T-box 20 protein

Overview
NameT-box 20 protein
Smed IDSMED30019532
Length (bp)1822
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of T-box 20 protein (SMED30019532) t-SNE clustered cells

Violin plots show distribution of expression levels for T-box 20 protein (SMED30019532) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of T-box 20 protein (SMED30019532) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for T-box 20 protein (SMED30019532) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019532

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30019532h1SMcG0007448 dd_Smed_v4_19890_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
dorsal-ventral muscle cellSMED30019532h1SMcG0007448 dd_Smed_v4_19890_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of T-box 20 protein vs. Ensembl Human
Match: TBX20 (T-box transcription factor 20 [Source:HGNC Symbol;Acc:HGNC:11598])

HSP 1 Score: 322.783 bits (826), Expect = 9.900e-104
Identity = 150/226 (66.37%), Postives = 181/226 (80.09%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLR 1234
            +++I+C LETK+LW+KF ELGTEMIITKSGRRMFP IR+S +G+ P  KY V MDI+PVDNKRYRYAYHRSSWLVAGKADP +  R Y HPDSPF+GE L KQ VSFEK+KLTNN +D+HG+IILNSMHKYQPR+HI+ K            ++ ++    +++F+FPET+F AVTAYQNQLITKLKID NPFAKGFRDSSRLTD ERES+ESL+ + S   S +R
Sbjct:   97 MAKIACSLETKELWDKFHELGTEMIITKSGRRMFPTIRVSFSGVDPEAKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFTGEQLLKQMVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKD-------HTASLLNLKSEEFRTFIFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDIERESVESLIQKHSYARSPIR 315          
BLAST of T-box 20 protein vs. Ensembl Human
Match: TBX18 (T-box transcription factor 18 [Source:HGNC Symbol;Acc:HGNC:11595])

HSP 1 Score: 264.233 bits (674), Expect = 2.058e-79
Identity = 121/209 (57.89%), Postives = 155/209 (74.16%), Query Frame = 2
Query:  578 LETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGH-YQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLL 1201
            L+  +LW++F E+GTEMIITK+GRRMFP +R+ I+GL P+ +Y++AMDI+PVDNKRYRY YH S W+VAG AD  V  R Y HPDSP SGE   +Q +SF+KLKLTNN +D  G+IIL+SMHKYQPR+H++ KD  +  S      I+ +P G   ++F FPET+F  VTAYQNQ IT+LKID NPFAKGFRDS R     R  +E+L+
Sbjct:  143 LQGAELWKRFHEIGTEMIITKAGRRMFPAMRVKISGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSPASGETWMRQVISFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDCGDDLS-----PIKPVPSGEGVKAFSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGR----NRMGLEALV 342          
BLAST of T-box 20 protein vs. Ensembl Human
Match: TBX15 (T-box transcription factor 15 [Source:HGNC Symbol;Acc:HGNC:11594])

HSP 1 Score: 254.988 bits (650), Expect = 3.717e-77
Identity = 119/215 (55.35%), Postives = 154/215 (71.63%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLL 1201
            + EI  +L+  DLW++F ++GTEMIITK+GRRMFP +R+ I GL P+ +Y++AMDI+PVDNKRYRY YH S W+VAG AD  V  R Y HPDS  SG+   +Q VSF+KLKLTNN +D  G+IIL+SMHKYQPR+H++ KD     S  +   + D      ++F FPET+F  VTAYQNQ IT+LKID NPFAKGFRDS R     R  +E+++
Sbjct:    4 MEEIQVELQCADLWKRFHDIGTEMIITKAGRRMFPAMRVKITGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSLASGDTWMRQVVSFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDFSSDLSPTKPVPVGD----GVKTFNFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGR----NRTGLEAIM 210          
BLAST of T-box 20 protein vs. Ensembl Human
Match: TBX15 (T-box transcription factor 15 [Source:HGNC Symbol;Acc:HGNC:11594])

HSP 1 Score: 256.914 bits (655), Expect = 9.125e-77
Identity = 122/232 (52.59%), Postives = 161/232 (69.40%), Query Frame = 2
Query:  506 TNLNSFQSVQSTFSIPGLSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLL 1201
            T+L S  +     ++  + EI  +L+  DLW++F ++GTEMIITK+GRRMFP +R+ I GL P+ +Y++AMDI+PVDNKRYRY YH S W+VAG AD  V  R Y HPDS  SG+   +Q VSF+KLKLTNN +D  G+IIL+SMHKYQPR+H++ KD     S  +   + D      ++F FPET+F  VTAYQNQ IT+LKID NPFAKGFRDS R     R  +E+++
Sbjct:   93 TDLASGAAGPVPAAMSSMEEIQVELQCADLWKRFHDIGTEMIITKAGRRMFPAMRVKITGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSLASGDTWMRQVVSFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDFSSDLSPTKPVPVGD----GVKTFNFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGR----NRTGLEAIM 316          
BLAST of T-box 20 protein vs. Ensembl Human
Match: TBX18 (T-box transcription factor 18 [Source:HGNC Symbol;Acc:HGNC:11595])

HSP 1 Score: 233.032 bits (593), Expect = 5.954e-73
Identity = 110/180 (61.11%), Postives = 136/180 (75.56%), Query Frame = 2
Query:  626 MIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGH-YQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSR 1162
            MIITK+GRRMFP +R+ I+GL P+ +Y++AMDI+PVDNKRYRY YH S W+VAG AD  V  R Y HPDSP SGE   +Q +SF+KLKLTNN +D  G+IIL+SMHKYQPR+H++ KD  +  S      I+ +P G   ++F FPET+F  VTAYQNQ IT+LKID NPFAKGFRDS R
Sbjct:    1 MIITKAGRRMFPAMRVKISGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSPASGETWMRQVISFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDCGDDLS-----PIKPVPSGEGVKAFSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGR 175          
BLAST of T-box 20 protein vs. Ensembl Celegans
Match: mab-9 (T-box protein 12 [Source:UniProtKB/Swiss-Prot;Acc:P90971])

HSP 1 Score: 238.81 bits (608), Expect = 3.704e-73
Identity = 115/215 (53.49%), Postives = 156/215 (72.56%), Query Frame = 2
Query:  566 ISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLT--DFERESMESLLS 1204
            I C+LE  +LW KF +LGTEMIITKSGRRMFP +++S   +  +  Y++ +D++PVD+KRYRY Y++S+WL AGKA+P    R Y HPDSPF+G+ L K  +SFEK KLTNN +D+ G++ILNSMHKYQPRIHI+ +      +N  + N   + +  + ++ FPET F+AVTAYQNQLITKLKI+ NPFAKGFRD +  +  + ER   + +LS
Sbjct:   77 IECKLEGSELWAKFFDLGTEMIITKSGRRMFPTVKVSFTNVILDALYYIFLDVVPVDSKRYRYIYNKSAWLTAGKAEPVPKNRYYLHPDSPFTGDQLLKHVISFEKTKLTNNEVDKTGHLILNSMHKYQPRIHIVQRQK----ANPLDPNKVVMSEEKHCTYTFPETQFMAVTAYQNQLITKLKIEKNPFAKGFRDPTGRSPDEMERSPGDMMLS 287          
BLAST of T-box 20 protein vs. Ensembl Celegans
Match: tbx-2 (T-box protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q19691])

HSP 1 Score: 214.542 bits (545), Expect = 4.346e-63
Identity = 99/196 (50.51%), Postives = 140/196 (71.43%), Query Frame = 2
Query:  572 CQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSS 1159
             +L+ ++LW++FS+ GTEM+ITKSGRR+FP  R+ I+GL    +YFV MD++P D   +RY ++ S W++AGKADPE+    Y HPDSP +GE+   +  +F KLKLTNN+ D+HGY ILNSMHKYQPR+H++      + ++  N          +++F+F ET FIAVTAYQN+ +T+LKI+ NPFAKGFRD+ 
Sbjct:   63 VELDERELWQQFSQCGTEMVITKSGRRIFPAYRVKISGLDKKSQYFVMMDLVPAD--EHRYKFNNSRWMIAGKADPEMPKTLYIHPDSPSTGEHWMSKGANFHKLKLTNNISDKHGYTILNSMHKYQPRLHVV------RCADRHNLMYST-----FRTFVFRETEFIAVTAYQNEKVTELKIENNPFAKGFRDAG 245          
BLAST of T-box 20 protein vs. Ensembl Celegans
Match: tbx-2 (T-box protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q19691])

HSP 1 Score: 214.542 bits (545), Expect = 4.346e-63
Identity = 99/196 (50.51%), Postives = 140/196 (71.43%), Query Frame = 2
Query:  572 CQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSS 1159
             +L+ ++LW++FS+ GTEM+ITKSGRR+FP  R+ I+GL    +YFV MD++P D   +RY ++ S W++AGKADPE+    Y HPDSP +GE+   +  +F KLKLTNN+ D+HGY ILNSMHKYQPR+H++      + ++  N          +++F+F ET FIAVTAYQN+ +T+LKI+ NPFAKGFRD+ 
Sbjct:   63 VELDERELWQQFSQCGTEMVITKSGRRIFPAYRVKISGLDKKSQYFVMMDLVPAD--EHRYKFNNSRWMIAGKADPEMPKTLYIHPDSPSTGEHWMSKGANFHKLKLTNNISDKHGYTILNSMHKYQPRLHVV------RCADRHNLMYST-----FRTFVFRETEFIAVTAYQNEKVTELKIENNPFAKGFRDAG 245          
BLAST of T-box 20 protein vs. Ensembl Celegans
Match: mls-1 (T-box transcription factor mls-1 [Source:UniProtKB/Swiss-Prot;Acc:O17212])

HSP 1 Score: 192.2 bits (487), Expect = 7.920e-57
Identity = 93/196 (47.45%), Postives = 128/196 (65.31%), Query Frame = 2
Query:  566 ISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRD 1153
            I   L++ +LW +F  LGTEMI+TKSGRRMFP + + I GL P   Y V +D+  ++ KR+RY++H+S W+  G  + E+  R + H DSP  G +  +  VSF+K+KLTNN +D +G+II+NSMHKY+PR+HI+ +D  +K                  +F F ET FIAVTAYQN  IT LKI+ NPFAKGFR+
Sbjct:   31 IRVFLQSSNLWRRFHNLGTEMIVTKSGRRMFPTLSVIIAGLDPVKSYVVMVDLECIEMKRFRYSFHQSKWISTGPGESELPSRMFVHTDSPARGAHWMRAPVSFDKMKLTNNQLDNNGHIIVNSMHKYRPRVHIIEQDDSQK----------------RHTFSFEETEFIAVTAYQNHRITSLKIESNPFAKGFRE 210          
BLAST of T-box 20 protein vs. Ensembl Celegans
Match: tbx-7 (Putative T-box protein 7 [Source:UniProtKB/Swiss-Prot;Acc:Q95PX3])

HSP 1 Score: 166.777 bits (421), Expect = 1.120e-46
Identity = 86/195 (44.10%), Postives = 118/195 (60.51%), Query Frame = 2
Query:  572 CQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPD-GHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRD 1153
             +L  ++LW  F E GTEMIITK GRRMFP++++ ++GL  N  Y + M++I VD  + RY +   +W+VAG  +       + HP SP SGE      V F+  KL+NN  +  G+I+LNSMH+Y PR HI+  D+  +            P     ++F F ET FIAVTAYQN ++TK KID NPFAKGFR+
Sbjct:   30 VELVNRNLWSTFLECGTEMIITKKGRRMFPLVKLKLSGLDKNSNYTIIMEMISVD--KLRYKFWNGNWIVAGVGEHHPLPTCFVHPQSPRSGEWWMTDGVDFKMAKLSNNPFNNDGHIVLNSMHRYNPRFHIVRADSSGQ------------PILASLKTFSFKETEFIAVTAYQNDVVTKCKIDNNPFAKGFRN 210          
BLAST of T-box 20 protein vs. Ensembl Fly
Match: mid (gene:FBgn0261963 transcript:FBtr0310358)

