLGTAADIAEFFDSFKDKTVQNNRFLCLMILGLWSCSLLQFSFVLTAARARKDQSGLISGKNTSVNSYTKYYQSNSTPYLSVFSIKETENKTVFVKCCRYNWFSPDVYGIFISISLQDGPXXXXXXXXXXXXDVVSYTNMFFTAKN 979
             +YL  ++DI EFFD FK+K V +N  +  ++L  W+ SLLQF FVLT +RARK +  +        N Y + + +   P                 + C   ++  D++ IF++  LQD PFL  RL L+   ++++YT +FF  KN
Sbjct:  178 LAYLAISSDIVEFFDVFKEKVVYSNSRVQTIVLTAWTLSLLQFPFVLTVSRARKMRVAI-------TNDYEQLF-ARQRP-----------------RSCFKAFYDVDIWAIFLANVLQDVPFLLVRLYLMTVHNLITYTMIFFFFKN 300          

HSP 2 Score: 63.929 bits (154), Expect = 2.251e-26
Identity = 44/157 (28.03%), Postives = 71/157 (45.22%), Query Frame = 3
Query:   48 HLRMKCATVTRALIVRLCFASHGLISICLLYKYTYRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEMELFDFRAFAMEKRIEQLKTTSFNETSEKEERLTVDFEEMEKSVRISEQXXXXXXXXGRWFLPKGKLSHD 518
            H+ + C    RA++ R  F  H +++I      + R + +  A+    + FE    ++ + G E KWFC SVF Y+ +  P IW  E  + ++R   MEK  E  +T       +    L +   E    V +         I+GRW LPKG +S +
Sbjct:   28 HVLISCL---RAILARGIFIVHSIVTIRQTVLISERESVWGFALLSLLIVFEGGYAIIMRAGDERKWFCTSVFLYIVATAPPIWILETRICNWRT-NMEKNTEGFETLQHPVALKDNSELRLQLLEQLLLVNL---------IVGRWLLPKGDISRE 171          
BLAST of Transmembrane protein 26 vs. Ensembl Celegans
Match: Y119C1B.3 (pep chromosome:WBcel235:I:4549695:4552758:1 gene:WBGene00022469.1 transcript:Y119C1B.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y119C1B.3)

HSP 1 Score: 73.9442 bits (180), Expect = 2.251e-26
Identity = 50/148 (33.78%), Postives = 78/148 (52.70%), Query Frame = 2
Query:  536 FSYLGTAADIAEFFDSFKDKTVQNNRFLCLMILGLWSCSLLQFSFVLTAARARKDQSGLISGKNTSVNSYTKYYQSNSTPYLSVFSIKETENKTVFVKCCRYNWFSPDVYGIFISISLQDGPXXXXXXXXXXXXDVVSYTNMFFTAKN 979
             +YL  ++DI EFFD FK+K V +N  +  ++L  W+ SLLQF FVLT +RARK +  +        N Y + + +   P                 + C   ++  D++ IF++  LQD PFL  RL L+   ++++YT +FF  KN
Sbjct:  178 LAYLAISSDIVEFFDVFKEKVVYSNSRVQTIVLTAWTLSLLQFPFVLTVSRARKMRVAI-------TNDYEQLF-ARQRP-----------------RSCFKAFYDVDIWAIFLANVLQDVPFLLVRLYLMTVHNLITYTMIFFFFKN 300          

HSP 2 Score: 63.929 bits (154), Expect = 2.251e-26
Identity = 44/157 (28.03%), Postives = 71/157 (45.22%), Query Frame = 3
Query:   48 HLRMKCATVTRALIVRLCFASHGLISICLLYKYTYRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEMELFDFRAFAMEKRIEQLKTTSFNETSEKEERLTVDFEEMEKSVRISEQXXXXXXXXGRWFLPKGKLSHD 518
            H+ + C    RA++ R  F  H +++I      + R + +  A+    + FE    ++ + G E KWFC SVF Y+ +  P IW  E  + ++R   MEK  E  +T       +    L +   E    V +         I+GRW LPKG +S +
Sbjct:   28 HVLISCL---RAILARGIFIVHSIVTIRQTVLISERESVWGFALLSLLIVFEGGYAIIMRAGDERKWFCTSVFLYIVATAPPIWILETRICNWRT-NMEKNTEGFETLQHPVALKDNSELRLQLLEQLLLVNL---------IVGRWLLPKGDISRE 171          
BLAST of Transmembrane protein 26 vs. Ensembl Fly
Match: CG14238 (gene:FBgn0039429 transcript:FBtr0085014)

HSP 1 Score: 86.2705 bits (212), Expect = 2.907e-33
Identity = 57/147 (38.78%), Postives = 82/147 (55.78%), Query Frame = 2
Query:  542 YLGTAADIAEFFDSFKDKTVQNNRFLCLMILGLWSCSLLQFSFVLTAARARKDQSGLISGKNTSVNSYTKYYQSNSTPYLSVFSIKETENKTVFVKCCRYNWFSPDVYGIFISISLQDGPXXXXXXXXXXXXDVVSYTNMFFTAKNS 982
            Y+GTAADI EFFDS+KD ++    FL  + LG+WS SL+QF+ VL+A R R+ +    SG                           + +K     CC+      DV+GI +++ LQD PFL FRL +IF++ +++Y N+FFT KNS
Sbjct:  185 YIGTAADIIEFFDSYKDDSIAKIGFLVFLTLGIWSWSLMQFTIVLSATRGRRPRG---SG---------------------------SHHKEEHTDCCQNCCCGIDVWGIVLNVILQDAPFLTFRLLIIFQYKIINYMNVFFTCKNS 301          

HSP 2 Score: 75.485 bits (184), Expect = 2.907e-33
Identity = 55/174 (31.61%), Postives = 82/174 (47.13%), Query Frame = 3
Query:   60 KCATVTRALIVRLCFASHGLISICLLYKYTYRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEMELFDFRAFAMEK-----------RIEQLKTTSFNETSEKEERLTVDFEEMEKSVRIS----------EQXXXXXXXXGRWFLPKGKLSHD 518
            K  +  +A++ R+ F++H L++I  +        Y+ L   L  L  E + T++ K   EW+WFCPSVF YL S+VP+IW  E++    R   M              I    TT F  ++       V     +  V +S          EQ L+L+LI+GRW LPKG L+ D
Sbjct:    3 KIISTIKAILTRIIFSAHSLLAIWQVVALKSDIIYWALCGPLLLLLLEGIFTIMIKKTQEWRWFCPSVFLYLSSIVPAIWLLELDKVARRVGNMTSTNSTVYSPSNYSIPVGNTTIFITSTNSSGVPPVATLLGQAGVTLSVTPDTWTTLIEQFLMLILIVGRWLLPKGDLTRD 176          
BLAST of Transmembrane protein 26 vs. Ensembl Zebrafish
Match: si:dkey-163f12.11 (si:dkey-163f12.11 [Source:ZFIN;Acc:ZDB-GENE-081104-323])

HSP 1 Score: 60.4622 bits (145), Expect = 2.893e-11
Identity = 29/81 (35.80%), Postives = 49/81 (60.49%), Query Frame = 3
Query:   69 TVTRALIVRLCFASHGLISICLLYKYTYRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEM 311
             +  AL+ R  FA HG++++  + + T  ++Y+ L + +A L  E  +T+      EW+WF P VF YL +V+PS+WF E+
Sbjct:    3 NILSALLSRFLFAVHGVVTVWRVVEVTGEASYWLLVMGVALLGVEMAITVKYTRNTEWRWFSPMVFLYLSTVIPSVWFLEL 83          
BLAST of Transmembrane protein 26 vs. Ensembl Zebrafish
Match: tmem26b (transmembrane protein 26b [Source:ZFIN;Acc:ZDB-GENE-080204-66])

