NPHP6

Overview
NameNPHP6 (AKN21708.1)
Smed IDSMED30019531
Length (bp)7356
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NPHP6 (SMED30019531) t-SNE clustered cells

Violin plots show distribution of expression levels for NPHP6 (SMED30019531) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NPHP6 (SMED30019531) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NPHP6 (SMED30019531) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019531

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30019531SMESG000072747.1 SmedASXL_014021SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30019531SMESG000072747.1 dd_Smed_v4_7145_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30019531SMESG000072747.1 dd_Smed_v4_7145_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019531SMESG000072747.1 dd_Smed_v4_7145_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019531SMESG000072747.1 dd_Smed_v4_7145_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30019531SMESG000072747.1 dd_Smed_v4_7145_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30019531SMESG000072747.1 dd_Smed_v6_7145_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30019531SMESG000072747.1 dd_Smed_v4_7145_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019531SMESG000072747.1 dd_Smed_v4_7145_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30019531SMESG000072747.1 dd_Smed_v4_7145_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NPHP6 vs. Ensembl Human
Match: CEP290 (centrosomal protein 290 [Source:HGNC Symbol;Acc:HGNC:29021])

HSP 1 Score: 796.193 bits (2055), Expect = 0.000e+0
Identity = 697/2129 (32.74%), Postives = 1212/2129 (56.93%), Query Frame = 2
Query:  638 LDNAQEKILELHQEMDHLKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQMRRIKELRQMLDDKEKMLRETVERLNKVENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVLQXXXXXXXXXXXXXXXXVRMLARQAGLRAGSAGMEAGDVMDAYKALELESSMQNI-EYDPV----MQSMARKYESAPQGNNTW---RIKEREMSSELSNAVKERAVKEDEIAKLMTRNRQLQTENDAMCDALRQIKEELVTRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDXXX---XXXXXXXXXXXXXXIGFXXXXXXXXXXXXXXXVMDPMVMMENGWNLEER-IGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEE---LGEAPASEQSIKSTSNSPRKTKSKLAVDSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNTWXXXXXXXXXXXXXXXXXXXXXXXXQKIERELRDELIDSVSKEINDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAKFD-----LETEFQVANIARQTETELKDAMATKRNEKSVLESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKXXXXXXXXXXXXGTRRAGYNGQ--LPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQLSIQKQKMETTDKINQSRLXXXXXXXXXXXXDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKN-LRNLSSNDAMKQELDAMKIKLRLIEEENNQLKR-------NPAKSANSKQDSQEKVNNWEEGKRNQRXXXXXXXXXXXXXNDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRLMRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRLTQ--------SGSTSVITLEKEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADXXXXXXXXXXQVGHKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLKQMARDVDKLEKQNADLESKLAISESRGRQ 6910