HSP 1 Score: 301.212 bits (770), Expect = 3.372e-94
Identity = 150/276 (54.35%), Postives = 196/276 (71.01%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISING----LQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENF--NIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLRICPPEVSGSSECNGKRS----FSTHKNYQTMFNDSVSAIQRFLP 1354
            L  + C LETK+LW++F +LGTEMIITK+GRRMFP +R+S +G    +QP  +Y V MDIIP+D+KRYRYAYHRS+WLVAGKADP    R Y HPDSPFS E L KQ +SFEK+KLTNN MD++G I+LNSMH+YQPRIH++      + S+ ++   N +++ D  +++++FPET+F AVTAYQNQLITKLKID NPFAKGFRDSSRLTDF+R+ ME+LL +Q  + S LR+ P  +       G  S    F   + +  MF  +    Q  +P
Sbjct:  183 LKPVQCHLETKELWDRFHDLGTEMIITKTGRRMFPTVRVSFSGPLRQIQPADRYAVLMDIIPMDSKRYRYAYHRSAWLVAGKADPAPPARLYAHPDSPFSCEALRKQVISFEKVKLTNNEMDKNGQIVLNSMHRYQPRIHLV------RLSHGQSIPSNPKELQDLDHKTYVFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDFDRDPMEALLLEQQ-LRSPLRLFPDPLMQQFAAQGDPSSMALFEKARQHLQMFGGNSPYAQLMMP 451          
BLAST of T-box 20 protein vs. Ensembl Fly
Match: mid (gene:FBgn0261963 transcript:FBtr0079093)

HSP 1 Score: 301.212 bits (770), Expect = 3.372e-94
Identity = 150/276 (54.35%), Postives = 196/276 (71.01%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISING----LQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENF--NIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLRICPPEVSGSSECNGKRS----FSTHKNYQTMFNDSVSAIQRFLP 1354
            L  + C LETK+LW++F +LGTEMIITK+GRRMFP +R+S +G    +QP  +Y V MDIIP+D+KRYRYAYHRS+WLVAGKADP    R Y HPDSPFS E L KQ +SFEK+KLTNN MD++G I+LNSMH+YQPRIH++      + S+ ++   N +++ D  +++++FPET+F AVTAYQNQLITKLKID NPFAKGFRDSSRLTDF+R+ ME+LL +Q  + S LR+ P  +       G  S    F   + +  MF  +    Q  +P
Sbjct:  183 LKPVQCHLETKELWDRFHDLGTEMIITKTGRRMFPTVRVSFSGPLRQIQPADRYAVLMDIIPMDSKRYRYAYHRSAWLVAGKADPAPPARLYAHPDSPFSCEALRKQVISFEKVKLTNNEMDKNGQIVLNSMHRYQPRIHLV------RLSHGQSIPSNPKELQDLDHKTYVFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDFDRDPMEALLLEQQ-LRSPLRLFPDPLMQQFAAQGDPSSMALFEKARQHLQMFGGNSPYAQLMMP 451          
BLAST of T-box 20 protein vs. Ensembl Fly
Match: H15 (gene:FBgn0016660 transcript:FBtr0343225)

HSP 1 Score: 288.886 bits (738), Expect = 1.360e-88
Identity = 136/235 (57.87%), Postives = 177/235 (75.32%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISING----LQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENF--NIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLRICP 1243
            L+ + C LETK+LW+KF ELGTEMIITKSGRRMFP +R+S +G    +QP  +Y V +D++P+D++RYRYAYHRSSWLVAGKADP    R Y HPD P S E L KQ VSFEK+KLTNN MD+ G ++LNSMH+YQPRIH++      + S+ ++   + +++ D  +++F+FPET+F AVTAYQNQLITKLKID NPFAKGFRDSSRL+DF+R+ M++    Q    + LR  P
Sbjct:  273 LTPVQCHLETKELWDKFHELGTEMIITKSGRRMFPTVRVSFSGPLRQIQPADRYAVLLDVVPLDSRRYRYAYHRSSWLVAGKADPPPPSRIYAHPDCPLSPEALRKQVVSFEKVKLTNNEMDKSGQVVLNSMHRYQPRIHLV------RLSHGQSIPGSPKELQDMDHKTFVFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLSDFDRDPMDAFFFDQHMRTAPLRFFP 501          
BLAST of T-box 20 protein vs. Ensembl Fly
Match: H15 (gene:FBgn0016660 transcript:FBtr0079076)

HSP 1 Score: 288.886 bits (738), Expect = 1.483e-88
Identity = 136/235 (57.87%), Postives = 177/235 (75.32%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISING----LQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENF--NIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLRICP 1243
            L+ + C LETK+LW+KF ELGTEMIITKSGRRMFP +R+S +G    +QP  +Y V +D++P+D++RYRYAYHRSSWLVAGKADP    R Y HPD P S E L KQ VSFEK+KLTNN MD+ G ++LNSMH+YQPRIH++      + S+ ++   + +++ D  +++F+FPET+F AVTAYQNQLITKLKID NPFAKGFRDSSRL+DF+R+ M++    Q    + LR  P
Sbjct:  274 LTPVQCHLETKELWDKFHELGTEMIITKSGRRMFPTVRVSFSGPLRQIQPADRYAVLLDVVPLDSRRYRYAYHRSSWLVAGKADPPPPSRIYAHPDCPLSPEALRKQVVSFEKVKLTNNEMDKSGQVVLNSMHRYQPRIHLV------RLSHGQSIPGSPKELQDMDHKTFVFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLSDFDRDPMDAFFFDQHMRTAPLRFFP 502          
BLAST of T-box 20 protein vs. Ensembl Fly
Match: org-1 (gene:FBgn0021767 transcript:FBtr0071244)

HSP 1 Score: 234.958 bits (598), Expect = 5.629e-68
Identity = 112/202 (55.45%), Postives = 143/202 (70.79%), Query Frame = 2
Query:  551 PGLSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNI-RDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRD 1153
            P L++    LETK LW++F   GTEMIITK+GRRMFP  ++ I GL P+  Y   MD +P+D+KRYRYA+H S W+VAGKADP    R + HPDSP  G N  KQ VSF+KLKLTNN +D +G+IILNSMH+YQPR H++       Y   +N ++  +    H+++F+FPET F AVTAYQNQ +T+LKI  NPFAKGFRD
Sbjct:  191 PSLAQAIVVLETKALWDQFHAQGTEMIITKTGRRMFPTFQVRIGGLDPHATYICMMDFVPMDDKRYRYAFHNSCWVVAGKADPISPPRIHVHPDSPAVGSNWMKQIVSFDKLKLTNNQLDENGHIILNSMHRYQPRFHLV-------YLPPKNASLDENEHSSHFRTFIFPETSFTAVTAYQNQRVTQLKISSNPFAKGFRD 385          
BLAST of T-box 20 protein vs. Ensembl Zebrafish
Match: tbx20 (T-box transcription factor 20 [Source:NCBI gene;Acc:57936])

HSP 1 Score: 323.553 bits (828), Expect = 3.279e-104
Identity = 154/247 (62.35%), Postives = 188/247 (76.11%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLRICPPEVSGSSECNGKRSFSTH 1297
            +++ISC LETK+LW+KF ELGTEMIITKSGRRMFP IR+S +G+ P+ KY V MDI+PVDNKRYRYAYHRSSWLVAGKADP +  R Y HPDSPF+GE L KQ VSFEK+KLTNN +D+HG+IILNSMHKYQPR+HI+ K            ++ ++    +++F+F ET+F AVTAYQNQLIT+LKID NPFAKGFRDSSRLTD ERES+ESL+ + S   S +R      +G  E  G+   S H
Sbjct:   96 MAKISCSLETKELWDKFHELGTEMIITKSGRRMFPTIRVSFSGVDPDAKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFTGEQLLKQMVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKD-------HTASLLNLKSEEFRTFVFTETVFTAVTAYQNQLITRLKIDSNPFAKGFRDSSRLTDIERESVESLIHKHSYARSPIRT----YAGDEETLGEEGHSAH 331          
BLAST of T-box 20 protein vs. Ensembl Zebrafish
Match: tbx15 (T-box transcription factor 15 [Source:ZFIN;Acc:ZDB-GENE-020529-1])

HSP 1 Score: 259.225 bits (661), Expect = 1.288e-77
Identity = 120/216 (55.56%), Postives = 157/216 (72.69%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGH-YQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLL 1201
            + EI  +L+  DLW++F ++GTEMIITK+GRRMFP +R+ I GL P+ +Y++AMDI+PVDNKRYRY YH S W+VAG AD  V  R Y HPDS  SG+   +Q VSF+KLKLTNN +D  G+IIL+SMHKYQPR+H++ KD   + S       + +P G   ++F FPET+F  VTAYQNQ IT+LKID NPFAKGFRDS R +   R  +E+++
Sbjct:  107 MEEIQVELQCADLWKRFHDIGTEMIITKAGRRMFPAMRVKIVGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSLASGDTWMRQVVSFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDFSSELS-----PTKPVPTGEGVKTFSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGRNSPPYRTGLEAIM 317          
BLAST of T-box 20 protein vs. Ensembl Zebrafish
Match: tbx15 (T-box transcription factor 15 [Source:ZFIN;Acc:ZDB-GENE-020529-1])

HSP 1 Score: 257.299 bits (656), Expect = 6.727e-77
Identity = 120/216 (55.56%), Postives = 156/216 (72.22%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGH-YQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLL 1201
            + EI  +L+  DLW++F ++GTEMIITK+GRRMFP +R+ I GL P+ +Y++AMDI+PVDNKRYRY YH S W+VAG AD  V  R Y HPDS  SG+   +Q VSF+KLKLTNN +D  G+IIL+SMHKYQPR+H++ KD   + S       + +P G   ++F FPET+F  VTAYQNQ IT+LKID NPFAKGFRDS R     R  +E+++
Sbjct:  107 MEEIQVELQCADLWKRFHDIGTEMIITKAGRRMFPAMRVKIVGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSLASGDTWMRQVVSFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDFSSELS-----PTKPVPTGEGVKTFSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGR----NRTGLEAIM 313          
BLAST of T-box 20 protein vs. Ensembl Zebrafish
Match: tbx1 (T-box transcription factor 1 [Source:NCBI gene;Acc:368206])

HSP 1 Score: 244.202 bits (622), Expect = 1.179e-73
Identity = 121/253 (47.83%), Postives = 166/253 (65.61%), Query Frame = 2
Query:  551 PGLSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFER-------ESMESLLSQQSPVVSGLRICPPEVSGSSECNGKRSF 1288
            P ++ I+ QLE K LW++F++LGTEMI+TK+GRRMFP  ++ I G+ P   Y + MD +PVD+KRYRYA+H SSWLVAGKADP    R ++HPDSP  G    KQ VSF+KLKLTNN++D +G+IILNSMH+YQPR H++  D  +    +   N        Y++F+F ET F AVTAYQN  IT+LKI  NPFAKGFRD     D+ R       + M +    ++P+ S     PP+ +G+ + + +R +
Sbjct:  102 PKVANINVQLEMKALWDEFNQLGTEMIVTKAGRRMFPTFQVKIFGMDPMADYMLLMDFLPVDDKRYRYAFHSSSWLVAGKADPATPGRVHYHPDSPAKGAQWMKQIVSFDKLKLTNNLLDDNGHIILNSMHRYQPRFHVVYVDPRKDSEKYAEEN--------YKTFVFEETRFTAVTAYQNHRITQLKIASNPFAKGFRDCDP-EDWPRNHRPGSLQIMSAFARTRNPMSS-----PPQQNGTEKEDSRREY 340          
BLAST of T-box 20 protein vs. Ensembl Zebrafish
Match: tbx1 (T-box transcription factor 1 [Source:NCBI gene;Acc:368206])

HSP 1 Score: 244.202 bits (622), Expect = 1.599e-73
Identity = 121/253 (47.83%), Postives = 166/253 (65.61%), Query Frame = 2
Query:  551 PGLSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFER-------ESMESLLSQQSPVVSGLRICPPEVSGSSECNGKRSF 1288
            P ++ I+ QLE K LW++F++LGTEMI+TK+GRRMFP  ++ I G+ P   Y + MD +PVD+KRYRYA+H SSWLVAGKADP    R ++HPDSP  G    KQ VSF+KLKLTNN++D +G+IILNSMH+YQPR H++  D  +    +   N        Y++F+F ET F AVTAYQN  IT+LKI  NPFAKGFRD     D+ R       + M +    ++P+ S     PP+ +G+ + + +R +
Sbjct:  110 PKVANINVQLEMKALWDEFNQLGTEMIVTKAGRRMFPTFQVKIFGMDPMADYMLLMDFLPVDDKRYRYAFHSSSWLVAGKADPATPGRVHYHPDSPAKGAQWMKQIVSFDKLKLTNNLLDDNGHIILNSMHRYQPRFHVVYVDPRKDSEKYAEEN--------YKTFVFEETRFTAVTAYQNHRITQLKIASNPFAKGFRDCDP-EDWPRNHRPGSLQIMSAFARTRNPMSS-----PPQQNGTEKEDSRREY 348          
BLAST of T-box 20 protein vs. Ensembl Xenopus
Match: tmub2 (transmembrane and ubiquitin-like domain containing 2 [Source:Xenbase;Acc:XB-GENE-5955419])