HSP 1 Score: 61.2326 bits (147), Expect = 6.365e-10
Identity = 30/86 (34.88%), Postives = 51/86 (59.30%), Query Frame = 3
Query:   63 CATVTRALIVRLCFASHGLISICLLYKYTY---RSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEM 311
            CA VTRAL +        L+S+  +++ T+      Y++L I    L  E ++TL R+ G ++KWF P++ F+L S++P+IW  E+
Sbjct:    7 CAIVTRALFI--------LVSLIGVWRVTWVKNNPLYWFLTILYLPLVVEMILTLRRRKGKDYKWFSPAILFFLISIIPTIWILEL 84          
BLAST of Transmembrane protein 26 vs. Ensembl Zebrafish
Match: tmem26a (transmembrane protein 26a [Source:ZFIN;Acc:ZDB-GENE-101223-2])

HSP 1 Score: 60.8474 bits (146), Expect = 8.011e-10
Identity = 48/157 (30.57%), Postives = 78/157 (49.68%), Query Frame = 3
Query:   63 CATVTRALIVRLCFASHGLISICLLYKYTYRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEMELFDFRAFAMEKRI----EQLKTTSFNETSEKEERLTVDFEEMEKSVRISE------QXXXXXXXXGRWFLPKG 503
            CA +TR+L     F    LI +  +      + Y+ L I    L  E ++TL R+ G ++KWF P++  +L S++PSIW  E+   + +A   + R     + +K+   +  +     L    E M  SV  ++      Q+LL+LLILG+W LP G
Sbjct:    8 CAIITRSL-----FILVSLIGVWRVKTVKNDNMYWLLTILYLPLVVEMIITLKRRKGQDYKWFSPAILLFLISIIPSIWILELHHQENKASDPQCRKLDSWDNVKSILPSNGTMGNATLKY-LESMLTSVCANDWILALHQVLLILLILGKWLLPLG 158          
BLAST of Transmembrane protein 26 vs. Ensembl Zebrafish
Match: CU638868.1 (transmembrane protein 26a [Source:NCBI gene;Acc:794507])

HSP 1 Score: 57.3806 bits (137), Expect = 7.946e-9
Identity = 28/84 (33.33%), Postives = 45/84 (53.57%), Query Frame = 3
Query:   63 CATVTRALIVRLCFASHGLISICLLYKYTYRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEME 314
            CA +TR+L     F    LI +  +      + Y+ L I    L  E ++TL R+ G ++KWF P++  +L S++PSIW  E+ 
Sbjct:    8 CAIITRSL-----FILVSLIGVWRVKTVKNDNMYWLLTILYLPLVVEMIITLKRRKGQDYKWFSPAILLFLISIIPSIWILELH 86          
BLAST of Transmembrane protein 26 vs. Ensembl Xenopus
Match: nostrin (nitric oxide synthase trafficking [Source:Xenbase;Acc:XB-GENE-988808])

HSP 1 Score: 60.077 bits (144), Expect = 1.475e-16
Identity = 43/146 (29.45%), Postives = 74/146 (50.68%), Query Frame = 3
Query:   81 ALIVRLCFASHGLISICLLYKYTYRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEMELFDFR-AFAMEKRIEQLKTTSFNETSEKEERLTVDFEEMEKSVRISEQXXXXXXXXGRWFLPKGKLSH 515
            ++I R+ F +HG + + ++ +      Y+ L I L  L  E +VTL      EWKWF P VF YL + +PSI+  E++   +R   +   + E L T +          LT+            EQ+++L++++GRW +PKG++  
Sbjct:   11 SIISRILFTAHGALLVWVVVEMKNNQLYWILLIGLLLLSLEMVVTLAVTEKGEWKWFSPMVFLYLTAAIPSIFLLELDFLQYRIVMSNSTQTEHLPTDAAYFIIYNPWLLTL------------EQVMILVIVMGRWIMPKGEMDR 144          

HSP 2 Score: 46.595 bits (109), Expect = 1.475e-16
Identity = 42/146 (28.77%), Postives = 72/146 (49.32%), Query Frame = 2
Query:  542 YLGTAADIAEFFDSFKDKTVQNNRFLCLMILGLWSCSLLQFSFVLTAARARKDQSGLISGKNTSVNSYTKYYQSNSTPYLSVFSIKETENKTVFVKCCRYNWFSPDVYGIFISISLQDGPXXXXXXXXXXXXDVVSYTNMFFTAKN 979
            Y+G  ADI +  +  KD  V+  R + ++ L ++S +LLQF+ VLT  ++        S  N  ++S                S+K T   +    CC     + +V+ + I++ +QDGPFL FRL ++ +  V++   +FF  KN
Sbjct:  154 YIGLGADILDILNLIKDPQVETCRMVNIVGLSIFSWALLQFTLVLTQTQSSD------STDNDEMSS----------------SVKGTCGSS----CC-----TNEVWSLLIAVGMQDGPFLIFRLYVMIKEQVLNEMMIFFICKN 268          
BLAST of Transmembrane protein 26 vs. Ensembl Xenopus
Match: lrch3 (leucine-rich repeats and calponin homology (CH) domain containing 3 [Source:Xenbase;Acc:XB-GENE-877225])

HSP 1 Score: 61.2326 bits (147), Expect = 1.300e-9
Identity = 51/154 (33.12%), Postives = 71/154 (46.10%), Query Frame = 3
Query:   78 RALIVRLCFASHGLISICLLYKYTYRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEMELFDFRAFAMEKRIEQLKTTSFNETSEKEERLTVDFEEMEKSVRISE------------QXXXXXXXXGRWFLPKG 503
             A+I RL F  H L+ +  +      S Y+ LA+    L  E ++TL  K G   KWF P +F YL S+VPS+W  E+  +D    +  K +E L    +N T   +    V      K+V I              Q  LLLLI+G+W LP G
Sbjct:    8 NAVITRLLFMLHSLVGVWRVTVIKKDSMYWLLALVNLLLCLEMVLTLKFKKGRGLKWFSPPIFCYLISIVPSLWLLEIN-YDSEPCSKNKSLENLPILQYNFTLAGDTDTVV-----RKAVAIISAICETVWTLGLHQTFLLLLIIGKWLLPIG 155          
BLAST of Transmembrane protein 26 vs. Ensembl Mouse
Match: Tmem26 (transmembrane protein 26 [Source:MGI Symbol;Acc:MGI:2143537])