            L  A EKI   +QEM   ++NLE +  E+E++T EY  MK+    TD  +   + E    ++Q++ L + +  +N+ DD IM+ VN +VE+WK I+  +D EI    +    LR  L+ + ++++K+NV AL + ++ER+ ++K L++Q+      +E+N  +IE+LK +L+R  G S+  Q   +K ++  LD  ++  +E        E    ++++EL +AL+R K YE G +GL +AV EIK CK Q+++++RE E   + +NK      +   EN  LR ++ +     +D+  +R  K  + ++ RA N +L KEIE LE+ERL LKKK+R +A++ G R+ ++G+   D+          +  +NI + D +    +  ++ K  S  Q  N +    + E+E   E S  V   A  ++++ +L+  N+QL+   + M + L+ IKE  + ++     G   L  P L++L+ A+E++   G FD  ++LK ++D L        +   E R   I + Q     +     L+    ++    G N+  + I LP+ ++ S++  I + N++LI +LQE   KE+ L   + +L++Y RKFA +RH+Q LLY++Y  EK+ ++ E + ++   + +E    +D  ++ E++ +L+ L  D  E+K+ LA+  R+ITVL+VNE +L R+Y+ + E+E+ +R+EN K K+E++ +EA V +++G  +RFKE A +K+  LQK +D SV   ++     +++E+T KYR+ L+K N+L+ R  ++  +E E   +K   E++ K LE  K++ H +E   E+   LG   + +++ KS +NS             ++S+SKK+  LEMK++NE++RA+H  +MYE+++ +  + E+RN ELE K  ELT  NL+ QK+E+ LRDEL DSVSK ++DA+++R+LELEK E+E K E+ KL+EI++IA  Q   L  QQ SR+KE  SLR QL D Q QSDEKSLI KLH+H V LQ+SE +AL KL+ +    +++EA  LR EQ  DEK+Q LY  RL+GR R KHLR+TI SLR QFSG++PL++ E+F+ T+I+L  DK+K+ QE++ + +   +     LE E ++  +     T LKD   TK  +K +  +W  K+E LRL+ LK  R+    + E+++L ++I   E  ++ ++E+I +  + H+++Q+ W+QRE +LER +   +  Q E++ AA  F++AT        G++PDPS PLPNQL+ A+  IK++IR+I +     K+L +  KE E+ +R  E  +L R++ INELRLRLPA+ +R + + ++    +       KS++    T+  A  T++ +Q RL  K+E L +Y++LL++ARE+     +KH E++ +L  RL  +A +   +        +  + T V T+  +    E+   +A Q  +   L ++L  +   L  Q++  E   K  ++   + +   E+E+  +K  + +LK  L++ + + +    E+   K   +R+P   M+N + +L  QL  KEKQ + L   L +++  +T  + + +    ++     N+Q+++D+HTR+L  ++E   + +L+ +  L++++  +  +   L+ L  +   K+    K+  +K +++QENDEL+ Q++R+ + L+     D  +  ++ ++ K++ +E   NQL+         P K  N+K    E++  WEEGK+ Q   + ++ KL++KE ++  L+KQL+T      +  +EK  ++ +L      G  +D    +  I A   +                   RN +LE +I   MR   +    +V    +++  ++NR LQ  +  LE++ ++        SG  S    ++E+ +QKE ++L+ +N+ELKF+ E A K++PRLK +V D K+  + LK EK  ++ K           + +++  G SGK+  ELEK IG MKKVVEK QRENE+LK+A G++ +E++  +  EN  LK EL  LK  +GH+L+  Y++K +G  +++++ E+LRK+L +E +  EK RI    +    +K+  Q  +   +L  +ESRG Q