HSP 1 Score: 315.849 bits (808), Expect = 2.994e-101
Identity = 148/226 (65.49%), Postives = 180/226 (79.65%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLR 1234
            +++ISC LETK+LW+KF +LGTEMIITKSGRRMFP IR+S +G+  + KY V MDI+PVDNKRYRYAYHRSSWLVAGKADP +  R Y HPDSPF+GE L KQ VSFEK+KLTNN +D+HG+IILNSMHKYQPR+HI+ K            ++ ++    +++F+F ET+F AVTAYQNQLITKLKID NPFAKGFRDSSRLTD ERES+ESL+ + S   S +R
Sbjct:   91 MAKISCSLETKELWDKFHDLGTEMIITKSGRRMFPTIRVSFSGVDADAKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFTGEQLLKQMVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKD-------HTASLLNLKSEEFRTFIFQETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDIERESVESLIQKHSYARSPIR 309          
BLAST of T-box 20 protein vs. Ensembl Xenopus
Match: mgc107884 (mgc107884 protein [Source:Xenbase;Acc:XB-GENE-5767840])

HSP 1 Score: 264.233 bits (674), Expect = 8.585e-80
Identity = 123/213 (57.75%), Postives = 156/213 (73.24%), Query Frame = 2
Query:  566 ISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQ-SFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLL 1201
            +   L+  +LW++F E+GTEMIITK+GRRMFP +R+ I GL P+ +Y++AMDI+PVDNKRYRY YH S W+VAG AD  V  R Y HPDSP SGE   +Q +SF+KLKLTNN +D  G+IIL+SMHKYQPR+H++ KD  E+ S      ++ IP G  + +F FPETIF  VTAYQNQ IT+LKID NPFAKGFRDS R     R  +E+L+
Sbjct:  112 VRVDLQGAELWKRFHEIGTEMIITKAGRRMFPAMRVKITGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSPASGETWMRQVISFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDCGEELS-----PVKPIPVGEGEKAFSFPETIFTTVTAYQNQQITRLKIDRNPFAKGFRDSGR----NRMGLEALV 315          
BLAST of T-box 20 protein vs. Ensembl Xenopus
Match: TBX15 (T-box 15 [Source:NCBI gene;Acc:100489988])

HSP 1 Score: 259.61 bits (662), Expect = 7.164e-78
Identity = 148/328 (45.12%), Postives = 206/328 (62.80%), Query Frame = 2
Query:  254 MSAKATAFSIDSIIRKRAFNQHNELDDDDINSQCSRNKIRIFKTIDRISPLQIDTGIDGSENG-SISLXXXXXXXXXKPTDWGKTTNLNSFQSVQ----------STFSIPGLSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDG-HYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLL 1201
            +S++A AFS++++I     N+  +L D D        +  +  +++ +SP Q D G +G E+G  + LN D   S++  T+        S++S               S+  + EI  +L+  DLW++F ++GTEMIITK+GRRMFP +R+ I+GL P+ +Y++AMDI+PVDNKRYRY YH S W+VAG AD  V  R Y HPDS  SG+   +Q VSF+KLKLTNN +D  G+IIL+SMHKYQPRIH++ KD     S       + IP G   ++F FPET+F  VTAYQNQ IT+LKID NPFAKGFRDS R     R  +E+++
Sbjct:   11 LSSRAHAFSVEALI---GANKKRKLRDWD--------EKGLDLSMESLSP-QGDLG-EGEESGPCLDLNPDSEHSTSSDTEVLAERTSCSYESCPDLAPPRVPDPQPLSVTSMDEIQVELQCADLWKRFHDIGTEMIITKAGRRMFPAMRVKISGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYVHPDSLASGDTWMRQVVSFDKLKLTNNELDDQGHIILHSMHKYQPRIHVIRKDFSSDLS-----PTKPIPTGDGVKTFSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGR----NRTGLEAIM 316          
BLAST of T-box 20 protein vs. Ensembl Xenopus
Match: tbx1 (T-box 1 [Source:NCBI gene;Acc:619587])

HSP 1 Score: 246.128 bits (627), Expect = 9.795e-74
Identity = 134/291 (46.05%), Postives = 178/291 (61.17%), Query Frame = 2
Query:  551 PGLSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTM---EKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERES-------MESLLSQQSPVVSGLRICPPEVSGSSECNGKRSFSTHKNYQTMFNDSVSA--IQRFLPPKHSLPATDQL 1387
            P ++ I+ QLE K LW++F++LGTEMI+TK+GRRMFP  ++ I G+ P   Y + MD +PVD+KRYRYA+H SSWLVAGKADP    R ++HPDSP  G    KQ VSF+KLKLTNN++D +G+IILNSMH+YQPR H++  D     EKY+  ENF          ++F+F ET F AVTAYQN  IT+LKI  NPFAKGFRD     D+ R         M +    ++PV S     PP+     + +G+R +    +   +  D+     + R L P  SLP    L
Sbjct:  143 PKVANITVQLEMKALWDEFNQLGTEMIVTKAGRRMFPTFQVKIFGMDPMADYMLLMDFVPVDDKRYRYAFHSSSWLVAGKADPATPGRVHYHPDSPAKGAQWMKQIVSFDKLKLTNNLLDDNGHIILNSMHRYQPRFHVVYVDPRKDSEKYAE-ENF----------KTFVFEETRFTAVTAYQNHRITQLKIASNPFAKGFRDCDP-EDWPRNHRPGSLPLMNAFARSRNPVSS-----PPQNGSDKDGDGRREYERDTSGTPLHGDAAHQQLMSRVLSP--SLPVPGGL 414          
BLAST of T-box 20 protein vs. Ensembl Xenopus
Match: TBX22 (T-box 22 [Source:NCBI gene;Acc:100494512])

HSP 1 Score: 237.269 bits (604), Expect = 2.193e-70
Identity = 110/200 (55.00%), Postives = 143/200 (71.50%), Query Frame = 2
Query:  566 ISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPE-VHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSR 1162
            +  +L+  +LW +F ++GTEMIITK+GRRMFP +RI + GL P+ +Y++AMD+ PVD+KRYRY YH S W+VAG  D   +  R Y HPDSP SGE   +Q +SF+++KLTNN MD  G+IIL SMHKY+PR+HI++ D     S F+   I+ +P    ++F F ET F  VTAYQNQ ITKLKID NPFAKGFRD  R
Sbjct:   80 VQVELQGSELWRRFHDIGTEMIITKAGRRMFPSVRIKVKGLDPSKQYYIAMDVTPVDSKRYRYVYHSSQWMVAGNTDHSCITPRLYIHPDSPCSGETWMRQIISFDRIKLTNNEMDDKGHIILQSMHKYKPRVHIIVHD-----SRFDLSQIQSLPAEGVKTFSFKETEFTTVTAYQNQQITKLKIDRNPFAKGFRDPGR 274          
BLAST of T-box 20 protein vs. Ensembl Mouse
Match: Tbx20 (T-box 20 [Source:MGI Symbol;Acc:MGI:1888496])

HSP 1 Score: 322.783 bits (826), Expect = 6.393e-104
Identity = 150/226 (66.37%), Postives = 181/226 (80.09%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLR 1234
            +++I+C LETK+LW+KF ELGTEMIITKSGRRMFP IR+S +G+ P  KY V MDI+PVDNKRYRYAYHRSSWLVAGKADP +  R Y HPDSPF+GE L KQ VSFEK+KLTNN +D+HG+IILNSMHKYQPR+HI+ K            ++ ++    +++F+FPET+F AVTAYQNQLITKLKID NPFAKGFRDSSRLTD ERES+ESL+ + S   S +R
Sbjct:   96 MAKIACSLETKELWDKFHELGTEMIITKSGRRMFPTIRVSFSGVDPESKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFTGEQLLKQMVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKD-------HTASLLNLKSEEFRTFIFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDIERESVESLIQKHSYARSPIR 314          
BLAST of T-box 20 protein vs. Ensembl Mouse
Match: Tbx20 (T-box 20 [Source:MGI Symbol;Acc:MGI:1888496])

HSP 1 Score: 311.227 bits (796), Expect = 1.629e-101
Identity = 143/209 (68.42%), Postives = 170/209 (81.34%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERE 1183
            +++I+C LETK+LW+KF ELGTEMIITKSGRRMFP IR+S +G+ P  KY V MDI+PVDNKRYRYAYHRSSWLVAGKADP +  R Y HPDSPF+GE L KQ VSFEK+KLTNN +D+HG+IILNSMHKYQPR+HI+ K            ++ ++    +++F+FPET+F AVTAYQNQLITKLKID NPFAKGFRDSSRLTD ERE
Sbjct:   96 MAKIACSLETKELWDKFHELGTEMIITKSGRRMFPTIRVSFSGVDPESKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFTGEQLLKQMVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKD-------HTASLLNLKSEEFRTFIFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDIERE 297          
BLAST of T-box 20 protein vs. Ensembl Mouse
Match: Tbx18 (T-box18 [Source:MGI Symbol;Acc:MGI:1923615])

HSP 1 Score: 263.462 bits (672), Expect = 2.679e-79
Identity = 121/209 (57.89%), Postives = 155/209 (74.16%), Query Frame = 2
Query:  578 LETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGH-YQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLL 1201
            L+  +LW++F E+GTEMIITK+GRRMFP +R+ I+GL P+ +Y++AMDI+PVDNKRYRY YH S W+VAG AD  V  R Y HPDSP SGE   +Q +SF+KLKLTNN +D  G+IIL+SMHKYQPR+H++ KD  +  S      I+ +P G   ++F FPET+F  VTAYQNQ IT+LKID NPFAKGFRDS R     R  +E+L+
Sbjct:  149 LQGAELWKRFHEIGTEMIITKAGRRMFPAMRVKISGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSPASGETWMRQVISFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDCGDDLS-----PIKPVPSGEGVKAFSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGR----NRMGLEALV 348          
BLAST of T-box 20 protein vs. Ensembl Mouse
Match: Tbx15 (T-box 15 [Source:MGI Symbol;Acc:MGI:1277234])

HSP 1 Score: 256.914 bits (655), Expect = 6.072e-77
Identity = 122/232 (52.59%), Postives = 161/232 (69.40%), Query Frame = 2
Query:  506 TNLNSFQSVQSTFSIPGLSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLL 1201
            T+L S  +     ++  + EI  +L+  DLW++F ++GTEMIITK+GRRMFP +R+ I GL P+ +Y++AMDI+PVDNKRYRY YH S W+VAG AD  V  R Y HPDS  SG+   +Q VSF+KLKLTNN +D  G+IIL+SMHKYQPR+H++ KD     S  +   + D      ++F FPET+F  VTAYQNQ IT+LKID NPFAKGFRDS R     R  +E+++
Sbjct:   93 TDLASGAAGPVPAAMSSMEEIQVELQCADLWKRFHDIGTEMIITKAGRRMFPAMRVKITGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSLASGDTWMRQVVSFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDFSSDLSPTKPVPVGD----GVKTFNFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGR----NRTGLEAIM 316          
BLAST of T-box 20 protein vs. Ensembl Mouse
Match: Tbx10 (T-box 10 [Source:MGI Symbol;Acc:MGI:1261436])

HSP 1 Score: 240.35 bits (612), Expect = 5.420e-73
Identity = 111/202 (54.95%), Postives = 144/202 (71.29%), Query Frame = 2
Query:  551 PGLSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDS 1156
            P +S +  QLE K LWE+F++LGTEMI+TK+GRRMFP  ++ I G+     Y + MD IP+D+KRYRYA+H S+WLVAGKADP    R +FHPDSP  G    +Q VSF+KLKLTNN+MD +G+IILNSMH+YQPR H++  D  +  + +   N        ++SF+F ET F AVTAYQN  IT+LKI  NPFAKGFR++
Sbjct:   60 PRVSSVMVQLEMKPLWEEFNQLGTEMIVTKAGRRMFPTFQVKILGMDTLADYALLMDFIPLDDKRYRYAFHSSAWLVAGKADPATPGRVHFHPDSPAKGAQWMRQIVSFDKLKLTNNLMDDNGHIILNSMHRYQPRFHVVFVDPRKDSARYAQEN--------FKSFVFTETQFTAVTAYQNHRITQLKIASNPFAKGFREA 253          
BLAST of T-box 20 protein vs. UniProt/SwissProt
Match: sp|Q8UW76|TBX20_CHICK (T-box transcription factor TBX20 OS=Gallus gallus OX=9031 GN=TBX20 PE=2 SV=1)