HSP 1 Score: 46.2098 bits (108), Expect = 7.164e-6
Identity = 34/121 (28.10%), Postives = 63/121 (52.07%), Query Frame = 3
Query:   57 MKCATVTRALIVRLCFASHGLISICLLYKYTYRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEMELFDFRAFAMEKRIEQLK-TTSFNETSEKEERLTVD 416
            M+   + +AL+ RL F  H L+++  +        Y+ LA+    L  E+++TL  K G  +KW  P++F YL +++PS+W  EM          +KR+E    + S +  S + + L+++
Sbjct:    1 MEGLVLLKALVTRLLFLLHSLVAVWRVTWVKEEHRYWLLALLNLLLVLETVLTLKFKRGRGYKWLSPAIFVYLVNIMPSLWLLEMH------HGNQKRMEDTGCSLSLSSDSPQGKTLSLN 115          
BLAST of Transmembrane protein 26 vs. UniProt/SwissProt
Match: sp|Q6ZUK4|TMM26_HUMAN (Transmembrane protein 26 OS=Homo sapiens OX=9606 GN=TMEM26 PE=1 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 7.872e-7
Identity = 47/162 (29.01%), Postives = 76/162 (46.91%), Query Frame = 3
Query:   78 RALIVRLCFASHGLISICLLYKYTYRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEM----ELFDFRAFAMEKRIEQLKTTSFNETSEKEERLTVDFEEMEKSVRI----------------SEQXXXXXXXXGRWFLPKG 503
             AL  RL F  H L+ +  + +      Y+ LA+    LF E+ +TL  K G  +KWF P++F YL S+VPS+W  E+    +    +A    +     +   FN+T    E+ T   +++ ++ ++                  Q  LL+LI+GRW LP G
Sbjct:    8 NALATRLLFLLHSLVGVWRVTEVKKEPRYWLLALLNLLLFLETALTLKFKRGRGYKWFSPAIFLYLISIVPSLWLLELHHETQYCSIQAEGTSQNTS--RKEDFNQTLTSNEQ-TSRADDLIETAKVFVNNLSTVCEKVWTLGLHQTFLLMLIIGRWLLPIG 166          
BLAST of Transmembrane protein 26 vs. TrEMBL
Match: R7UHY6 (Uncharacterized protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_23383 PE=4 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 1.072e-54
Identity = 77/164 (46.95%), Postives = 101/164 (61.59%), Query Frame = 3
Query:   72 VTRALIVRLCFASHGLISICLLYKYTYRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEMELFDFRAFAMEKRI---EQLKTTSFNETSEKEERLTVDFEEMEKSVRIS------------EQXXXXXXXXGRWFLPKGKLSHD 518
            V RA++VR+ FA HGL+++  L+  T   TY+Y+ +AL GL  E+MVTL +K G+EWKWFCPSVFFYL  +VP IWF E++        MEKRI        +S   T++  E L   F+ +   +RI             EQLLLLLLI+GRW LPKGKL+HD
Sbjct:    4 VARAILVRVLFAIHGLVAVWRLHSVTGDGTYWYITLALVGLCAETMVTLYKKMGNEWKWFCPSVFFYLLGIVPPIWFLELD-------EMEKRITVRNNKGNSSAFVTNQTAEELKATFDGLGVQIRIPLALTSDQWVRAIEQLLLLLLIMGRWMLPKGKLTHD 160          

HSP 2 Score: 112.464 bits (280), Expect = 1.072e-54
Identity = 70/147 (47.62%), Postives = 90/147 (61.22%), Query Frame = 2
Query:  542 YLGTAADIAEFFDSFKDKTVQNNRFLCLMILGLWSCSLLQFSFVLTAARARKDQSGLISGKNTSVNSYTKYYQSNSTPYLSVFSIKETENKTVFVKCCRYNWFSPDVYGIFISISLQDGPXXXXXXXXXXXXDVVSYTNMFFTAKNS 982
            Y+GTAADI EFF++FK++ V+ N  LC++IL +WS SLLQF+ VLTA + RKDQSGL+     + N Y++                          CC     +PDVYGI ISI +QD PFL  RL LIF + V+SYTNMFFT KN+
Sbjct:  169 YIGTAADIVEFFEAFKEEKVRYNPILCMVILAIWSWSLLQFTMVLTATKVRKDQSGLLP---RAFNEYSE-------------------------TCC-----TPDVYGIVISIFMQDAPFLVLRLLLIFYYGVLSYTNMFFTCKNT 282          
BLAST of Transmembrane protein 26 vs. TrEMBL
Match: A0A210QYM2 (Transmembrane protein 26 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT20992 PE=4 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 1.151e-54
Identity = 79/175 (45.14%), Postives = 106/175 (60.57%), Query Frame = 3
Query:   57 MKCATVTRALIVRLCFASHGLISICLLYKYTYRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEMELFDFRAFAMEKRIEQLKTTSF--NETSE---------KEERLTVDFEEMEKSV----------RISEQXXXXXXXXGRWFLPKGKLSHD 518
            M+C T+ RAL+VR+ FA HG+I+I  L+    +   +YL  AL GL  E+++TL +K G EWKWFCPSVFFYL SVVP+IWF E+         ME RI  L+ +S+  N T            +E L+V+ E ++ ++          RI EQ LLL+LI+GRW LPKG LSHD
Sbjct:    1 MRCMTIIRALLVRVLFAVHGVIAIWRLFMVIRKPWCWYLTGALGGLLIETIITLTKKKGKEWKWFCPSVFFYLGSVVPAIWFLELH-------EMEDRIA-LRESSYLTNSTGSVFHVPVNRTNKEDLSVNIEGLQITIPLAIPANLWLRILEQFLLLMLIVGRWLLPKGSLSHD 167          

HSP 2 Score: 113.62 bits (283), Expect = 1.151e-54
Identity = 81/186 (43.55%), Postives = 117/186 (62.90%), Query Frame = 2
Query:  536 FSYLGTAADIAEFFDSFKDKTVQNNRFLCLMILGLWSCSLLQFSFVLTAARARKDQSGLISGKNTSVNSYTKYYQSNSTPYLSVFSIKETENKTVFVKCCRYNWFSPDVYGIFISISLQDGPXXXXXXXXXXXXDVVSYTNMFFTAKNSXXXXXXXXXXXXXWCE--QKKKIELQENSENIKIQPP 1087
              Y+GTAADI EF+++F ++ V  NR LC +ILG+W+ SLLQF+ VLTA RAR+D SG+ S  ++  +                            V CC     +P++YGI  SI +QD PFL  RL LIF++ V+SYTNMFFT+KNSLVI+LL+YR+IV+  E  ++KK E+++++  I++  P
Sbjct:  174 LVYVGTAADIVEFYEAFSEELVMYNRLLCYIILGIWTLSLLQFTLVLTATRARRDHSGVPSASHSEEDQ---------------------------VGCC-----NPEIYGIVTSILMQDCPFLVIRLLLIFKYGVISYTNMFFTSKNSLVIVLLMYRVIVVQGETRRRKKEEMKKSNSAIRLNVP 327          
BLAST of Transmembrane protein 26 vs. TrEMBL
Match: A0A1S3JPY4 (LOW QUALITY PROTEIN: transmembrane protein 26-like OS=Lingula unguis OX=7574 GN=LOC106174859 PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.449e-53
Identity = 75/168 (44.64%), Postives = 99/168 (58.93%), Query Frame = 3
Query:   57 MKCATVTRALIVRLCFASHGLISICLLYKYTYRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEMELFDFRAFAMEKRIEQLKTTSFNETSEKE--ERLTVDFEEMEKSVRIS------------EQXXXXXXXXGRWFLPKGKLSHD 518
            M C TV RA+ VRLCFA+H  +++  +Y  T    Y+YL  AL   F E MVTL+++ G EWKWFCPSVFFYL  V+PSIWF  +EL++ +             ++FN T   +  + LT   +E+   +RI             EQ LLL+LILGRW LPKGKL+HD
Sbjct:    1 MGCFTVIRAVAVRLCFAAHSTLAVWRVYLVTKDEIYWYLLCALGTQFIEGMVTLLKRDGXEWKWFCPSVFFYLSGVIPSIWF--LELYNLQILGT-------GNSTFNHTGVNDSLQDLTATIKELGLEIRIPLKLSSDQWLKFLEQGLLLMLILGRWVLPKGKLTHD 159          