Sbjct:  225 LTEANEKIEVQNQEM---RKNLEESVQEMEKMTDEYNRMKAIVHQTDNVIDQLKKENDHYQLQVQELTDLLKSKNEEDDPIMVAVNAKVEEWKLILSSKDDEIIEYQQMLHNLREKLKNAQLDADKSNVMALQQGIQERDSQIKMLTEQVEQYTKEMEKNTCIIEDLKNELQRNKGASTLSQQTHMK-IQSTLDILKEKTKEAERTAELAEADAREKDKELVEALKRLKDYESGVYGLEDAVVEIKNCKNQIKIRDREIEILTKEINKLELKISDFLDENEALRERVGLEPKTMIDLTEFRNSKHLKQQQYRAENQILLKEIESLEEERLDLKKKIRQMAQERGKRSATSGLTTEDL----------NLTENISQGDRISERKLDLLSLKNMSEAQSKNEFLSRELIEKERDLERSRTV--IAKFQNKLKELVEENKQLE---EGMKEILQAIKE--MQKDPDVKGGETSLIIPSLERLVNAIESKNAEGIFDASLHLKAQVDQLTGRNEELRQELRESRKEAINYSQQLAKANLKIDHLEKETSLLRQSEGSNVVFKGIDLPDGIAPSSASIINSQNEYLIHLLQELENKEKKLKNLEDSLEDYNRKFAVIRHQQSLLYKEYLSEKETWKTESKTIKEEKRKLEDQVQQDAIKVKEYNNLLNALQMDSDEMKKILAENSRKITVLQVNEKSLIRQYTTLVELERQLRKENEKQKNELLSMEAEVCEKIGCLQRFKEMAIFKIAALQKVVDNSVSLSELELANKQYNELTAKYRDILQKDNMLVQRTSNLEHLECENISLKEQVESINKELEITKEKLHTIEQAWEQETKLGNESSMDKAKKSITNSD------------IVSISKKITMLEMKELNERQRAEHCQKMYEHLRTSLKQMEERNFELETKFAELTKINLDAQKVEQMLRDELADSVSKAVSDADRQRILELEKNEMELKVEVSKLREISDIARRQVEILNAQQQSRDKEVESLRMQLLDYQAQSDEKSLIAKLHQHNVSLQLSEATALGKLESITSKLQKMEAYNLRLEQKLDEKEQALYYARLEGRNRAKHLRQTIQSLRRQFSGALPLAQQEKFSKTMIQLQNDKLKIMQEMKNSQQEHRNMENKTLEMELKLKGLEELIST-LKD---TKGAQKVI--NWHMKIEELRLQELKLNRELVKDKEEIKYLNNIISEYERTISSLEEEIVQQNKFHEERQMAWDQREVDLERQLDIFDRQQNEILNAAQKFEEAT--------GSIPDPSLPLPNQLEIALRKIKENIRIILETRATCKSLEEKLKEKESALRLAEQNILSRDKVINELRLRLPATAEREKLIAELGRKEMEP-----KSHH----TLKIAHQTIANMQARLNQKEEVLKKYQRLLEKAREEQREIVKKHEEDLHILHHRLELQADSSLNKFKQTAWDLMKQSPTPVPTNKHFIRLAEMEQTVAEQDDSLSSLLVKLKKVSQDLERQREITELKVKEFENIKLQLQENHEDEVKKVKAEVEDLKYLLDQSQKESQCLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRAEMTAAAEERIISATSQKEAHLNVQQIVDRHTRELKTQVEDLNENLLKLKEALKTSKNRENSLTDNLNDLNNELQKKQKAYNKILREKEEIDQENDELKRQIKRLTSGLQGKPLTDNKQSLIEELQRKVKKLE---NQLEGKVEEVDLKPMKEKNAK----EELIRWEEGKKWQAKIEGIRNKLKEKEGEVFTLTKQLNTLKDLFAKADKEKLTLQRKLK---TTGMTVD---QVLGIRALESEKELEELKK-----------RNLDLENDI-LYMRAHQALPRDSV----VEDLHLQNRYLQEKLHALEKQFSKDTYSKPSISGIESDDHCQREQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMCEFLKKEKAEVQRK-----------LGHVRGSGRSGKTIPELEKTIGLMKKVVEKVQRENEQLKKASGILTSEKMANIEQENEKLKAELEKLKAHLGHQLSMHYESKTKGTEKIIAENERLRKELKKETDAAEKLRIAKNNLEILNEKMTVQLEETGKRLQFAESRGPQ 2257          
BLAST of NPHP6 vs. Ensembl Human
Match: CEP290 (centrosomal protein 290 [Source:HGNC Symbol;Acc:HGNC:29021])

HSP 1 Score: 791.956 bits (2044), Expect = 0.000e+0
Identity = 695/2131 (32.61%), Postives = 1211/2131 (56.83%), Query Frame = 2