HSP 1 Score: 324.324 bits (830), Expect = 1.036e-103
Identity = 151/226 (66.81%), Postives = 181/226 (80.09%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLR 1234
            +++ISC LETK+LW+KF ELGTEMIITKSGRRMFP IR+S +G+ P  KY V MDI+PVDNKRYRYAYHRSSWLVAGKADP +  R Y HPDSPF+GE L KQ VSFEK+KLTNN +D+HG+IILNSMHKYQPR+HI+ K            ++ ++    +++F+FPET+F AVTAYQNQLITKLKID NPFAKGFRDSSRLTD ERES+ESL+ + S   S +R
Sbjct:   91 MAKISCSLETKELWDKFHELGTEMIITKSGRRMFPTIRVSFSGVDPEAKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFTGEQLMKQMVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKD-------HTASLLNLKSEEFRTFIFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDIERESVESLIQKHSYARSPIR 309          
BLAST of T-box 20 protein vs. UniProt/SwissProt
Match: sp|Q9I9K7|TBX20_DANRE (T-box transcription factor TBX20 OS=Danio rerio OX=7955 GN=tbx20 PE=2 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 2.475e-103
Identity = 154/247 (62.35%), Postives = 188/247 (76.11%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLRICPPEVSGSSECNGKRSFSTH 1297
            +++ISC LETK+LW+KF ELGTEMIITKSGRRMFP IR+S +G+ P+ KY V MDI+PVDNKRYRYAYHRSSWLVAGKADP +  R Y HPDSPF+GE L KQ VSFEK+KLTNN +D+HG+IILNSMHKYQPR+HI+ K            ++ ++    +++F+F ET+F AVTAYQNQLIT+LKID NPFAKGFRDSSRLTD ERES+ESL+ + S   S +R      +G  E  G+   S H
Sbjct:   96 MAKISCSLETKELWDKFHELGTEMIITKSGRRMFPTIRVSFSGVDPDAKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFTGEQLLKQMVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKD-------HTASLLNLKSEEFRTFVFTETVFTAVTAYQNQLITRLKIDSNPFAKGFRDSSRLTDIERESVESLIHKHSYARSPIRT----YAGDEETLGEEGHSAH 331          
BLAST of T-box 20 protein vs. UniProt/SwissProt
Match: sp|Q9ES03|TBX20_MOUSE (T-box transcription factor TBX20 OS=Mus musculus OX=10090 GN=Tbx20 PE=2 SV=3)

HSP 1 Score: 322.783 bits (826), Expect = 4.472e-103
Identity = 150/226 (66.37%), Postives = 181/226 (80.09%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLR 1234
            +++I+C LETK+LW+KF ELGTEMIITKSGRRMFP IR+S +G+ P  KY V MDI+PVDNKRYRYAYHRSSWLVAGKADP +  R Y HPDSPF+GE L KQ VSFEK+KLTNN +D+HG+IILNSMHKYQPR+HI+ K            ++ ++    +++F+FPET+F AVTAYQNQLITKLKID NPFAKGFRDSSRLTD ERES+ESL+ + S   S +R
Sbjct:   96 MAKIACSLETKELWDKFHELGTEMIITKSGRRMFPTIRVSFSGVDPESKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFTGEQLLKQMVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKD-------HTASLLNLKSEEFRTFIFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDIERESVESLIQKHSYARSPIR 314          
BLAST of T-box 20 protein vs. UniProt/SwissProt
Match: sp|Q9UMR3|TBX20_HUMAN (T-box transcription factor TBX20 OS=Homo sapiens OX=9606 GN=TBX20 PE=1 SV=4)

HSP 1 Score: 322.783 bits (826), Expect = 4.754e-103
Identity = 150/226 (66.37%), Postives = 181/226 (80.09%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLR 1234
            +++I+C LETK+LW+KF ELGTEMIITKSGRRMFP IR+S +G+ P  KY V MDI+PVDNKRYRYAYHRSSWLVAGKADP +  R Y HPDSPF+GE L KQ VSFEK+KLTNN +D+HG+IILNSMHKYQPR+HI+ K            ++ ++    +++F+FPET+F AVTAYQNQLITKLKID NPFAKGFRDSSRLTD ERES+ESL+ + S   S +R
Sbjct:   97 MAKIACSLETKELWDKFHELGTEMIITKSGRRMFPTIRVSFSGVDPEAKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFTGEQLLKQMVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKD-------HTASLLNLKSEEFRTFIFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDIERESVESLIQKHSYARSPIR 315          
BLAST of T-box 20 protein vs. UniProt/SwissProt
Match: sp|Q3SA46|TBX20_XENTR (T-box transcription factor TBX20 OS=Xenopus tropicalis OX=8364 GN=tbx20 PE=2 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 1.586e-100
Identity = 148/226 (65.49%), Postives = 180/226 (79.65%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLR 1234
            +++ISC LETK+LW+KF +LGTEMIITKSGRRMFP IR+S +G+  + KY V MDI+PVDNKRYRYAYHRSSWLVAGKADP +  R Y HPDSPF+GE L KQ VSFEK+KLTNN +D+HG+IILNSMHKYQPR+HI+ K            ++ ++    +++F+F ET+F AVTAYQNQLITKLKID NPFAKGFRDSSRLTD ERES+ESL+ + S   S +R
Sbjct:   91 MAKISCSLETKELWDKFHDLGTEMIITKSGRRMFPTIRVSFSGVDADAKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFTGEQLLKQMVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKD-------HTASLLNLKSEEFRTFIFQETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDIERESVESLIQKHSYARSPIR 309          
BLAST of T-box 20 protein vs. TrEMBL
Match: A0A5P8I4I6 (T-box 20 protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1162.52 bits (3006), Expect = 0.000e+0
Identity = 573/573 (100.00%), Postives = 573/573 (100.00%), Query Frame = 2
Query:   77 MMNICEKSASVTGVDGLFREYVSPNSREKDSITSGNLSPNLPEPTNDRLFFDEINTKRLMSAKATAFSIDSIIRKRAFNQHNELDDDDINSQCSRNKIRIFKTIDRISPLQIDTGIDGSENGSISLXXXXXXXXXKPTDWGKTTNLNSFQSVQSTFSIPGLSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLRICPPEVSGSSECNGKRSFSTHKNYQTMFNDSVSAIQRFLPPKHSLPATDQLKKDFEIQKLVKSFVNETNMFPEIFDSKCYDSIKLNSCFSASHLSSVLPPHFIRSGLTHNFQNPKIPITSSPMFSSHPSQVNGHNFPPLPSSINGLLAQIARSSRDDLTQSISSNPSDMLKNFLFMHRIASNPNYLN 1795
            MMNICEKSASVTGVDGLFREYVSPNSREKDSITSGNLSPNLPEPTNDRLFFDEINTKRLMSAKATAFSIDSIIRKRAFNQHNELDDDDINSQCSRNKIRIFKTIDRISPLQIDTGIDGSENGSISLNSDDNDSSNKPTDWGKTTNLNSFQSVQSTFSIPGLSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLRICPPEVSGSSECNGKRSFSTHKNYQTMFNDSVSAIQRFLPPKHSLPATDQLKKDFEIQKLVKSFVNETNMFPEIFDSKCYDSIKLNSCFSASHLSSVLPPHFIRSGLTHNFQNPKIPITSSPMFSSHPSQVNGHNFPPLPSSINGLLAQIARSSRDDLTQSISSNPSDMLKNFLFMHRIASNPNYLN
Sbjct:    1 MMNICEKSASVTGVDGLFREYVSPNSREKDSITSGNLSPNLPEPTNDRLFFDEINTKRLMSAKATAFSIDSIIRKRAFNQHNELDDDDINSQCSRNKIRIFKTIDRISPLQIDTGIDGSENGSISLNSDDNDSSNKPTDWGKTTNLNSFQSVQSTFSIPGLSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLRICPPEVSGSSECNGKRSFSTHKNYQTMFNDSVSAIQRFLPPKHSLPATDQLKKDFEIQKLVKSFVNETNMFPEIFDSKCYDSIKLNSCFSASHLSSVLPPHFIRSGLTHNFQNPKIPITSSPMFSSHPSQVNGHNFPPLPSSINGLLAQIARSSRDDLTQSISSNPSDMLKNFLFMHRIASNPNYLN 573          
BLAST of T-box 20 protein vs. TrEMBL
Match: F1CDF2 (TBX20 (Fragment) OS=Schmidtea polychroa OX=50054 PE=2 SV=1)

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 274/282 (97.16%), Postives = 278/282 (98.58%), Query Frame = 2
Query:  950 QPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLRICPPEVSGSSECNGKRSFSTHKNYQTMFNDSVSAIQRFLPPKHSLPATDQLKKDFEIQKLVKSFVNETNMFPEIFDSKCYDSIKLNSCFSASHLSSVLPPHFIRSGLTHNFQNPKIPITSSPMFSSHPSQVNGHNFPPLPSSINGLLAQIARSSRDDLTQSISSNPSDMLKNFLFMHRIASNPNYLN 1795
            QPRIHILLKDTMEKYSNFENFNIRDIPDGHY+SFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLRICPPEVSGS ECNGKRSFSTHKNYQTMFNDSVSAIQRFLPPKHSLP TDQLKKDFEIQKLVKSFVN+TNMFPEIFDSK YDSIKLNSCFSASHLSSVLPPHFIRSGLTHNFQNPKIPITSSPM+SSHPSQ NGHNFPPLPSSINGLLAQIARSSRDDLTQS+SSNPSDMLKNFLFMHRIASNPNYLN
Sbjct:    1 QPRIHILLKDTMEKYSNFENFNIRDIPDGHYRSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLRICPPEVSGSGECNGKRSFSTHKNYQTMFNDSVSAIQRFLPPKHSLPTTDQLKKDFEIQKLVKSFVNDTNMFPEIFDSKSYDSIKLNSCFSASHLSSVLPPHFIRSGLTHNFQNPKIPITSSPMYSSHPSQANGHNFPPLPSSINGLLAQIARSSRDDLTQSMSSNPSDMLKNFLFMHRIASNPNYLN 282          
BLAST of T-box 20 protein vs. TrEMBL
Match: A0A5J4NCN1 (T-box protein 20 (Fragment) OS=Paragonimus westermani OX=34504 GN=DEA37_0005270 PE=4 SV=1)

HSP 1 Score: 336.265 bits (861), Expect = 1.212e-108
Identity = 156/207 (75.36%), Postives = 177/207 (85.51%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFE 1177
            L  ++C LETK+LWEKFSELGTEMIITKSGRRMFPVIR+S  GL P+ KYFV MDIIPVD KRYRYAYHRSSWLVAGKADPE+H R Y HPDSPF+GE L+KQTVSFEKLKLTNNV+DRHGYIILNSMHKYQPRIH++ +  +E  ++    ++  +  G  +SF F ET+FIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLT+FE
Sbjct:   43 LDAVNCHLETKELWEKFSELGTEMIITKSGRRMFPVIRLSFTGLDPDAKYFVLMDIIPVDTKRYRYAYHRSSWLVAGKADPEMHLRHYIHPDSPFTGEQLTKQTVSFEKLKLTNNVLDRHGYIILNSMHKYQPRIHLVRRSCLENVNHLPVKSLDSLKPGEIKSFEFSETVFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTEFE 249          
BLAST of T-box 20 protein vs. TrEMBL
Match: A0A1S8WHM9 (T-box (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_10259 PE=4 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 4.185e-108
Identity = 162/232 (69.83%), Postives = 196/232 (84.48%), Query Frame = 2
Query:  560 SEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYS-----NFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSP---VVSGL 1231
            S + C LET++LWEKF+ELGTEMIITKSGRRMFPVIR+S  G+ P+ +Y VAMDIIPVD KRYRYAYHRSSWLVAGKADPE+H R Y HPDSPF+G+ L+KQTVSFEKLKLTNN +DRHGYIILNSMHKYQPR+H++  ++M+ +      + ++F+  D+     ++F FPET+FIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLT+FERESME+LL+QQ+    V++GL
Sbjct:  142 SSVECHLETRELWEKFNELGTEMIITKSGRRMFPVIRVSFTGVDPDSRYLVAMDIIPVDTKRYRYAYHRSSWLVAGKADPEMHLRQYVHPDSPFTGDQLAKQTVSFEKLKLTNNALDRHGYIILNSMHKYQPRVHLIRSNSMDDFGKLSIKSLDSFDPEDV-----ETFEFPETVFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTEFERESMENLLAQQAAATTVLTGL 368          
BLAST of T-box 20 protein vs. TrEMBL
Match: G7Y3B8 (T-box protein 20 (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_100383 PE=4 SV=1)