HSP 2 Score: 110.538 bits (275), Expect = 2.449e-53
Identity = 77/167 (46.11%), Postives = 107/167 (64.07%), Query Frame = 2
Query:  542 YLGTAADIAEFFDSFKDKTVQNNRFLCLMILGLWSCSLLQFSFVLTAARARKDQSGLISGKNTSVNSYTKYYQSNSTPYLSVFSIKETENKTVFVKCCRYNWFSPDVYGIFISISLQDGPXXXXXXXXXXXXDVVSYTNMFFTAKNSXXXXXXXXXXXXXWCEQKKK 1042
            Y+GTAADI EFF++FK+  V+   +L   +L +W+ SLLQF+ VLTA +ARKDQSGL+ G +T ++ +                           +CC     S DVYGI ISI +QD PFL+ RL LIF + VVSYTN FFT+KN+LV++LL+YRLI++  E+K++
Sbjct:  168 YIGTAADIVEFFEAFKEDVVRRTWYLAYAVLSIWTWSLLQFTMVLTATKARKDQSGLLPGIHTHIDKH---------------------------QCC-----SSDVYGIMISIIMQDAPFLSLRLLLIFYYGVVSYTNFFFTSKNALVMLLLIYRLIMVQLERKRE 302          
BLAST of Transmembrane protein 26 vs. TrEMBL
Match: A0A433UB43 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_001185 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 2.825e-50
Identity = 89/181 (49.17%), Postives = 117/181 (64.64%), Query Frame = 2
Query:  542 YLGTAADIAEFFDSFKDKTVQNNRFLCLMILGLWSCSLLQFSFVLTAARARKDQSGLISGKNTSVNSYTKYYQSNSTPYLSVFSIKETENKTVFVKCCRYNWFSPDVYGIFISISLQDGPXXXXXXXXXXXXDVVSYTNMFFTAKNSXXXXXXXXXXXXXWCEQKK--KIELQENSENIKI 1078
            Y+GTAADI EFF++FK++ V+ +R LC +ILG+WS SL+QFS VLTA+RAR+D++GL+                             T  K V   CC     +PDVYGI ISI LQD PFL  RL LIF+++VVSYTNMFFT KN++VIILL+YRLIV+  E+++  K E QE +   +I
Sbjct:  293 YIGTAADIVEFFEAFKEERVRYDRILCTVILGIWSLSLIQFSLVLTASRARRDRTGLV---------------------------PMTHPKGVTDTCC-----NPDVYGILISICLQDLPFLVLRLLLIFKYNVVSYTNMFFTCKNTIVIILLIYRLIVVHMERRRQAKQEKQETASAARI 441          

HSP 2 Score: 113.235 bits (282), Expect = 2.825e-50
Identity = 78/189 (41.27%), Postives = 102/189 (53.97%), Query Frame = 3
Query:    9 CHVRFENLNEK*FHLRMKCATVTRALIVRLCFASHGLISICLLYKYTYRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEMELFDFRAFAMEKRIEQLKTTSFNETSEKEERLTVDFEEMEKS-------------------VRISEQXXXXXXXXGRWFLPKGKLSHD 518
            C+ +F++         M    V RA++VRL FA+HG+ISI  L   T    Y+YL + L  L  E  VTL +K G EWKWFCPSVF YL  +VP+IWF E+         +EKRI++    S   T+   +  +VDF     S                   +R  EQ+LLL+LILGRWFLPKGKL+HD
Sbjct:  115 CYTKFDS---------MGYLAVARAIVVRLTFAAHGIISIWRLAVITQDHGYWYLGLVLCLLLVEMTVTLGKKAGQEWKWFCPSVFIYLLCIVPTIWFMELH-------ELEKRIQEKAAMS---TTVSPDTSSVDFRYNSSSRAGNLTSTGCPLDLNSDEWIRTLEQILLLILILGRWFLPKGKLTHD 284          
BLAST of Transmembrane protein 26 vs. TrEMBL
Match: K1S280 (Transmembrane protein 26 OS=Crassostrea gigas OX=29159 GN=CGI_10025687 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 8.323e-50
Identity = 78/171 (45.61%), Postives = 100/171 (58.48%), Query Frame = 3
Query:   57 MKCATVTRALIVRLCFASHGLISICLLYKYTYRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEMELFDFRAFAMEKRIEQ-LKTTSFNETSEKEERLTVDFEEMEKS----------------VRISEQXXXXXXXXGRWFLPKGKLSHD 518
            M+  T+ RAL VR  F +HGLI+I  LY        +YL++ L GL  E++VTL  K G EWKWFCPSVFFYL SVVP+IWF E+        AME RIE+  +   FN T++ + R   D + + K                 +R+ EQ LLL+LI+GRW LPKG LSHD
Sbjct:    1 MRVFTIFRALFVRSLFGAHGLIAIWRLYMVIGEIWCWYLSVTLLGLLIETVVTLAVKRGKEWKWFCPSVFFYLASVVPAIWFLEL-------HAMEDRIEEKAEQERFNITTQNQNRSVEDLKIIIKDLGIDFSFPLSLTADLWLRVLEQFLLLMLIVGRWVLPKGALSHD 164          

HSP 2 Score: 102.834 bits (255), Expect = 8.323e-50
Identity = 64/149 (42.95%), Postives = 89/149 (59.73%), Query Frame = 2
Query:  536 FSYLGTAADIAEFFDSFKDKTVQNNRFLCLMILGLWSCSLLQFSFVLTAARARKDQSGLISGKNTSVNSYTKYYQSNSTPYLSVFSIKETENKTVFVKCCRYNWFSPDVYGIFISISLQDGPXXXXXXXXXXXXDVVSYTNMFFTAKNS 982
              Y+GTAADI EF+++F ++ V+ N  L  ++LG+W+ SLLQF+ V+TA RAR+D  G+ SG                     + ++KE         CC     +P++YGI +SI +QD PFL  RL LIF + VVSYTNMFFT+KNS
Sbjct:  171 LVYVGTAADIVEFYEAFNEEAVKYNPLLIYILLGIWTMSLLQFTLVVTATRARRDLVGVPSG--------------------LILAMKEEAP-----SCC-----NPEIYGIIVSILMQDCPFLVIRLLLIFYYHVVSYTNMFFTSKNS 289          
BLAST of Transmembrane protein 26 vs. Ensembl Cavefish
Match: tmem26a (transmembrane protein 26-like [Source:NCBI gene;Acc:103029977])

HSP 1 Score: 60.4622 bits (145), Expect = 1.170e-16
Identity = 47/162 (29.01%), Postives = 83/162 (51.23%), Query Frame = 3
Query:   51 LRMKCATVTRALIVRLCFASHGLISICLLYKYTYRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEMELFDFRA-----------FAMEKRIEQLKTTSFNETSEKEERLTVDFEEMEKSVRISEQXXXXXXXXGRWFLPKG 503
            L+  CA +TRAL +    A   +  +CL+  + +   ++ L +    L  E+++TL R  G E+KWF P++ F+L S++PSIW  E+   + ++            +++  +E    T  N+T ++ E + +        +    Q LL+LLILG+W LP G
Sbjct:    4 LKFVCAVLTRALFLL--LALLAVWRVCLVKNHHW---FWLLTVLFTPLLLETIITLKRSKGQEYKWFSPAILFFLISIIPSIWILELHHQESKSSDPQCKKLDSWNSVKSMVESFNATHGNDTLKRLEDI-LSIVCPNDWILTLHQCLLILLILGKWLLPLG 159          

HSP 2 Score: 45.4394 bits (106), Expect = 1.170e-16
Identity = 45/150 (30.00%), Postives = 65/150 (43.33%), Query Frame = 2
Query:  542 YLGTAADIAEF----FDSFKDKTVQNNRFLCLMILGLWSCSLLQFSFVLTAARARKDQSGLISGKNTSVNSYTKYYQSNSTPYLSVFSIKETENKTVFVKCCRYNWFSPDVYGIFISISLQDGPXXXXXXXXXXXXDVVSYTNMFFTAKN 979
            ++GTAADI EF        KDK+ Q    L  +IL +W+ S+LQF   L+   +R D+         SV    +  Q+                     +C      S D++ I  S+ +QDGPFL  RL ++  F V     +FF  KN
Sbjct:  174 FVGTAADILEFTSETLSDVKDKSPQ----LVYIILAVWTWSMLQFPLHLSVVTSRPDE---------SVEKEEEEKQTGCC------------------RCVLIERHSTDIWNIVESLFIQDGPFLVVRLMVMAYFKVFHQMLLFFAIKN 292          
BLAST of Transmembrane protein 26 vs. Ensembl Cavefish
Match: tmem26b (transmembrane protein 26b [Source:ZFIN;Acc:ZDB-GENE-080204-66])