Query:  638 LDNAQEKILELHQEMDHLKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQMRRIKELRQMLDDKEKMLRETVERLNKVENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVL--QXXXXXXXXXXXXXXXXVRMLARQAGLRAGSAGMEAGDVMDAYKALELESSMQNI-EYDPV----MQSMARKYESAPQGNNTW---RIKEREMSSELSNAVKERAVKEDEIAKLMTRNRQLQTENDAMCDALRQIKEELVTRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDXXX---XXXXXXXXXXXXXXIGFXXXXXXXXXXXXXXXVMDPMVMMENGWNLEER-IGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEE---LGEAPASEQSIKSTSNSPRKTKSKLAVDSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNTWXXXXXXXXXXXXXXXXXXXXXXXXQKIERELRDELIDSVSKEINDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAKFD-----LETEFQVANIARQTETELKDAMATKRNEKSVLESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKXXXXXXXXXXXXGTRRAGYNGQ--LPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQLSIQKQKMETTDKINQSRLXXXXXXXXXXXXDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKN-LRNLSSNDAMKQELDAMKIKLRLIEEENNQLKR-------NPAKSANSKQDSQEKVNNWEEGKRNQRXXXXXXXXXXXXXNDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRLMRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRLTQ--------SGSTSVITLEKEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADXXXXXXXXXXQVGHKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLKQMARDVDKLEKQNADLESKLAISESRGRQ 6910
            L  A EKI   +QEM   ++NLE +  E+E++T EY  MK+    TD  +   + E    ++Q++ L + +  +N+ DD IM+ VN +VE+WK I+  +D EI    +    LR  L+ + ++++K+NV AL + ++ER+ ++K L++Q+      +E+N  +IE+LK +L+R  G S+  Q   +K ++  LD  ++  +E        E    ++++EL +AL+R K YE G +GL +AV EIK CK Q+++++RE E   + +NK      +   EN  LR ++ +     +D+  +R  K  + ++ RA N +L  +  IE LE+ERL LKKK+R +A++ G R+ ++G+   D+          +  +NI + D +    +  ++ K  S  Q  N +    + E+E   E S  V   A  ++++ +L+  N+QL+   + M + L+ IKE  + ++     G   L  P L++L+ A+E++   G FD  ++LK ++D L        +   E R   I + Q     +     L+    ++    G N+  + I LP+ ++ S++  I + N++LI +LQE   KE+ L   + +L++Y RKFA +RH+Q LLY++Y  EK+ ++ E + ++   + +E    +D  ++ E++ +L+ L  D  E+K+ LA+  R+ITVL+VNE +L R+Y+ + E+E+ +R+EN K K+E++ +EA V +++G  +RFKE A +K+  LQK +D SV   ++     +++E+T KYR+ L+K N+L+ R  ++  +E E   +K   E++ K LE  K++ H +E   E+   LG   + +++ KS +NS             ++S+SKK+  LEMK++NE++RA+H  +MYE+++ +  + E+RN ELE K  ELT  NL+ QK+E+ LRDEL DSVSK ++DA+++R+LELEK E+E K E+ KL+EI++IA  Q   L  QQ SR+KE  SLR QL D Q QSDEKSLI KLH+H V LQ+SE +AL KL+ +    +++EA  LR EQ  DEK+Q LY  RL+GR R KHLR+TI SLR QFSG++PL++ E+F+ T+I+L  DK+K+ QE++ + +   +     LE E ++  +     T LKD   TK  +K +  +W  K+E LRL+ LK  R+    + E+++L ++I   E  ++ ++E+I +  + H+++Q+ W+QRE +LER +   +  Q E++ AA  F++AT        G++PDPS PLPNQL+ A+  IK++IR+I +     K+L +  KE E+ +R  E  +L R++ INELRLRLPA+ +R + + ++    +       KS++    T+  A  T++ +Q RL  K+E L +Y++LL++ARE+     +KH E++ +L  RL  +A +   +        +  + T V T+  +    E+   +A Q  +   L ++L  +   L  Q++  E   K  ++   + +   E+E+  +K  + +LK  L++ + + +    E+   K   +R+P   M+N + +L  QL  KEKQ + L   L +++  +T  + + +    ++     N+Q+++D+HTR+L  ++E   + +L+ +  L++++  +  +   L+ L  +   K+    K+  +K +++QENDEL+ Q++R+ + L+     