HSP 1 Score: 352.829 bits (904), Expect = 1.003e-107
Identity = 160/227 (70.48%), Postives = 190/227 (83.70%), Query Frame = 2
Query:  560 SEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSP---VVSGL 1231
            S + C LET++LWEKF+ELGTEMIITKSGRRMFPVIR+S  G+ P+ +Y VAMDIIPVD KRYRYAYHRSSWLVAGKADPE+H R Y HPDSPF+G+ L KQTVSFEKLKLTNN +DRHGYIILNSMHKYQPR+H++  ++M+ +      ++        ++F FPET+FIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLT+FERESME+LL+QQ+    V++GL
Sbjct:  365 SSVECHLETRELWEKFNELGTEMIITKSGRRMFPVIRVSFTGIDPDSRYLVAMDIIPVDTKRYRYAYHRSSWLVAGKADPEMHLRQYVHPDSPFTGDQLVKQTVSFEKLKLTNNALDRHGYIILNSMHKYQPRVHLIRSNSMDDFGKLSIKSLDSFDPEDVETFEFPETVFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTEFERESMENLLAQQAAATTVLTGL 591          
BLAST of T-box 20 protein vs. Ensembl Cavefish
Match: tbx20 (T-box transcription factor 20 [Source:NCBI gene;Acc:103046636])

HSP 1 Score: 308.531 bits (789), Expect = 1.344e-98
Identity = 153/248 (61.69%), Postives = 185/248 (74.60%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFE-RESMESLLSQQSPVVSGLRICPPEVSGSSECNGKRSFSTH 1297
            +  I+C LETK+LW+KF ELGTEMIITKSGRRMFP IR+S +G++P+ +Y V MDII VDNKRYRYAYHRSSWLVAGKADP +  R Y HPDSPF+GE L KQ VSFEK+KLTNN +D+HG+IILNSMHKYQPR+HI+ K            ++ ++    ++SF+F ET F AVTAYQNQLITKLKID NPFAKGFRDSSRLTD E RES+E+L+ + S   S +R      +   E  G+   STH
Sbjct:   91 MKNINCSLETKELWDKFHELGTEMIITKSGRRMFPTIRVSFSGVEPDCRYIVLMDIIAVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFTGEQLLKQMVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKE-------HTASLLNLKSDEFRSFIFTETQFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDIESRESVENLIHKHSYARSPIRT----YTAEEENLGEDGHSTH 327          
BLAST of T-box 20 protein vs. Ensembl Cavefish
Match: tbx18 (T-box transcription factor TBX18 [Source:NCBI gene;Acc:103036111])

HSP 1 Score: 265.388 bits (677), Expect = 1.818e-80
Identity = 123/214 (57.48%), Postives = 157/214 (73.36%), Query Frame = 2
Query:  563 EISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDG-HYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLL 1201
            E   +L+  DLW++F E+GTEMIITK+GRRMFP +R+ I GL P+ +Y++AMDIIPVDNKRYRY YH S W+VAG AD  V  R Y HPDSP SGE   +Q +SF+KLKLTNN +D  G+IIL+SMHKYQPR+H++ K+  E+ S      ++ +P G   ++F FPET+F  VTAYQNQ IT+LKID NPFAKGFRDS R     R  +E+L+
Sbjct:  147 EARVELQGADLWKRFHEIGTEMIITKAGRRMFPAMRVKITGLDPHQQYYIAMDIIPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSPASGETWMRQVISFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKECGEELS-----PVKAVPTGDGVKAFCFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGR----NRMGLEALV 351          
BLAST of T-box 20 protein vs. Ensembl Cavefish
Match: tbx15 (T-box transcription factor 15 [Source:NCBI gene;Acc:103029315])

HSP 1 Score: 256.529 bits (654), Expect = 8.501e-77
Identity = 120/216 (55.56%), Postives = 156/216 (72.22%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGH-YQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLL 1201
            + EI  +L+  DLW++F ++GTEMIITK+GRRMFP +R+ I GL P+ +Y++AMDI+PVDNKRYRY YH S W+VAG AD  V  R Y HPDS  SG+   +Q VSF+KLKLTNN +D  G+IIL+SMHKYQPR+H++ KD   + S       + +P G   ++F FPET+F  VTAYQNQ IT+LKID NPFAKGFRDS R     R  +E+++
Sbjct:  102 MEEIQVELQCADLWKRFHDIGTEMIITKAGRRMFPAMRVKILGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSLASGDTWMRQVVSFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDFSSELS-----PTKPVPSGEGVKTFSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGR----NRTGLEAIM 308          
BLAST of T-box 20 protein vs. Ensembl Cavefish
Match: TBX22 (T-box transcription factor 22 [Source:NCBI gene;Acc:103039699])

HSP 1 Score: 232.261 bits (591), Expect = 1.108e-68
Identity = 107/201 (53.23%), Postives = 140/201 (69.65%), Query Frame = 2
Query:  563 EISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPE-VHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSR 1162
            ++   L+  DLW++F E+GTEMIITK+GRRMFP IR+ +  L P  +Y++AMDI+PVD+KRYRY YH S W+VAG  D   +  R Y HPDSP SGE   +Q +SF+++KLTNN MD  G+IIL SMHKY+PR+H+++++   + +       R +      +F F ET F  VTAYQNQ ITKLKID NPFAKGFRD  R
Sbjct:   94 QVRVDLQGSDLWKRFHEIGTEMIITKAGRRMFPSIRVKVRNLDPIKQYYIAMDIMPVDSKRYRYVYHSSQWMVAGNTDHSCITPRLYVHPDSPCSGETWMRQVISFDRVKLTNNEMDDKGHIILQSMHKYKPRVHVIVREHGPESTQLTCLPARGV-----HTFSFSETQFTTVTAYQNQQITKLKIDRNPFAKGFRDPGR 289          
BLAST of T-box 20 protein vs. Ensembl Cavefish
Match: tbx2b (T-box transcription factor 2 [Source:NCBI gene;Acc:103034102])

HSP 1 Score: 231.876 bits (590), Expect = 6.310e-67
Identity = 109/194 (56.19%), Postives = 139/194 (71.65%), Query Frame = 2
Query:  578 LETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSS 1159
            LE KDLW++F +LGTEM+ITKSGRRMFP  ++ INGL    KY + MDI+  D+ RY++  H S W+VAGKADPE+  R Y HPDSP +GE    + V+F KLKLTNN+ D+HG+ ILNSMHKYQPR HI+  +           +I  +P   +++++FPET FIAVTAYQN  IT+LKID NPFAKGFRD+ 
Sbjct:   97 LEAKDLWDQFHKLGTEMVITKSGRRMFPPFKVRINGLDKKAKYILLMDIVAADDCRYKF--HNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMAKPVAFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRAN-----------DILKLPYSTFRTYVFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRDTG 277          
BLAST of T-box 20 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004087.1 (pep scaffold:Pmarinus_7.0:GL483204:5206:18999:-1 gene:ENSPMAG00000003745.1 transcript:ENSPMAT00000004087.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 268.085 bits (684), Expect = 1.820e-87
Identity = 127/180 (70.56%), Postives = 147/180 (81.67%), Query Frame = 2
Query:  611 ELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFR 1150
            ELGTEMIITKSGRRMFP IR+S  G++P+ KY V MDI+PVDNKRYRYAYHRSSWLVAGKADP +  R Y HPDSPF+GE L KQ VSFEKLKLTNN +D+HG+IILNSMHKYQPR+HI+ K  M+  S+  N    +     +++F+FPET+F AVTAYQNQLITKLKID NPFAKGFR
Sbjct:    2 ELGTEMIITKSGRRMFPTIRVSFGGVEPDAKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFAGEQLHKQMVSFEKLKLTNNELDQHGHIILNSMHKYQPRVHIIKK--MDHTSSLVNLKSEE-----FRTFVFPETVFTAVTAYQNQLITKLKIDSNPFAKGFR 174          
BLAST of T-box 20 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008915.1 (pep scaffold:Pmarinus_7.0:GL481372:6049:9031:1 gene:ENSPMAG00000008071.1 transcript:ENSPMAT00000008915.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.992 bits (393), Expect = 9.952e-45
Identity = 86/197 (43.65%), Postives = 118/197 (59.90%), Query Frame = 2
Query:  566 ISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQ-SFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRD 1153
            ++  L+  +LW KF  +GTEMIITKSG +   VI +S  G Q      +  +++P D  +Y++      W  +G A+  +  R Y HP SP SG    +Q VSF K KLTNN + + G++IL+SMHKYQP  ++ ++DT          + R +   H   +F FP+T FIAVTAYQN LITKLKI  NPFAKGFR+
Sbjct:    1 VAATLDNAELWRKFHAIGTEMIITKSGSKW--VIALSPRGRQ------IKXELVPADEVKYKWREAEERWEASGPAELSMPSRLYVHPSSPSSGAQWMRQPVSFHKAKLTNNALSKSGHLILHSMHKYQPCFYV-VRDT----------DWRGVAAAHSPLTFSFPDTTFIAVTAYQNSLITKLKIATNPFAKGFRE 178          
BLAST of T-box 20 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004398.1 (pep scaffold:Pmarinus_7.0:GL481394:165233:166024:1 gene:ENSPMAG00000004017.1 transcript:ENSPMAT00000004398.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.05 bits (362), Expect = 3.975e-41
Identity = 62/86 (72.09%), Postives = 74/86 (86.05%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCR 814
            L+ I+C LETK+LW+KF ELGTEMIITKSGRRMFP IR+S++G++P+ +Y V MDIIPVD KRYRYAYHRS WLVAGKADP +  R
Sbjct:   39 LARIACALETKELWDKFHELGTEMIITKSGRRMFPTIRVSLSGVEPDARYIVLMDIIPVDQKRYRYAYHRSCWLVAGKADPPLPSR 124          
BLAST of T-box 20 protein vs. Ensembl Sea Lamprey
Match: TBR1 (T-box brain transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:11590])

HSP 1 Score: 153.295 bits (386), Expect = 4.087e-40
Identity = 87/206 (42.23%), Postives = 118/206 (57.28%), Query Frame = 2
Query:  548 IPGLSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHC-RTYFHPDSPFSGENLSKQTVSFEKLKLTNN---VMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRD 1153
            +PG ++    L  + LW KF    T  +IT+ G RMFP +  +++GL P   Y + +D++  D   +R+      W+  GKAD  V   R Y HPDSP +G +  +Q +SF KLKLTNN     +    I+L S+HKYQPR+H++  +        +         G  Q+F FPET FIAVTAYQN  IT+LKID NPFAKGFRD
Sbjct:  108 VPGKAQKD--LCNRALWIKFHRHFTNRLITRVGMRMFPFLSFTVSGLDPTAHYNIFVDVVLADPNHWRF--QGGKWVPCGKADTNVQGNRMYLHPDSPNTGAHWMRQEISFGKLKLTNNKGGTNNTGQMIVLQSLHKYQPRLHVVEVNEEGVEDATQ--------PGRAQTFTFPETQFIAVTAYQNTDITQLKIDHNPFAKGFRD 301          
BLAST of T-box 20 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007664.1 (pep scaffold:Pmarinus_7.0:GL477495:60408:67857:-1 gene:ENSPMAG00000006925.1 transcript:ENSPMAT00000007664.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.976 bits (367), Expect = 6.442e-37
Identity = 70/187 (37.43%), Postives = 106/187 (56.68%), Query Frame = 2
Query:  578 LETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFA 1138
            L+ +++WE+F   GTEMI+TK+GRRMFP  R  + GL P   Y +A+D++PVD  RYR+      W+   +  P++    Y H +    G     +++SF ++KLTN  + + G I L  M KY  R HI+  + + ++   +  N+         +F+FP+T F AVTAYQN  IT LKI  +P A
Sbjct:    6 LDNREVWERFHSWGTEMILTKTGRRMFPYCRYKVRGLDPQSCYLMAIDVVPVDGHRYRWG--EGCWMPIERGKPQIPDSVYVHQEGVAPGSFWMYESISFSEVKLTNTALGQDGVISLIPMFKYVTRFHIIRANKVPRHLRLDADNV--------HTFIFPQTEFFAVTAYQNTAITHLKISHSPLA 182          
BLAST of T-box 20 protein vs. Ensembl Nematostella
Match: EDO37185 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGG8])