HSP 1 Score: 61.2326 bits (147), Expect = 4.630e-10
Identity = 31/91 (34.07%), Postives = 53/91 (58.24%), Query Frame = 3
Query:   51 LRMKCATVTRALIVRLCFASHGLISICLLYKYTY---RSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEME 314
            L+  CA +TRAL +        LIS+  +++ T+      Y++L I    L  E ++TL R+ G ++KWF P++F +L S++P+IW  E+ 
Sbjct:    3 LKFLCALITRALFI--------LISLIGVWRVTWVKNNKLYWFLTILYLPLVIELILTLRRRKGKDYKWFSPAIFLFLISIIPTIWILELH 85          
BLAST of Transmembrane protein 26 vs. Ensembl Cavefish
Match: ENSAMXT00000044825.1 (pep primary_assembly:Astyanax_mexicanus-2.0:6:129973:131566:1 gene:ENSAMXG00000036480.1 transcript:ENSAMXT00000044825.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 4.924e-10
Identity = 43/146 (29.45%), Postives = 72/146 (49.32%), Query Frame = 2
Query:  542 YLGTAADIAEFFDSFKDKTVQNNRFLCLMILGLWSCSLLQFSFVLTAARARKDQSGLISGKNTSVNSYTKYYQSNSTPYLSVFSIKETENKTVFVKCCRYNWFSPDVYGIFISISLQDGPXXXXXXXXXXXXDVVSYTNMFFTAKN 979
            Y+G  ADI + FD+FK+  V+  R + ++ L L+S +L+QF  VLT            +   T   + T++               + +       CC     S +V+ + +++ LQDGPFL +RL L+ R +V++   +FFT KN
Sbjct:   67 YVGLGADILDIFDTFKEPEVKTKRIVIIVGLSLFSWALMQFPLVLTQ-----------TSPTTPAQAETQHP-------------ADGDRTGTSTSCC-----SSEVWSLLLTVGLQDGPFLVYRLYLMIRENVLNQLMIFFTCKN 183          

HSP 2 Score: 28.4906 bits (62), Expect = 4.924e-10
Identity = 13/23 (56.52%), Postives = 19/23 (82.61%), Query Frame = 3
Query:  450 EQXXXXXXXXGRWFLPKGKLSHD 518
            EQ +L++L+LGRW +PKG +S D
Sbjct:   36 EQTMLIVLVLGRWLMPKGDMSRD 58          
BLAST of Transmembrane protein 26 vs. Ensembl Nematostella
Match: EDO40847 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Z5])

HSP 1 Score: 78.9518 bits (193), Expect = 1.552e-25
Identity = 46/146 (31.51%), Postives = 77/146 (52.74%), Query Frame = 3
Query:   81 ALIVRLCFASHGLISICLLYKYTYRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEMELFDFRAFAMEKRIEQLKTTSFNETSEKEERLTVDFEEMEKSVRISEQXXXXXXXXGRWFLPKGKLSHD 518
            A++ RL F  HG++ + LL      S Y++L I +  L  E   TL  + G E+K+F PS  FY+ ++VP +W  E +L   R+ A           +   T      +T+D   M +  ++ E  L++++ILGRW LP+G+++ D
Sbjct:    4 AILTRLMFIIHGVMCVWLLSCNYNNSNYWWLIIGILCLLVEMCYTLAARKGREYKYFWPSCLFYMLTMVPIVWILETDLHKTRSLA-----------AAGTTQAPSSCITMDANTMAR--KLCELGLIIMIILGRWLLPRGEITRD 136          

HSP 2 Score: 55.4546 bits (132), Expect = 1.552e-25
Identity = 45/149 (30.20%), Postives = 70/149 (46.98%), Query Frame = 2
Query:  536 FSYLGTAADIAEFFDSFKDKTVQNNRFLCLMILGLWSCSLLQFSFVLTAARARKDQSGLISGKNTSVNSYTKYYQSNSTPYLSVFSIKETENKTVFVKCCRYNWFSPDVYGIFISISLQDGPXXXXXXXXXXXXDVVSYTNMFFTAKNS 982
              Y+GTAADI E F+ F++  V +   +   +LG++S SLLQF+ V TA   + ++  + S K +                                   R      D++GI   I +QDGPFL  RL LI ++++ S  ++FFT KN+
Sbjct:  143 LGYVGTAADILELFEVFEEPQVGSELQITTAVLGVYSWSLLQFTLVTTATTGKDNKIRIASNKISR----------------------------------REMLLHGDIFGILTGIFMQDGPFLVLRLVLIIKYNLYSEMHLFFTCKNA 257          
BLAST of Transmembrane protein 26 vs. Ensembl Nematostella
Match: EDO40016 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S878])

HSP 1 Score: 84.7297 bits (208), Expect = 5.253e-23
Identity = 53/151 (35.10%), Postives = 82/151 (54.30%), Query Frame = 3
Query:   66 ATVTRALIVRLCFASHGLISICLLYKYTYRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEMELFDFRAFAMEKRIEQLKTTSFNETSEKEERLTVDFEEMEKSVRISEQXXXXXXXXGRWFLPKGKLSHD 518
            +TV +A++ RL FASH +++I  +   T + + ++L+  L GLF E++V L  +HG E+KW  PS+  YL +++P  W  E+ L   R              S N +S       VD E +   +   EQ  LL++ILGRW LPKG L+ +
Sbjct:    6 STVFKAILTRLIFASHAMVAIFWVTLVTKQESLWHLSWILVGLFVETLVCLFYRHGDEYKWVSPSILCYLIAIIPCAWIIELHLLPVR--------------SANVSSILPG---VDGEVLTDLI---EQTTLLMMILGRWLLPKGSLTRE 136          

HSP 2 Score: 41.2022 bits (95), Expect = 5.253e-23
Identity = 42/146 (28.77%), Postives = 60/146 (41.10%), Query Frame = 2
Query:  545 LGTAADIAEFFDSFKDKTVQNNRFLCLMILGLWSCSLLQFSFVLTAARARKDQSGLISGKNTSVNSYTKYYQSNSTPYLSVFSIKETENKTVFVKCCRYNWFSPDVYGIFISISLQDGPXXXXXXXXXXXXDVVSYTNMFFTAKNS 982
            L  +ADI EFFD  K K  Q +  + L IL LW+ SL+QF                       VN+  K     + P   V                     + D+ G  +++ +QDGPFL FRL +I ++    Y  +F T KN+
Sbjct:  146 LAMSADIIEFFDILKLKEAQQSHDVTLAILCLWTISLMQF----------------------PVNATAKLGTEETAPKHRV---------------------TMDLIGTVMALFMQDGPFLTFRLFMIAKYSAFGYMIVFLTVKNA 248          
BLAST of Transmembrane protein 26 vs. Ensembl Nematostella
Match: EDO32760 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU47])

HSP 1 Score: 62.3882 bits (150), Expect = 7.947e-16
Identity = 33/131 (25.19%), Postives = 69/131 (52.67%), Query Frame = 3
Query:  147 TYRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEMELFDFRAFAMEKRIEQLKTTSFNETSEKEERLTVDFEEMEKSV-------RISEQXXXXXXXXGRWFLPKGKLSHD 518
            T +  Y+   + L  L  E +  ++ + G E+K+F PS F Y+ +++P +W  E++L   R   ++KR +QL        +     L +D   +  ++       ++ E  +++++I+GRW LP+G+++ D
Sbjct:   31 TKQPLYWAFLLGLVALVCEMLYVMIVRKGAEYKYFWPSCFLYISAIIPVVWVMELDLLRHR---LDKR-DQLTLRLSGSNTIDTSGLNIDGIGIAATIQVDTAAKKVCELGVVVIIIVGRWLLPRGRMTRD 157          