D  +  ++ ++ K++ +E   NQL+         P K  N+K    E++  WEEGK+ Q   + ++ KL++KE ++  L+KQL+T      +  +EK  ++ +L      G  +D    +  I A   +                   RN +LE +I   MR   +    +V    +++  ++NR LQ  +  LE++ ++        SG  S    ++E+ +QKE ++L+ +N+ELKF+ E A K++PRLK +V D K+  + LK EK  ++ K           + +++  G SGK+  ELEK IG MKKVVEK QRENE+LK+A G++ +E++  +  EN  LK EL  LK  +GH+L+  Y++K +G  +++++ E+LRK+L +E +  EK RI    +    +K+  Q  +   +L  +ESRG Q
Sbjct:  225 LTEANEKIEVQNQEM---RKNLEESVQEMEKMTDEYNRMKAIVHQTDNVIDQLKKENDHYQLQVQELTDLLKSKNEEDDPIMVAVNAKVEEWKLILSSKDDEIIEYQQMLHNLREKLKNAQLDADKSNVMALQQGIQERDSQIKMLTEQVEQYTKEMEKNTCIIEDLKNELQRNKGASTLSQQTHMK-IQSTLDILKEKTKEAERTAELAEADAREKDKELVEALKRLKDYESGVYGLEDAVVEIKNCKNQIKIRDREIEILTKEINKLELKISDFLDENEALRERVGLEPKTMIDLTEFRNSKHLKQQQYRAENQILLKEASIESLEEERLDLKKKIRQMAQERGKRSATSGLTTEDL----------NLTENISQGDRISERKLDLLSLKNMSEAQSKNEFLSRELIEKERDLERSRTV--IAKFQNKLKELVEENKQLE---EGMKEILQAIKE--MQKDPDVKGGETSLIIPSLERLVNAIESKNAEGIFDASLHLKAQVDQLTGRNEELRQELRESRKEAINYSQQLAKANLKIDHLEKETSLLRQSEGSNVVFKGIDLPDGIAPSSASIINSQNEYLIHLLQELENKEKKLKNLEDSLEDYNRKFAVIRHQQSLLYKEYLSEKETWKTESKTIKEEKRKLEDQVQQDAIKVKEYNNLLNALQMDSDEMKKILAENSRKITVLQVNEKSLIRQYTTLVELERQLRKENEKQKNELLSMEAEVCEKIGCLQRFKEMAIFKIAALQKVVDNSVSLSELELANKQYNELTAKYRDILQKDNMLVQRTSNLEHLECENISLKEQVESINKELEITKEKLHTIEQAWEQETKLGNESSMDKAKKSITNSD------------IVSISKKITMLEMKELNERQRAEHCQKMYEHLRTSLKQMEERNFELETKFAELTKINLDAQKVEQMLRDELADSVSKAVSDADRQRILELEKNEMELKVEVSKLREISDIARRQVEILNAQQQSRDKEVESLRMQLLDYQAQSDEKSLIAKLHQHNVSLQLSEATALGKLESITSKLQKMEAYNLRLEQKLDEKEQALYYARLEGRNRAKHLRQTIQSLRRQFSGALPLAQQEKFSKTMIQLQNDKLKIMQEMKNSQQEHRNMENKTLEMELKLKGLEELIST-LKD---TKGAQKVI--NWHMKIEELRLQELKLNRELVKDKEEIKYLNNIISEYERTISSLEEEIVQQNKFHEERQMAWDQREVDLERQLDIFDRQQNEILNAAQKFEEAT--------GSIPDPSLPLPNQLEIALRKIKENIRIILETRATCKSLEEKLKEKESALRLAEQNILSRDKVINELRLRLPATAEREKLIAELGRKEMEP-----KSHH----TLKIAHQTIANMQARLNQKEEVLKKYQRLLEKAREEQREIVKKHEEDLHILHHRLELQADSSLNKFKQTAWDLMKQSPTPVPTNKHFIRLAEMEQTVAEQDDSLSSLLVKLKKVSQDLERQREITELKVKEFENIKLQLQENHEDEVKKVKAEVEDLKYLLDQSQKESQCLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRAEMTAAAEERIISATSQKEAHLNVQQIVDRHTRELKTQVEDLNENLLKLKEALKTSKNRENSLTDNLNDLNNELQKKQKAYNKILREKEEIDQENDELKRQIKRLTSGLQGKPLTDNKQSLIEELQRKVKKLE---NQLEGKVEEVDLKPMKEKNAK----EELIRWEEGKKWQAKIEGIRNKLKEKEGEVFTLTKQLNTLKDLFAKADKEKLTLQRKLK---TTGMTVD---QVLGIRALESEKELEELKK-----------RNLDLENDI-LYMRAHQALPRDSV----VEDLHLQNRYLQEKLHALEKQFSKDTYSKPSISGIESDDHCQREQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMCEFLKKEKAEVQRK-----------LGHVRGSGRSGKTIPELEKTIGLMKKVVEKVQRENEQLKKASGILTSEKMANIEQENEKLKAELEKLKAHLGHQLSMHYESKTKGTEKIIAENERLRKELKKETDAAEKLRIAKNNLEILNEKMTVQLEETGKRLQFAESRGPQ 2259          
BLAST of NPHP6 vs. Ensembl Human