HSP 1 Score: 283.878 bits (725), Expect = 7.156e-93
Identity = 132/208 (63.46%), Postives = 160/208 (76.92%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFER 1180
            L  IS +LE ++LWE+FSELGTEMIITK+GRRMFP +RIS++G+QP   Y V +DI+PVD+KRYRYAYHRS+WLVAGKADP    R Y HPDSPF+GE L KQ +SFEK+KLTNN  D +G++ILNSMHKYQPRIH++ K            ++ ++     ++F FP T FIAVTAYQNQLIT+LKID NPFAKGFRDSSRL   ER
Sbjct:    4 LQNISVELEGRELWERFSELGTEMIITKAGRRMFPTLRISVSGVQPKANYMVLLDIVPVDDKRYRYAYHRSTWLVAGKADPPAPVRLYMHPDSPFTGEQLLKQIISFEKVKLTNNDTDHNGHLILNSMHKYQPRIHVIRKRD-------HTASVINLKSERMKTFTFPSTTFIAVTAYQNQLITRLKIDSNPFAKGFRDSSRLMPVER 204          
BLAST of T-box 20 protein vs. Ensembl Nematostella
Match: EDO37205 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGG9])

HSP 1 Score: 267.7 bits (683), Expect = 9.760e-87
Identity = 124/201 (61.69%), Postives = 158/201 (78.61%), Query Frame = 2
Query:  578 LETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFER 1180
            LE ++LW +F+ELGTEMIITKSGRRMFP +RIS++G+QP   Y V +DI+PVD+KRYRYAYHRS+WLVAGKADP    R Y HPDSPF+GE L KQ +SFEK+KLTNN  D +G++IL+SMHKY+PR+H++ K   +  ++  N N  ++     ++F FPET FIAVTAYQNQLIT+LKID NPFAKGFRD+ R+   +R
Sbjct:    3 LEGRELWGRFNELGTEMIITKSGRRMFPTLRISVSGVQPKANYMVLLDIVPVDDKRYRYAYHRSTWLVAGKADPPAPVRLYMHPDSPFTGEQLLKQIISFEKVKLTNNDTDHNGHLILHSMHKYKPRVHLMRKR--DHTASIVNLNSEEV-----KTFTFPETSFIAVTAYQNQLITRLKIDSNPFAKGFRDTMRIIPVQR 196          
BLAST of T-box 20 protein vs. Ensembl Nematostella
Match: EDO46664 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPC8])

HSP 1 Score: 245.358 bits (625), Expect = 4.824e-78
Identity = 118/201 (58.71%), Postives = 144/201 (71.64%), Query Frame = 2
Query:  566 ISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILL-KDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRL 1165
            I  +L+  DLW +F ELGTEMIITK+GRRMFP IR+ ++GL  +  Y + MD+IP+D KRYRYAYH S W+VAG AD  +  R Y HPDSP  GE   +Q VSF+K+KLTNN +D+ G+IIL+SMHKYQPRIHI+  KDT E   +       D P    ++F F ET+F  VTAYQNQ IT+LKID NPFAKGFRDS RL
Sbjct:    1 IRVELQMHDLWRRFYELGTEMIITKAGRRMFPAIRVKVSGLDLHAHYILVMDVIPLDGKRYRYAYHSSKWVVAGNADAPMPGRVYIHPDSPALGEEWMRQIVSFDKVKLTNNELDQQGHIILHSMHKYQPRIHIIRKKDTSEASIDI------DRPCSERKTFTFSETVFTTVTAYQNQQITRLKIDSNPFAKGFRDSGRL 195          
BLAST of T-box 20 protein vs. Ensembl Nematostella
Match: EDO35086 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMK2])

HSP 1 Score: 244.973 bits (624), Expect = 5.697e-78
Identity = 115/189 (60.85%), Postives = 147/189 (77.78%), Query Frame = 2
Query:  587 KDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRD 1153
            K+LW++F  LGTEMI+TK+GRRMFP  ++ + GL+PN KY + MD +PVD+KRYRYA+H S WLVAGKADP V  R + HPDSP +G    KQ VSF+KLKLTNN+MD +G+IILNSMHKYQPR H++L  T +K +   N N+ D+   H ++F+FPE+ F+AVTAYQN +IT+LKI  NPFAKGFRD
Sbjct:    2 KNLWDEFYTLGTEMIVTKAGRRMFPPFQVRLYGLEPNVKYILMMDFVPVDDKRYRYAFHSSKWLVAGKADPSVPGRVHIHPDSPCTGAQWMKQIVSFDKLKLTNNLMDDNGHIILNSMHKYQPRFHVVLV-TSDKNA---NANLNDVNRDHIKTFVFPESQFMAVTAYQNHMITQLKIASNPFAKGFRD 186          
BLAST of T-box 20 protein vs. Ensembl Nematostella
Match: EDO35074 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMK3])

HSP 1 Score: 250.366 bits (638), Expect = 1.886e-77
Identity = 112/199 (56.28%), Postives = 149/199 (74.87%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRD 1153
            L+ +  +LE K LW++F  LGTEMI+TK+GRRMFP  ++ + GL+P+ K+ + MD +PVD+KRYRYA+H S WLVAGKADP V  R + HPDSP +G    KQ VSF+KLKLTNN+MD +G+IILNSMHKYQPR H++L+D           ++ ++   H ++F+FPET F+AVTAYQN +IT+LKI  NPFAKGFR+
Sbjct:   19 LAHVRVELEMKSLWDEFHSLGTEMIVTKAGRRMFPTFQVRLYGLEPSAKHILMMDFVPVDDKRYRYAFHSSKWLVAGKADPSVPGRVHIHPDSPCTGAQWMKQIVSFDKLKLTNNLMDDNGHIILNSMHKYQPRFHVILEDP----DRSSTASLHEVSKDHIRTFIFPETQFMAVTAYQNHMITQLKIASNPFAKGFRE 213          
BLAST of T-box 20 protein vs. Ensembl Medaka
Match: tbx20 (T-box transcription factor 20 [Source:NCBI gene;Acc:101170124])

HSP 1 Score: 317.39 bits (812), Expect = 4.262e-102
Identity = 153/247 (61.94%), Postives = 186/247 (75.30%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLRICPPEVSGSSECNGKRSFSTH 1297
            +++ISC LETK+LW+KF ELGTEMIITKSGRRMFP IR+S +G+  + KY V MDI+PVDNKRYRYAYHRSSWLVAGKADP +  R Y HPDSPF+GE L KQ VSFEK+KLTNN +D+HG+IILNSMHKYQPR+HI+ K            ++ ++    +++F+F ET+F AVTAYQNQLITKLKID NPFAKGFRDSSRLTD ERES+E+L+ + S   S +R       G  E  G+   S H
Sbjct:   93 MAKISCSLETKELWDKFHELGTEMIITKSGRRMFPTIRVSFSGVDQDSKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFTGEQLKKQMVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKD-------HTASLLNLKSEEFRTFVFVETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDMERESVENLIHKHSYARSPIRT----YGGDEESLGEDGHSAH 328          
BLAST of T-box 20 protein vs. Ensembl Medaka
Match: tbx18 (T-box transcription factor TBX18 [Source:NCBI gene;Acc:101175611])

HSP 1 Score: 262.307 bits (669), Expect = 5.290e-80
Identity = 126/214 (58.88%), Postives = 154/214 (71.96%), Query Frame = 2
Query:  563 EISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGH-YQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLL 1201
            E    L+  DLW++F E+GTEMIITK+GRRMFP +R+ I GL P+ +Y+VAMDIIPVDNKRYRY YH S W+VAG AD  V  R Y HPDSP SGE   +Q VSF+KLKLTNN +D  G+IIL+SMHKYQPR+H++ K+  E+ S      +R IP G    +F F ET+F  VTAYQNQ IT+LKID NPFAKGFRDS R     R  +E+L+
Sbjct:  105 ETHVDLQGSDLWKRFHEIGTEMIITKAGRRMFPAMRVKITGLDPHQQYYVAMDIIPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSPASGETWMRQVVSFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKECGEELS-----PVRAIPVGEGTHTFSFSETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGR----NRMGLEALV 309          
BLAST of T-box 20 protein vs. Ensembl Medaka
Match: tbx15 (T-box transcription factor 15 [Source:NCBI gene;Acc:101172855])

HSP 1 Score: 256.144 bits (653), Expect = 6.677e-77
Identity = 120/216 (55.56%), Postives = 156/216 (72.22%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGH-YQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLL 1201
            + EI  +L+  DLW++F ++GTEMIITK+GRRMFP +R+ I GL P+ +Y++AMDI+PVDNKRYRY YH S W+VAG AD  V  R Y HPDS  SG+   +Q VSF+KLKLTNN +D  G+IIL+SMHKYQPR+H++ KD   + S       + +P G   ++F FPET+F  VTAYQNQ IT+LKID NPFAKGFRDS R     R  +E+++
Sbjct:  122 MEEIQVELQCADLWKRFHDIGTEMIITKAGRRMFPAMRVKIAGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSLASGDTWMRQVVSFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDFSSELS-----PNKPVPSGEGVKTFSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGR----NRTGLEAIM 328          
BLAST of T-box 20 protein vs. Ensembl Medaka
Match: tbx15 (T-box transcription factor 15 [Source:NCBI gene;Acc:101172855])

HSP 1 Score: 256.144 bits (653), Expect = 1.254e-76
Identity = 120/216 (55.56%), Postives = 156/216 (72.22%), Query Frame = 2
Query:  557 LSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGH-YQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLL 1201
            + EI  +L+  DLW++F ++GTEMIITK+GRRMFP +R+ I GL P+ +Y++AMDI+PVDNKRYRY YH S W+VAG AD  V  R Y HPDS  SG+   +Q VSF+KLKLTNN +D  G+IIL+SMHKYQPR+H++ KD   + S       + +P G   ++F FPET+F  VTAYQNQ IT+LKID NPFAKGFRDS R     R  +E+++
Sbjct:  102 MEEIQVELQCADLWKRFHDIGTEMIITKAGRRMFPAMRVKIAGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSLASGDTWMRQVVSFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDFSSELS-----PNKPVPSGEGVKTFSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGR----NRTGLEAIM 308          
BLAST of T-box 20 protein vs. Ensembl Medaka
Match: tbx1 (T-box transcription factor 1 [Source:NCBI gene;Acc:101156899])

HSP 1 Score: 244.588 bits (623), Expect = 2.378e-73
Identity = 121/253 (47.83%), Postives = 165/253 (65.22%), Query Frame = 2
Query:  551 PGLSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERES-------MESLLSQQSPVVSGLRICPPEVSGSSECNGKRSF 1288
            P ++ I+ QLE K LW++F++LGTEMI+TK+GRRMFP  ++ I G+ P   Y + MD +PVD+KRYRYA+H SSWLVAGKADP    R ++HPDSP  G    KQ VSF+KLKLTNN++D +G+IILNSMH+YQPR H++  D  +    +   N        Y++F+F ET F AVTAYQN  IT+LKI  NPFAKGFRD     D+ R         M +    ++P+ S     PP+ +G+ + + +R +
Sbjct:  145 PKVANINVQLEMKALWDEFNQLGTEMIVTKAGRRMFPTFQVKIFGMDPMADYMLLMDFLPVDDKRYRYAFHSSSWLVAGKADPATPGRVHYHPDSPAKGAQWMKQIVSFDKLKLTNNLLDDNGHIILNSMHRYQPRFHVVYVDPRKDSEKYAEEN--------YKTFVFEETRFTAVTAYQNHRITQLKIASNPFAKGFRDCDP-EDWPRNHRPGSLPIMSAFARTRNPMSS-----PPQQNGTDKEDSRREY 383          
BLAST of T-box 20 protein vs. Planmine SMEST
Match: SMESG000071435.1 (SMESG000071435.1)