HSP 2 Score: 38.891 bits (89), Expect = 7.947e-16
Identity = 40/147 (27.21%), Postives = 67/147 (45.58%), Query Frame = 2
Query:  542 YLGTAADIAEFFDSFKDKTVQNNRFLCLMILGLWSCSLLQFSFVLTAARARKDQSGLISGKNTSVNSYTKYYQSNSTPYLSVFSIKETENKTVFVKCCRYNWFSPDVYGIFISISLQDGPXXXXXXXXXXXXDVVSYTNMFFTAKNS 982
            Y+G  ADI E F +  +  V +N  +    L L+S S+ QF  V TA     ++S  I+ + + V++             S+   K+ ++                      ++ +QDGPFL  RL+L+  + V S  ++FFTAKN+
Sbjct:  166 YIGMGADILELFAALTEPEVMHNASVTYATLALFSWSMFQFCVVATATVGGSEESPDITHQPSEVST-------------SIVDFKKKKHLA--------------------ALFMQDGPFLLLRLSLLIGYGVSSEIHIFFTAKNA 279          
BLAST of Transmembrane protein 26 vs. Ensembl Nematostella
Match: EDO47924 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKK6])

HSP 1 Score: 67.781 bits (164), Expect = 1.027e-15
Identity = 45/146 (30.82%), Postives = 69/146 (47.26%), Query Frame = 3
Query:   81 ALIVRLCFASHGLISICLLYKYTYRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEMELFDFRAFAMEKRIEQLKTTSFNETSEKEERLTVDFEEMEKSVRISEQXXXXXXXXGRWFLPKGKLSHD 518
            AL  R  F  H ++ IC L      + YF     L  L  E+ +T+  + GHE+  FCPS+F YL +V+P  W  +  + +F        I Q   + +    ++    T+            EQ L+L+L++GRW LPKG +S D
Sbjct:   10 ALFSRFLFLIHAVLMICWLVLVKDNNLYFIFVSLLVALVIETFITVGFRKGHEYAGFCPSMFLYLLAVIPCDWITKRAVINFF------HIFQALGSVYKSQDDEAVLYTL------------EQALVLILVIGRWLLPKGSISRD 137          

HSP 2 Score: 33.113 bits (74), Expect = 1.027e-15
Identity = 20/53 (37.74%), Postives = 30/53 (56.60%), Query Frame = 2
Query:  542 YLGTAADIAEFFDSFKDKTVQ------NNRFLCLMILGLWSCSLLQFSFVLTA 682
            Y+G AADI EF +  K+  ++      NN F+  +IL  WS SL QF+  ++ 
Sbjct:  146 YVGMAADIMEFTEIIKEDEIRKVNMLNNNHFVNAVIL-FWSMSLFQFTLTISG 197          
BLAST of Transmembrane protein 26 vs. Ensembl Nematostella
Match: EDO48561 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIS6])

HSP 1 Score: 66.6254 bits (161), Expect = 2.530e-12
Identity = 44/147 (29.93%), Postives = 81/147 (55.10%), Query Frame = 3
Query:   81 ALIVRLCFASHGLISICLLYKYTYR-STYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEMELFDFRAFAMEKRIEQLKTTSFNETSEKEERLTVDFEEMEKSVRISEQXXXXXXXXGRWFLPKGKLSHD 518
            AL  R+ F  HG +S+ L++    + STY++L+  L  LFFE++ T++ + G E+K+F PS   Y+ +V+PSIW  EM +   +     +     ++ S +        + +       + + S+  L+L++I+ RW LP+G+L+ D
Sbjct:   11 ALFTRVIFFVHGFVSVYLVWLSKNKDSTYWWLSTGLVLLFFETIYTILMRKGKEYKYFWPSSLLYMATVLPSIWVAEMSILHAK-----QTDPNCESNSASTVYALGGGVGIAPTWNTLTQKWSKLGLILVIIVARWLLPRGELTRD 152          
BLAST of Transmembrane protein 26 vs. Ensembl Medaka
Match: ENSORLT00000005990.2 (pep primary_assembly:ASM223467v1:15:16625055:16640574:1 gene:ENSORLG00000004760.2 transcript:ENSORLT00000005990.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 1.221e-9
Identity = 29/86 (33.72%), Postives = 48/86 (55.81%), Query Frame = 3
Query:   63 CATVTRALIVRLCFASHGLISICLLYKYT---YRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEM 311
            CA +TRAL +        L+S+  +++ T       Y++L      L  E ++TL R+ G ++KWF P +F +L S++PSIW  E+
Sbjct:    8 CAVITRALFI--------LVSLVGVFRVTSVKNDRNYWFLTFLFLPLVTEMIITLKRRKGKDYKWFSPPIFLFLISIIPSIWILEL 85          
BLAST of Transmembrane protein 26 vs. Ensembl Medaka
Match: tmem26a (transmembrane protein 26a [Source:ZFIN;Acc:ZDB-GENE-101223-2])

HSP 1 Score: 56.225 bits (134), Expect = 1.854e-8
Identity = 28/87 (32.18%), Postives = 47/87 (54.02%), Query Frame = 3
Query:   63 CATVTRALIVRLCFASHGLISICLLYKYT---YRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEME 314
            CA +TRAL +        L+S+  +++ T       Y++L      L  E ++TL R+ G ++KWF P +F +L S++P IW  E+ 
Sbjct:    5 CAVITRALFI--------LVSLVGVFRVTSVKNDCNYWFLTFLFLPLVTEMIITLKRRKGKDYKWFSPPIFLFLISIIPLIWILELH 83          
BLAST of Transmembrane protein 26 vs. Planmine SMEST
Match: SMESG000001147.1 (SMESG000001147.1)

HSP 1 Score: 501.516 bits (1290), Expect = 3.785e-176
Identity = 271/271 (100.00%), Postives = 271/271 (100.00%), Query Frame = 2
Query:  542 YLGTAADIAEFFDSFKDKTVQNNRFLCLMILGLWSCSLLQFSFVLTAARARKDQSGLISGKNTSVNSYTKYYQSNSTPYLSVFSIKETENKTVFVKCCRYNWFSPDVYGIFISISLQDGPXXXXXXXXXXXXDVVSYTNMFFTAKNSXXXXXXXXXXXXXWCEQKKKIELQENSENIKIQPPQIEVKKIDRFYQNGFFDGYFEKNIEKPIFPFADGTYSCSDFNNQISSNFRTGKKPPEFNLQWKSIKKPELEKNLFTIPLKDERNFQLNY 1354
            YLGTAADIAEFFDSFKDKTVQNNRFLCLMILGLWSCSLLQFSFVLTAARARKDQSGLISGKNTSVNSYTKYYQSNSTPYLSVFSIKETENKTVFVKCCRYNWFSPDVYGIFISISLQDGPFLAFRLALIFRFDVVSYTNMFFTAKNSLVIILLVYRLIVIWCEQKKKIELQENSENIKIQPPQIEVKKIDRFYQNGFFDGYFEKNIEKPIFPFADGTYSCSDFNNQISSNFRTGKKPPEFNLQWKSIKKPELEKNLFTIPLKDERNFQLNY
Sbjct:   79 YLGTAADIAEFFDSFKDKTVQNNRFLCLMILGLWSCSLLQFSFVLTAARARKDQSGLISGKNTSVNSYTKYYQSNSTPYLSVFSIKETENKTVFVKCCRYNWFSPDVYGIFISISLQDGPFLAFRLALIFRFDVVSYTNMFFTAKNSLVIILLVYRLIVIWCEQKKKIELQENSENIKIQPPQIEVKKIDRFYQNGFFDGYFEKNIEKPIFPFADGTYSCSDFNNQISSNFRTGKKPPEFNLQWKSIKKPELEKNLFTIPLKDERNFQLNY 349          

HSP 2 Score: 125.946 bits (315), Expect = 1.776e-31
Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 3
Query:  309 MELFDFRAFAMEKRIEQLKTTSFNETSEKEERLTVDFEEMEKSVRISEQXXXXXXXXGRWFLPKGKLSHD 518
            MELFDFRAFAMEKRIEQLKTTSFNETSEKEERLTVDFEEMEKSVRISEQLLLLLLILGRWFLPKGKLSHD
Sbjct:    1 MELFDFRAFAMEKRIEQLKTTSFNETSEKEERLTVDFEEMEKSVRISEQLLLLLLILGRWFLPKGKLSHD 70          
BLAST of Transmembrane protein 26 vs. Planmine SMEST
Match: SMESG000031505.1 (SMESG000031505.1)