Match: CEP290 (centrosomal protein 290 [Source:HGNC Symbol;Acc:HGNC:29021])

HSP 1 Score: 329.717 bits (844), Expect = 1.267e-94
Identity = 266/861 (30.89%), Postives = 477/861 (55.40%), Query Frame = 2
Query:  818 RMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQMRRIKELRQMLDDKEKMLRETVERLNKVENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVLQXXXXXXXXXXXXXXXXVRMLARQAGLRAGSAGMEAGDVMDAYKALELESSMQNI-EYDPV----MQSMARKYESAPQGNNT-----WRIKEREM-----------SSELSNAVKERAVKEDE---------IAKLMTRNRQLQTEN----DAMCDALRQIKEELVTRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDXXX---XXXXXXXXXXXXXXIGFXXXXXXXXXXXXXXXVMDPMVMMENGWNLEER-IGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEE---LGEAPASEQSIKSTSNSPRKTKSKLAVDSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNT 3277
            ++Q++ L + +  +N+ DD IM+ VN +VE+WK I+  +D EI    +    LR  L+ + ++++K+NV AL + ++ER+ ++K L++Q+      +E+N  +IE+LK +L+R  G S+  Q   +K ++  LD  ++  +E        E    ++++EL +AL+R K YE G +GL +AV EIK CK Q+++++RE E   + +NK      +   EN  LR ++ +     +D+  +R  K  + ++ RA N +L KEIE LE+ERL LKKK+R +A++ G R+ ++G+   D+          +  +NI + D +    +  ++ K  S  Q  N      + IKE E            S    N    R + E E         IAK   + ++L  EN    + M + L+ IKE  + ++     G   L  P L++L+ A+E++   G FD  ++LK ++D L        +   E R   I + Q     +     L+    ++    G N+  + I LP+ ++ S++  I + N++LI +LQE   KE+ L   + +L++Y RKFA +RH+Q LLY++Y  EK+ ++ E + ++   + +E    +D  ++ E++ +L+ L  D  E+K+ LA+  R+ITVL+VNE +L R+Y+ + E+E+ +R+EN K K+E++ +EA V +++G  +RFKE A +K+  LQK +D SV   ++     +++E+T KYR+ L+K N+L+ R  ++  +E E   +K   E++ K LE  K++ H +E   E+   LG   + +++ KS +NS             ++S+SKK+  LEMK++NE++RA+H  +MYE+++ +
Sbjct:    4 QLQVQELTDLLKSKNEEDDPIMVAVNAKVEEWKLILSSKDDEIIEYQQMLHNLREKLKNAQLDADKSNVMALQQGIQERDSQIKMLTEQVEQYTKEMEKNTCIIEDLKNELQRNKGASTLSQQTHMK-IQSTLDILKEKTKEAERTAELAEADAREKDKELVEALKRLKDYESGVYGLEDAVVEIKNCKNQIKIRDREIEILTKEINKLELKISDFLDENEALRERVGLEPKTMIDLTEFRNSKHLKQQQYRAENQILLKEIESLEEERLDLKKKIRQMAQERGKRSATSGLTTEDL----------NLTENISQGDRISERKLDLLSLKNMSEAQSKNEIIAQEFLIKEAECRNADIELEHHRSQAEQNEFLSRELIEKERDLERSRTVIAKFQNKLKELVEENKQLEEGMKEILQAIKE--MQKDPDVKGGETSLIIPSLERLVNAIESKNAEGIFDASLHLKAQVDQLTGRNEELRQELRESRKEAINYSQQLAKANLKIDHLEKETSLLRQSEGSNVVFKGIDLPDGIAPSSASIINSQNEYLIHLLQELENKEKKLKNLEDSLEDYNRKFAVIRHQQSLLYKEYLSEKETWKTESKTIKEEKRKLEDQVQQDAIKVKEYNNLLNALQMDSDEMKKILAENSRKITVLQVNEKSLIRQYTTLVELERQLRKENEKQKNELLSMEAEVCEKIGCLQRFKEMAIFKIAALQKVVDNSVSLSELELANKQYNELTAKYRDILQKDNMLVQRTSNLEHLECENISLKEQVESINKELEITKEKLHTIEQAWEQETKLGNESSMDKAKKSITNSD------------IVSISKKITMLEMKELNERQRAEHCQKMYEHLRTS 839          
BLAST of NPHP6 vs. Ensembl Human
Match: CEP290 (centrosomal protein 290 [Source:HGNC Symbol;Acc:HGNC:29021])