HSP 1 Score: 1155.58 bits (2988), Expect = 0.000e+0
Identity = 570/573 (99.48%), Postives = 571/573 (99.65%), Query Frame = 2
Query:   77 MMNICEKSASVTGVDGLFREYVSPNSREKDSITSGNLSPNLPEPTNDRLFFDEINTKRLMSAKATAFSIDSIIRKRAFNQHNELDDDDINSQCSRNKIRIFKTIDRISPLQIDTGIDGSENGSISLXXXXXXXXXKPTDWGKTTNLNSFQSVQSTFSIPGLSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLRICPPEVSGSSECNGKRSFSTHKNYQTMFNDSVSAIQRFLPPKHSLPATDQLKKDFEIQKLVKSFVNETNMFPEIFDSKCYDSIKLNSCFSASHLSSVLPPHFIRSGLTHNFQNPKIPITSSPMFSSHPSQVNGHNFPPLPSSINGLLAQIARSSRDDLTQSISSNPSDMLKNFLFMHRIASNPNYLN 1795
            MMNICEKSASVTGVDGLFREYVSPNSREKDSITSGNLSPNLPEPTNDRLFFDEINTKRLMSAKATAFSIDSIIRKRAFNQHNELDDDDINSQCSRNKIRIFKTIDRISPLQIDTGIDGSENGSISLNSDDNDSSNKPTDWGKTTNLNSFQSVQSTFSIPGLSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHY+SFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLRICPPEVSGS ECNGKRSFSTHKNYQTMFNDSVSAIQRFLPPKHSLPATDQLKKDFEIQKLVKSFVNETNMFPEIFDSK YDSIKLNSCFSASHLSSVLPPHFIRSGLTHNFQNPKIPITSSPMFSSHPSQVNGHNFPPLPSSINGLLAQIARSSRDDLTQSISSNPSDMLKNFLFMHRIASNPNYLN
Sbjct:    1 MMNICEKSASVTGVDGLFREYVSPNSREKDSITSGNLSPNLPEPTNDRLFFDEINTKRLMSAKATAFSIDSIIRKRAFNQHNELDDDDINSQCSRNKIRIFKTIDRISPLQIDTGIDGSENGSISLNSDDNDSSNKPTDWGKTTNLNSFQSVQSTFSIPGLSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYRSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLRICPPEVSGSGECNGKRSFSTHKNYQTMFNDSVSAIQRFLPPKHSLPATDQLKKDFEIQKLVKSFVNETNMFPEIFDSKSYDSIKLNSCFSASHLSSVLPPHFIRSGLTHNFQNPKIPITSSPMFSSHPSQVNGHNFPPLPSSINGLLAQIARSSRDDLTQSISSNPSDMLKNFLFMHRIASNPNYLN 573          
BLAST of T-box 20 protein vs. Planmine SMEST
Match: SMESG000071435.1 (SMESG000071435.1)

HSP 1 Score: 1153.66 bits (2983), Expect = 0.000e+0
Identity = 569/572 (99.48%), Postives = 570/572 (99.65%), Query Frame = 2
Query:   80 MNICEKSASVTGVDGLFREYVSPNSREKDSITSGNLSPNLPEPTNDRLFFDEINTKRLMSAKATAFSIDSIIRKRAFNQHNELDDDDINSQCSRNKIRIFKTIDRISPLQIDTGIDGSENGSISLXXXXXXXXXKPTDWGKTTNLNSFQSVQSTFSIPGLSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLRICPPEVSGSSECNGKRSFSTHKNYQTMFNDSVSAIQRFLPPKHSLPATDQLKKDFEIQKLVKSFVNETNMFPEIFDSKCYDSIKLNSCFSASHLSSVLPPHFIRSGLTHNFQNPKIPITSSPMFSSHPSQVNGHNFPPLPSSINGLLAQIARSSRDDLTQSISSNPSDMLKNFLFMHRIASNPNYLN 1795
            MNICEKSASVTGVDGLFREYVSPNSREKDSITSGNLSPNLPEPTNDRLFFDEINTKRLMSAKATAFSIDSIIRKRAFNQHNELDDDDINSQCSRNKIRIFKTIDRISPLQIDTGIDGSENGSISLNSDDNDSSNKPTDWGKTTNLNSFQSVQSTFSIPGLSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHY+SFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLRICPPEVSGS ECNGKRSFSTHKNYQTMFNDSVSAIQRFLPPKHSLPATDQLKKDFEIQKLVKSFVNETNMFPEIFDSK YDSIKLNSCFSASHLSSVLPPHFIRSGLTHNFQNPKIPITSSPMFSSHPSQVNGHNFPPLPSSINGLLAQIARSSRDDLTQSISSNPSDMLKNFLFMHRIASNPNYLN
Sbjct:    1 MNICEKSASVTGVDGLFREYVSPNSREKDSITSGNLSPNLPEPTNDRLFFDEINTKRLMSAKATAFSIDSIIRKRAFNQHNELDDDDINSQCSRNKIRIFKTIDRISPLQIDTGIDGSENGSISLNSDDNDSSNKPTDWGKTTNLNSFQSVQSTFSIPGLSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYRSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLRICPPEVSGSGECNGKRSFSTHKNYQTMFNDSVSAIQRFLPPKHSLPATDQLKKDFEIQKLVKSFVNETNMFPEIFDSKSYDSIKLNSCFSASHLSSVLPPHFIRSGLTHNFQNPKIPITSSPMFSSHPSQVNGHNFPPLPSSINGLLAQIARSSRDDLTQSISSNPSDMLKNFLFMHRIASNPNYLN 572          
BLAST of T-box 20 protein vs. Planmine SMEST
Match: SMESG000061015.1 (SMESG000061015.1)

HSP 1 Score: 222.631 bits (566), Expect = 5.206e-64
Identity = 111/235 (47.23%), Postives = 155/235 (65.96%), Query Frame = 2
Query:  572 CQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRDSSRLTDFERESMESLLSQQSPVVS-GLRICPPEVSGSSECN 1273
             +L  +DLWE+F   GTEM+ITKSGRRMFP  ++ ++GL    KY + MD++ VD+ RY++  H + W+VAGKADPE+  R Y HPDSP +GE   ++ +SF KLKLTNN+ D+HG+ ILNSMHKYQPR H++  +           +I  +P   ++S++F ET FI VTAYQN+ IT+LKID NPFAKGFRD+      +++   S +S  S V + G +    E+S  S+ N
Sbjct:   91 VELIDRDLWEQFHAYGTEMVITKSGRRMFPPYKVQVSGLDKRAKYIMLMDVVAVDDCRYKF--HNNQWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKIISFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRAN-----------DIMRLPYSTFRSYVFKETQFIGVTAYQNEKITQLKIDHNPFAKGFRDTGGGKREKKKLNGSAISTSSDVDNKGNKDNSEEISECSDVN 312          
BLAST of T-box 20 protein vs. Planmine SMEST
Match: SMESG000064684.1 (SMESG000064684.1)

HSP 1 Score: 202.216 bits (513), Expect = 8.392e-60
Identity = 102/202 (50.50%), Postives = 135/202 (66.83%), Query Frame = 2
Query:  551 PGLSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHI-LLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRD 1153
            P L  I+ +L  K LWE F  L TEMI+TKSGRRMFP +++ ++G+  + KY + +D +P DN RYRY++H SSW  AGKADP    ++Y  PD    G++  K  ++F+KLKLTNN ++++G+IILNSMHKY PRIHI LL +  E   +F           +Y++F F  T F AVTAYQN  IT+LKI  NPFAKGFRD
Sbjct:   26 PDLQGITVELANKSLWESFDRLNTEMIVTKSGRRMFPTLQLKVDGMVMSSKYVIFVDFVPSDNYRYRYSFHSSSWNQAGKADPVHPQKSYMQPDGVCLGQHWKKTIINFDKLKLTNNTVNKNGHIILNSMHKYLPRIHIVLLPNNNENDHHF-----------YYRTFQFDFTSFYAVTAYQNHRITRLKIASNPFAKGFRD 216          
BLAST of T-box 20 protein vs. Planmine SMEST
Match: SMESG000064684.1 (SMESG000064684.1)