HSP 1 Score: 99.3673 bits (246), Expect = 4.443e-39
Identity = 60/148 (40.54%), Postives = 86/148 (58.11%), Query Frame = 3
Query:   96 LCFASHGLISICLLYKYTYRSTYFYLAIALAGLFFESMVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEMELFDFRAF----AMEKRIEQLKTTSFNETSEKEERL-----TVDFEEMEKSVRISEQXXXXXXXXGRWFLPKGKLS 512
            + F  H L  I L+ K++  S  ++L I L GLF E++V +VR+ G EW WF PS+FFYL SVVP+IWF E+ L          AM K +   +T     +     R+     T+    ++ + ++ EQ LLLLLI+GRWF+PKGK+S
Sbjct:    1 MVFTLHALTCIILVQKFSDGSHVWFLTITLGGLFMETLVIIVRRRGQEWMWFSPSIFFYLISVVPAIWFMELLLIKTGQNDCHSAMSKNLTNNQTEMTCPSLINYYRIPIKIGTITDISLDSTAQVLEQFLLLLLIMGRWFMPKGKMS 148          

HSP 2 Score: 81.6481 bits (200), Expect = 4.443e-39
Identity = 71/171 (41.52%), Postives = 102/171 (59.65%), Query Frame = 2
Query:  542 YLGTAADIAEFFDSFKDKTVQNNRFLCLMILGLWSCSLLQFSFVLTAARARKDQSGLISGKNTSVNSYTKY-YQSN-STPYLSVFSIKETENKTVFVKCCRYNWFSPDVYGIFISISLQDGPXXXXXXXXXXXXDVVSYTNMFFTAKNSXXXXXXXXXXXXXWCEQKKKIE 1048
            Y+G AADI E F++FK+K V++++ L +++L +WS SLLQF F+L +   +  Q    S K++  +SY  + ++SN +TP LS+ S+K+  +                         LQD PFL  RL  I    ++SYTN FFTAKNSLVI+LLVYRL+VI  E KK +E
Sbjct:  159 YIGVAADIVELFEAFKEKAVRHSKLLTILVLTVWSISLLQFCFILVSKTHKHSQK---STKHS--DSYRDFAWKSNGNTPCLSMISLKKKSDSL-----------------------LQDTPFLILRLYFIIEHKIISYTNTFFTAKNSLVILLLVYRLVVIQMESKKLLE 301          
BLAST of Transmembrane protein 26 vs. Planmine SMEST
Match: SMESG000049136.1 (SMESG000049136.1)

HSP 1 Score: 65.0846 bits (157), Expect = 5.707e-12
Identity = 49/146 (33.56%), Postives = 73/146 (50.00%), Query Frame = 2
Query:  545 LGTAADIAEFFDSFKDKTVQNNRFLCLMILGLWSCSLLQFSFVLTAARARKDQSGLISGKNTSVNSYTKYYQSNSTPYLSVFSIKETENKTVFVKCCRYNWFSPDVYGIFISISLQDGPXXXXXXXXXXXXDVVSYTNMFFTAKNS 982
            +G  ADI E F++FK+  V+ +  L + IL LW  SLLQF    TA + RK + G      TS +S+ +                        +  C +     +++ I  S+ LQDGPFL  R+ LI ++ V SY+N+FFT KN+
Sbjct:  324 IGMGADILELFEAFKEPVVRQDFLLTVSILSLWQASLLQFCLTKTATKVRKIRGGFSQTLKTS-DSWIR------------------------LPGCLFC--ETELWAISTSVLLQDGPFLILRVVLIVQYYVASYSNIFFTCKNT 442          

HSP 2 Score: 24.2534 bits (51), Expect = 5.707e-12
Identity = 19/52 (36.54%), Postives = 27/52 (51.92%), Query Frame = 3
Query:  390 EKEERLTVDFEEMEKS---------VRISEQXXXXXXXXGRWFLPKGKLSHD 518
            E+E R    FE++E +         VR+ EQ LLL LI  RW LP+  ++  
Sbjct:  263 ERENRRREIFEKVENAWKKISPENRVRMIEQFLLLCLIFARWLLPRAGITRQ 314          
BLAST of Transmembrane protein 26 vs. Planmine SMEST
Match: SMESG000049136.1 (SMESG000049136.1)

HSP 1 Score: 65.0846 bits (157), Expect = 5.814e-12
Identity = 49/146 (33.56%), Postives = 73/146 (50.00%), Query Frame = 2
Query:  545 LGTAADIAEFFDSFKDKTVQNNRFLCLMILGLWSCSLLQFSFVLTAARARKDQSGLISGKNTSVNSYTKYYQSNSTPYLSVFSIKETENKTVFVKCCRYNWFSPDVYGIFISISLQDGPXXXXXXXXXXXXDVVSYTNMFFTAKNS 982
            +G  ADI E F++FK+  V+ +  L + IL LW  SLLQF    TA + RK + G      TS +S+ +                        +  C +     +++ I  S+ LQDGPFL  R+ LI ++ V SY+N+FFT KN+
Sbjct:  283 IGMGADILELFEAFKEPVVRQDFLLTVSILSLWQASLLQFCLTKTATKVRKIRGGFSQTLKTS-DSWIR------------------------LPGCLFC--ETELWAISTSVLLQDGPFLILRVVLIVQYYVASYSNIFFTCKNT 401          

HSP 2 Score: 24.6386 bits (52), Expect = 5.814e-12
Identity = 19/52 (36.54%), Postives = 27/52 (51.92%), Query Frame = 3
Query:  390 EKEERLTVDFEEMEKS---------VRISEQXXXXXXXXGRWFLPKGKLSHD 518
            E+E R    FE++E +         VR+ EQ LLL LI  RW LP+  ++  
Sbjct:  222 ERENRRREIFEKVENAWKKISPENRVRMIEQFLLLCLIFARWLLPRAGITRQ 273          
BLAST of Transmembrane protein 26 vs. Planmine SMEST
Match: SMESG000079787.1 (SMESG000079787.1)