HSP 1 Score: 202.601 bits (514), Expect = 8.542e-60
Identity = 102/202 (50.50%), Postives = 135/202 (66.83%), Query Frame = 2
Query:  551 PGLSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRISINGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFHPDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHI-LLKDTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDCNPFAKGFRD 1153
            P L  I+ +L  K LWE F  L TEMI+TKSGRRMFP +++ ++G+  + KY + +D +P DN RYRY++H SSW  AGKADP    ++Y  PD    G++  K  ++F+KLKLTNN ++++G+IILNSMHKY PRIHI LL +  E   +F           +Y++F F  T F AVTAYQN  IT+LKI  NPFAKGFRD
Sbjct:   31 PDLQGITVELANKSLWESFDRLNTEMIVTKSGRRMFPTLQLKVDGMVMSSKYVIFVDFVPSDNYRYRYSFHSSSWNQAGKADPVHPQKSYMQPDGVCLGQHWKKTIINFDKLKLTNNTVNKNGHIILNSMHKYLPRIHIVLLPNNNENDHHF-----------YYRTFQFDFTSFYAVTAYQNHRITRLKIASNPFAKGFRD 221          
The following BLAST results are available for this feature:
BLAST of T-box 20 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TBX209.900e-10466.37T-box transcription factor 20 [Source:HGNC Symbol;... [more]
TBX182.058e-7957.89T-box transcription factor 18 [Source:HGNC Symbol;... [more]
TBX153.717e-7755.35T-box transcription factor 15 [Source:HGNC Symbol;... [more]
TBX159.125e-7752.59T-box transcription factor 15 [Source:HGNC Symbol;... [more]
TBX185.954e-7361.11T-box transcription factor 18 [Source:HGNC Symbol;... [more]
back to top
BLAST of T-box 20 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mab-93.704e-7353.49T-box protein 12 [Source:UniProtKB/Swiss-Prot;Acc... [more]
tbx-24.346e-6350.51T-box protein 2 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
tbx-24.346e-6350.51T-box protein 2 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
mls-17.920e-5747.45T-box transcription factor mls-1 [Source:UniProtK... [more]
tbx-71.120e-4644.10Putative T-box protein 7 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of T-box 20 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mid3.372e-9454.35gene:FBgn0261963 transcript:FBtr0310358[more]
mid3.372e-9454.35gene:FBgn0261963 transcript:FBtr0079093[more]
H151.360e-8857.87gene:FBgn0016660 transcript:FBtr0343225[more]
H151.483e-8857.87gene:FBgn0016660 transcript:FBtr0079076[more]
org-15.629e-6855.45gene:FBgn0021767 transcript:FBtr0071244[more]
back to top
BLAST of T-box 20 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbx203.279e-10462.35T-box transcription factor 20 [Source:NCBI gene;Ac... [more]
tbx151.288e-7755.56T-box transcription factor 15 [Source:ZFIN;Acc:ZDB... [more]
tbx156.727e-7755.56T-box transcription factor 15 [Source:ZFIN;Acc:ZDB... [more]
tbx11.179e-7347.83T-box transcription factor 1 [Source:NCBI gene;Acc... [more]
tbx11.599e-7347.83T-box transcription factor 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of T-box 20 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmub22.994e-10165.49transmembrane and ubiquitin-like domain containing... [more]
mgc1078848.585e-8057.75mgc107884 protein [Source:Xenbase;Acc:XB-GENE-5767... [more]
TBX157.164e-7845.12T-box 15 [Source:NCBI gene;Acc:100489988][more]
tbx19.795e-7446.05T-box 1 [Source:NCBI gene;Acc:619587][more]
TBX222.193e-7055.00T-box 22 [Source:NCBI gene;Acc:100494512][more]
back to top
BLAST of T-box 20 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tbx206.393e-10466.37T-box 20 [Source:MGI Symbol;Acc:MGI:1888496][more]
Tbx201.629e-10168.42T-box 20 [Source:MGI Symbol;Acc:MGI:1888496][more]
Tbx182.679e-7957.89T-box18 [Source:MGI Symbol;Acc:MGI:1923615][more]
Tbx156.072e-7752.59T-box 15 [Source:MGI Symbol;Acc:MGI:1277234][more]
Tbx105.420e-7354.95T-box 10 [Source:MGI Symbol;Acc:MGI:1261436][more]
back to top
BLAST of T-box 20 protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8UW76|TBX20_CHICK1.036e-10366.81T-box transcription factor TBX20 OS=Gallus gallus ... [more]
sp|Q9I9K7|TBX20_DANRE2.475e-10362.35T-box transcription factor TBX20 OS=Danio rerio OX... [more]
sp|Q9ES03|TBX20_MOUSE4.472e-10366.37T-box transcription factor TBX20 OS=Mus musculus O... [more]
sp|Q9UMR3|TBX20_HUMAN4.754e-10366.37T-box transcription factor TBX20 OS=Homo sapiens O... [more]
sp|Q3SA46|TBX20_XENTR1.586e-10065.49T-box transcription factor TBX20 OS=Xenopus tropic... [more]
back to top
BLAST of T-box 20 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5P8I4I60.000e+0100.00T-box 20 protein OS=Schmidtea mediterranea OX=7932... [more]
F1CDF20.000e+097.16TBX20 (Fragment) OS=Schmidtea polychroa OX=50054 P... [more]
A0A5J4NCN11.212e-10875.36T-box protein 20 (Fragment) OS=Paragonimus westerm... [more]
A0A1S8WHM94.185e-10869.83T-box (Fragment) OS=Opisthorchis viverrini OX=6198... [more]
G7Y3B81.003e-10770.48T-box protein 20 (Fragment) OS=Clonorchis sinensis... [more]
back to top
BLAST of T-box 20 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbx201.344e-9861.69T-box transcription factor 20 [Source:NCBI gene;Ac... [more]
tbx181.818e-8057.48T-box transcription factor TBX18 [Source:NCBI gene... [more]
tbx158.501e-7755.56T-box transcription factor 15 [Source:NCBI gene;Ac... [more]
TBX221.108e-6853.23T-box transcription factor 22 [Source:NCBI gene;Ac... [more]
tbx2b6.310e-6756.19T-box transcription factor 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of T-box 20 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004087.11.820e-8770.56pep scaffold:Pmarinus_7.0:GL483204:5206:18999:-1 g... [more]
ENSPMAT00000008915.19.952e-4543.65pep scaffold:Pmarinus_7.0:GL481372:6049:9031:1 gen... [more]
ENSPMAT00000004398.13.975e-4172.09pep scaffold:Pmarinus_7.0:GL481394:165233:166024:1... [more]
TBR14.087e-4042.23T-box brain transcription factor 1 [Source:HGNC Sy... [more]
ENSPMAT00000007664.16.442e-3737.43pep scaffold:Pmarinus_7.0:GL477495:60408:67857:-1 ... [more]
back to top
BLAST of T-box 20 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of T-box 20 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO371857.156e-9363.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372059.760e-8761.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466644.824e-7858.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350865.697e-7860.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350741.886e-7756.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of T-box 20 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbx204.262e-10261.94T-box transcription factor 20 [Source:NCBI gene;Ac... [more]
tbx185.290e-8058.88T-box transcription factor TBX18 [Source:NCBI gene... [more]
tbx156.677e-7755.56T-box transcription factor 15 [Source:NCBI gene;Ac... [more]
tbx151.254e-7655.56T-box transcription factor 15 [Source:NCBI gene;Ac... [more]
tbx12.378e-7347.83T-box transcription factor 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of T-box 20 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071435.10.000e+099.48SMESG000071435.1[more]
SMESG000071435.10.000e+099.48SMESG000071435.1[more]
SMESG000061015.15.206e-6447.23SMESG000061015.1[more]
SMESG000064684.18.392e-6050.50SMESG000064684.1[more]
SMESG000064684.18.542e-6050.50SMESG000064684.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019532 ID=SMED30019532|Name=T-box 20 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1822bp
CTGAGATTTATTTAAACAATTTATTGATAAAATTTATTTATTATTTATTT
TAATTTTGTCACTATTGATTGATTCAATGATGAATATTTGTGAAAAGTCT
GCCAGTGTGACAGGTGTTGACGGTTTGTTTCGAGAATATGTGTCACCGAA
TTCTCGAGAAAAAGACTCGATTACATCCGGAAATCTGTCACCGAATTTAC
CGGAACCGACAAATGATCGACTGTTTTTCGATGAGATCAACACGAAACGA
CTAATGTCAGCGAAAGCCACCGCGTTTTCAATCGATTCAATAATTCGAAA
ACGAGCATTCAATCAGCACAATGAACTCGATGACGACGACATCAATTCTC
AATGCTCTCGAAACAAAATTCGGATTTTCAAAACGATTGATCGAATTTCA
CCGCTTCAAATCGATACCGGAATCGATGGATCTGAGAATGGATCGATTTC
GTTGAATTCCGACGACAACGATTCCTCGAATAAGCCGACAGATTGGGGAA
AAACAACGAATCTGAATTCCTTTCAATCGGTTCAGTCGACCTTTTCAATT
CCGGGTTTATCGGAAATTTCCTGCCAGTTGGAAACAAAAGATTTGTGGGA
GAAATTTTCCGAACTGGGCACTGAAATGATTATTACAAAATCTGGAAGAC
GAATGTTTCCGGTCATTAGGATTTCCATCAATGGATTGCAGCCGAATTTT
AAATATTTTGTCGCAATGGACATCATCCCAGTGGATAATAAACGTTATCG
GTACGCATATCACAGATCGTCTTGGTTGGTTGCTGGTAAAGCCGATCCTG
AAGTTCATTGTCGAACGTATTTCCATCCTGATTCTCCGTTTTCTGGAGAA
AATCTTTCAAAACAAACCGTTTCCTTTGAAAAACTTAAACTGACAAACAA
CGTCATGGACCGCCATGGATATATAATTCTTAATTCGATGCACAAATACC
AACCAAGAATCCACATCCTTTTGAAAGACACGATGGAAAAATACTCGAAT
TTTGAAAACTTCAACATCCGAGATATTCCCGATGGTCACTATCAAAGTTT
TATGTTTCCGGAAACGATTTTCATCGCCGTTACCGCTTATCAAAATCAAC
TGATTACTAAATTAAAAATCGACTGCAATCCATTCGCTAAAGGATTTCGA
GATTCTTCAAGGTTAACAGATTTTGAAAGAGAGTCAATGGAATCTTTACT
ATCCCAACAATCTCCAGTCGTGTCTGGTCTACGAATTTGTCCTCCGGAAG
TCAGTGGTAGTAGTGAATGTAATGGAAAACGAAGTTTTTCAACTCACAAA
AACTACCAGACAATGTTTAACGATTCAGTGTCCGCTATTCAAAGATTTCT
ACCTCCAAAGCATAGTCTACCAGCAACGGATCAACTGAAAAAAGATTTCG
AAATCCAAAAACTCGTCAAGAGTTTCGTTAATGAGACAAACATGTTTCCA
GAAATTTTCGATTCGAAATGTTATGATTCCATAAAGTTAAATAGTTGTTT
CTCTGCCTCACATTTATCATCAGTTTTGCCACCACATTTTATCCGGTCTG
GACTGACACATAACTTTCAGAATCCTAAAATCCCAATCACATCCTCTCCA
ATGTTTTCTTCTCATCCTTCACAAGTTAATGGGCACAATTTTCCACCTTT
ACCTTCATCAATCAATGGACTTCTTGCCCAAATTGCGAGATCGTCAAGAG
ACGATCTGACCCAGTCTATTTCTTCAAATCCTTCGGACATGCTCAAAAAT
TTTCTCTTCATGCATAGAATAGCGTCGAATCCGAATTACTTGAATAAGAA
AAAGATCTGAAAACCTAAGAAA
back to top

protein sequence of SMED30019532-orf-1

>SMED30019532-orf-1 ID=SMED30019532-orf-1|Name=SMED30019532-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=578bp
MMNICEKSASVTGVDGLFREYVSPNSREKDSITSGNLSPNLPEPTNDRLF
FDEINTKRLMSAKATAFSIDSIIRKRAFNQHNELDDDDINSQCSRNKIRI
FKTIDRISPLQIDTGIDGSENGSISLNSDDNDSSNKPTDWGKTTNLNSFQ
SVQSTFSIPGLSEISCQLETKDLWEKFSELGTEMIITKSGRRMFPVIRIS
INGLQPNFKYFVAMDIIPVDNKRYRYAYHRSSWLVAGKADPEVHCRTYFH
PDSPFSGENLSKQTVSFEKLKLTNNVMDRHGYIILNSMHKYQPRIHILLK
DTMEKYSNFENFNIRDIPDGHYQSFMFPETIFIAVTAYQNQLITKLKIDC
NPFAKGFRDSSRLTDFERESMESLLSQQSPVVSGLRICPPEVSGSSECNG
KRSFSTHKNYQTMFNDSVSAIQRFLPPKHSLPATDQLKKDFEIQKLVKSF
VNETNMFPEIFDSKCYDSIKLNSCFSASHLSSVLPPHFIRSGLTHNFQNP
KIPITSSPMFSSHPSQVNGHNFPPLPSSINGLLAQIARSSRDDLTQSISS
NPSDMLKNFLFMHRIASNPNYLNKKKI*
back to top
Aliases
The feature 'T-box 20 protein' has the following synonyms
Synonym
Spol-TBX20
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002028dorsal-ventral muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036960T-box_sf
IPR001699TF_T-box
IPR018186TF_T-box_CS
IPR008967p53-like_TF_DNA-bd
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0000977RNA polymerase II regulatory region sequence-specific DNA binding
GO:0000978RNA polymerase II core promoter proximal region sequence-specific DNA binding
GO:0001077transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding
GO:0001085RNA polymerase II transcription factor binding
GO:0001102RNA polymerase II activating transcription factor binding
GO:0001105RNA polymerase II transcription coactivator activity
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0001569branching involved in blood vessel morphogenesis
GO:0001764neuron migration
GO:0001947heart looping
GO:0003143embryonic heart tube morphogenesis
GO:0003148outflow tract septum morphogenesis
GO:0003151outflow tract morphogenesis
GO:0003175tricuspid valve development
GO:0003176aortic valve development
GO:0003180aortic valve morphogenesis
GO:0003193pulmonary valve formation
GO:0003203endocardial cushion morphogenesis
GO:0003207cardiac chamber formation
GO:0003215cardiac right ventricle morphogenesis
GO:0003272endocardial cushion formation
GO:0003279cardiac septum development
GO:0003344pericardium morphogenesis
GO:0006351transcription, DNA-templated
GO:0006366transcription from RNA polymerase II promoter
GO:0006936muscle contraction
GO:0007275multicellular organism development
GO:0008015blood circulation
GO:0008283cell proliferation
GO:0009953dorsal/ventral pattern formation
GO:0010628positive regulation of gene expression
GO:0010629negative regulation of gene expression
GO:0010991negative regulation of SMAD protein complex assembly
GO:0021524visceral motor neuron differentiation
GO:0030335positive regulation of cell migration
GO:0035050embryonic heart tube development
GO:0035922foramen ovale closure
GO:0036306embryonic heart tube elongation
GO:0045892negative regulation of transcription, DNA-templated
GO:0045893positive regulation of transcription, DNA-templated
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0055008cardiac muscle tissue morphogenesis
GO:0060045positive regulation of cardiac muscle cell proliferation
GO:0060413atrial septum morphogenesis
GO:0060577pulmonary vein morphogenesis
GO:0060973cell migration involved in heart development
GO:2000793cell proliferation involved in heart valve development
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001699Transcription factor, T-boxPRINTSPR00937TBOXcoord: 181..205
score: 63.04
coord: 284..298
score: 72.75
coord: 248..261
score: 48.45
coord: 265..274
score: 77.61
coord: 351..359
score: 89.13
IPR001699Transcription factor, T-boxSMARTSM00425tbox5coord: 163..364
e-value: 3.7E-104
score: 362.0
IPR001699Transcription factor, T-boxPFAMPF00907T-boxcoord: 166..359
e-value: 1.1E-76
score: 257.2
IPR001699Transcription factor, T-boxPANTHERPTHR11267T-BOX PROTEIN-RELATEDcoord: 63..505
IPR001699Transcription factor, T-boxPROSITEPS50252TBOX_3coord: 168..359
score: 70.836
IPR001699Transcription factor, T-boxCDDcd00182TBOXcoord: 164..362
e-value: 1.6154E-105
score: 313.37
IPR036960T-box superfamilyGENE3DG3DSA:2.60.40.820coord: 151..359
e-value: 8.0E-88
score: 295.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 118..137
NoneNo IPR availablePANTHERPTHR11267:SF129LP04777P-RELATEDcoord: 63..505
IPR018186Transcription factor, T-box, conserved sitePROSITEPS01283TBOX_1coord: 173..192
IPR008967p53-like transcription factor, DNA-bindingSUPERFAMILYSSF49417p53-like transcription factorscoord: 164..359