HSP 1 Score: 64.3142 bits (155), Expect = 7.631e-11
Identity = 56/148 (37.84%), Postives = 77/148 (52.03%), Query Frame = 2
Query:  545 LGTAADIAEFFDSFKDKTVQNNRFLCLMILGLWSCSLLQFSFVLTAARARKDQSGLISGKNTSVNSYTKYYQSNSTPYLSVFSIKETENKTVFVK--CCRYNWFSPDVYGIFISISLQDGPXXXXXXXXXXXXDVVSYTNMFFTAKNS 982
            +G AADI E F++ K+K V+++  L ++IL LW  SL QFS   T  +ARK + G              Y++  ST          TEN        CCR      +++ I  S+ LQD PF   R+ LI  FDV+SY+N+FFT KNS
Sbjct:  214 IGMAADILELFEALKEKVVRHHLILNIIILVLWQMSLFQFSLTKTVTKARKVRLG--------------YFEDYSTK-------SNTENNLQITNCICCR-----TELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNS 335          
The following BLAST results are available for this feature:
BLAST of Transmembrane protein 26 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
TMEM265.066e-838.46transmembrane protein 26 [Source:HGNC Symbol;Acc:H... [more]
TMEM261.639e-729.01transmembrane protein 26 [Source:HGNC Symbol;Acc:H... [more]
TMEM261.639e-729.01transmembrane protein 26 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Transmembrane protein 26 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Y119C1B.32.251e-2633.78pep chromosome:WBcel235:I:4550401:4552758:1 gene:W... [more]
Y119C1B.32.251e-2633.78pep chromosome:WBcel235:I:4549695:4552758:1 gene:W... [more]
back to top
BLAST of Transmembrane protein 26 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG142382.907e-3338.78gene:FBgn0039429 transcript:FBtr0085014[more]
back to top
BLAST of Transmembrane protein 26 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
si:dkey-163f12.112.893e-1135.80si:dkey-163f12.11 [Source:ZFIN;Acc:ZDB-GENE-081104... [more]
tmem26b6.365e-1034.88transmembrane protein 26b [Source:ZFIN;Acc:ZDB-GEN... [more]
tmem26a8.011e-1030.57transmembrane protein 26a [Source:ZFIN;Acc:ZDB-GEN... [more]
CU638868.17.946e-933.33transmembrane protein 26a [Source:NCBI gene;Acc:79... [more]
back to top
BLAST of Transmembrane protein 26 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nostrin1.475e-1629.45nitric oxide synthase trafficking [Source:Xenbase;... [more]
lrch31.300e-933.12leucine-rich repeats and calponin homology (CH) do... [more]
back to top
BLAST of Transmembrane protein 26 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Tmem267.164e-628.10transmembrane protein 26 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Transmembrane protein 26 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q6ZUK4|TMM26_HUMAN7.872e-729.01Transmembrane protein 26 OS=Homo sapiens OX=9606 G... [more]
back to top
BLAST of Transmembrane protein 26 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7UHY61.072e-5446.95Uncharacterized protein (Fragment) OS=Capitella te... [more]
A0A210QYM21.151e-5445.14Transmembrane protein 26 OS=Mizuhopecten yessoensi... [more]
A0A1S3JPY42.449e-5344.64LOW QUALITY PROTEIN: transmembrane protein 26-like... [more]
A0A433UB432.825e-5049.17Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
K1S2808.323e-5045.61Transmembrane protein 26 OS=Crassostrea gigas OX=2... [more]
back to top
BLAST of Transmembrane protein 26 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tmem26a1.170e-1629.01transmembrane protein 26-like [Source:NCBI gene;Ac... [more]
tmem26b4.630e-1034.07transmembrane protein 26b [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSAMXT00000044825.14.924e-1029.45pep primary_assembly:Astyanax_mexicanus-2.0:6:1299... [more]
back to top
BLAST of Transmembrane protein 26 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 26 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 26 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO408471.552e-2531.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400165.253e-2335.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO327607.947e-1625.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479241.027e-1530.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485612.530e-1229.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transmembrane protein 26 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000005990.21.221e-933.72pep primary_assembly:ASM223467v1:15:16625055:16640... [more]
tmem26a1.854e-832.18transmembrane protein 26a [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Transmembrane protein 26 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001147.13.785e-176100.00SMESG000001147.1[more]
SMESG000031505.14.443e-3940.54SMESG000031505.1[more]
SMESG000049136.15.707e-1233.56SMESG000049136.1[more]
SMESG000049136.15.814e-1233.56SMESG000049136.1[more]
SMESG000079787.17.631e-1137.84SMESG000079787.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019533 ID=SMED30019533|Name=Transmembrane protein 26|organism=Schmidtea mediterranea sexual|type=transcript|length=1354bp
AGAAAATTTGTCACGTCAGATTTGAGAATCTCAATGAAAAATGATTTCAC
TTGAGAATGAAATGTGCAACAGTAACTAGAGCGCTGATTGTTAGGTTATG
TTTTGCCAGCCATGGGCTAATATCCATCTGTTTGTTATACAAGTACACCT
ATCGTTCTACATATTTTTACTTAGCCATCGCTCTTGCTGGATTGTTTTTT
GAATCTATGGTCACTCTGGTCAGGAAACATGGTCACGAATGGAAATGGTT
TTGCCCTAGTGTCTTTTTTTATTTATTTTCTGTCGTTCCATCAATTTGGT
TCTTTGAAATGGAATTATTCGATTTTCGAGCTTTTGCAATGGAGAAACGT
ATAGAACAGCTCAAGACAACATCATTTAATGAAACATCAGAAAAAGAAGA
AAGATTAACAGTGGACTTCGAAGAAATGGAGAAATCTGTTAGAATTTCTG
AGCAGCTGTTGTTGCTGCTATTAATTTTGGGCAGATGGTTTCTTCCGAAA
GGAAAACTTAGCCATGATCAATTGTCACAACTTCTTTTAGTTATTTAGGA
ACAGCAGCTGATATTGCCGAATTCTTTGATTCTTTCAAAGATAAAACTGT
ACAAAATAACCGTTTTTTATGCCTGATGATTTTAGGGCTTTGGTCATGTT
CCTTATTGCAATTTTCCTTTGTACTGACAGCGGCTAGAGCAAGAAAAGAT
CAAAGTGGACTTATATCCGGAAAAAACACATCAGTAAATTCATACACAAA
ATACTATCAATCTAACAGCACTCCATATTTGAGTGTATTTTCAATCAAAG
AAACCGAAAACAAAACCGTTTTTGTGAAGTGTTGCAGGTACAATTGGTTT
TCTCCCGATGTTTATGGGATTTTCATATCAATTTCCTTACAAGACGGTCC
TTTTCTGGCGTTTAGATTGGCTCTGATTTTTCGATTTGACGTCGTCAGTT
ATACAAATATGTTTTTTACGGCCAAAAATTCTTTGGTAATCATTCTACTG
GTTTATCGGTTGATTGTCATTTGGTGTGAACAAAAGAAAAAGATTGAACT
CCAAGAAAATAGCGAGAACATCAAAATCCAACCTCCACAGATCGAGGTGA
AAAAAATCGACAGATTTTATCAAAATGGATTTTTTGACGGTTATTTCGAA
AAGAACATTGAAAAACCGATTTTTCCCTTTGCCGACGGAACATATTCCTG
TTCTGATTTCAACAATCAAATCTCATCAAACTTTAGAACAGGGAAAAAAC
CACCAGAGTTTAATTTACAATGGAAGTCAATTAAAAAGCCGGAACTTGAA
AAAAATCTTTTTACAATTCCTTTAAAAGACGAAAGAAATTTTCAGCTAAA
CTAC
back to top

protein sequence of SMED30019533-orf-1

>SMED30019533-orf-1 ID=SMED30019533-orf-1|Name=SMED30019533-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=164bp
MKCATVTRALIVRLCFASHGLISICLLYKYTYRSTYFYLAIALAGLFFES
MVTLVRKHGHEWKWFCPSVFFYLFSVVPSIWFFEMELFDFRAFAMEKRIE
QLKTTSFNETSEKEERLTVDFEEMEKSVRISEQLLLLLLILGRWFLPKGK
LSHDQLSQLLLVI*
back to top

protein sequence of SMED30019533-orf-2

>SMED30019533-orf-2 ID=SMED30019533-orf-2|Name=SMED30019533-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=243bp
MILGLWSCSLLQFSFVLTAARARKDQSGLISGKNTSVNSYTKYYQSNSTP
YLSVFSIKETENKTVFVKCCRYNWFSPDVYGIFISISLQDGPFLAFRLAL
IFRFDVVSYTNMFFTAKNSLVIILLVYRLIVIWCEQKKKIELQENSENIK
IQPPQIEVKKIDRFYQNGFFDGYFEKNIEKPIFPFADGTYSCSDFNNQIS
SNFRTGKKPPEFNLQWKSIKKPELEKNLFTIPLKDERNFQLNY
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR019169Transmembrane_26
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019169Transmembrane protein 26PFAMPF09772Tmem26coord: 6..164
e-value: 3.3E-44
score: 151.4
IPR019169Transmembrane protein 26PANTHERPTHR22168TMEM26 PROTEINcoord: 1..164
NoneNo IPR availableTMHMMTMhelixcoord: 64..83
NoneNo IPR availableTMHMMTMhelixcoord: 9..31
NoneNo IPR availableTMHMMTMhelixcoord: 36..55