HSP 1 Score: 302.753 bits (774), Expect = 2.084e-84
Identity = 285/969 (29.41%), Postives = 528/969 (54.49%), Query Frame = 2
Query: 4058 SWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKXXXXXXXXXXXXGTRRAGYNGQ--LPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQLSIQKQKMETTDKINQSRLXXXXXXXXXXXXDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRI-KNLRNLSSNDAMKQELDAMKIKLRLIEEENNQLKRN-------PAKSANSKQDSQEKVNNWEEGKRNQRXXXXXXXXXXXXXNDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRLMRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRLTQ--------SGSTSVITLEKEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADXXXXXXXXXXQVGHKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLKQMARDVDKLEKQNADLESKLAISESRGRQ 6910
            +W  K+E LRL+ LK  R+    + E+++L ++I   E  ++ ++E+I +  + H+++Q+ W+QRE +LER +   +  Q E++ AA  F++ATG+        +PDPS PLPNQL+ A+  IK++IR+I +     K+L +  KE E+ +R  E  +L R++ INELRLRLPA+ +R + + ++    +       KS++    T+  A  T++ +Q RL  K+E L +Y++LL++ARE+     +KH E++ +L  RL  +A +   +        +  + T V T+  +    E+   +A Q  +   L ++L  +   L  Q++  E   K  ++   + +   E+E+  +K  + +LK  L++ + + +    E+   K   +R+P   M+N + +L  QL  KEKQ + L   L +++  +T  + + +    ++     N+Q+++D+HTR+L  ++E   + +L+ +  L++++  +  +   L+ L  +   K+    K+  +K +++QENDEL+ Q++R+   L+     D  +  ++ ++ K++ +E   NQL+         P K  N+K    E++  WEEGK+ Q   + ++ KL++KE ++  L+KQL+T      +  +EK  ++ +L      G  +D    +  I A                 +++L++RN +LE +I   MR   +    +V    +++  ++NR LQ  +  LE++ ++        SG  S    ++E+ +QKE ++L+ +N+ELKF+ E A K++PRLK +V D K+  + LK EK  ++ K           + +++  G SGK+  ELEK IG MKKVVEK QRENE+LK+A G++ +E++  +  EN  LK EL  LK  +GH+L+  Y++K +G  +++++ E+LRK+L +E +  EK RI    +    +K+  Q  +   +L  +ESRG Q
Sbjct:   25 NWHMKIEELRLQELKLNRELVKDKEEIKYLNNIISEYERTISSLEEEIVQQNKFHEERQMAWDQREVDLERQLDIFDRQQNEILNAAQKFEEATGS--------IPDPSLPLPNQLEIALRKIKENIRIILETRATCKSLEEKLKEKESALRLAEQNILSRDKVINELRLRLPATAEREKLIAELGRKEMEP-----KSHH----TLKIAHQTIANMQARLNQKEEVLKKYQRLLEKAREEQREIVKKHEEDLHILHHRLELQADSSLNKFKQTAWDLMKQSPTPVPTNKHFIRLAEMEQTVAEQDDSLSSLLVKLKKVSQDLERQREITELKVKEFENIKLQLQENHEDEVKKVKAEVEDLKYLLDQSQKESQCLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRAEMTAAAEERIISATSQKEAHLNVQQIVDRHTRELKTQVEDLNENLLKLKEALKTSKNRENSLTDNLNDLNNELQKKQKAYNKILREKEEIDQENDELKRQIKRLTSGLQGKPLTDNKQSLIEELQRKVKKLE---NQLEGKVEEVDLKPMKEKNAK----EELIRWEEGKKWQAKIEGIRNKLKEKEGEVFTLTKQLNTLKDLFAKADKEKLTLQRKLK---TTGMTVD---QVLGIRA-----------LESEKELEELKKRNLDLENDI-LYMRAHQALPRDSV----VEDLHLQNRYLQEKLHALEKQFSKDTYSKPSISGIESDDHCQREQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMCEFLKKEKAEVQRK-----------LGHVRGSGRSGKTIPELEKTIGLMKKVVEKVQRENEQLKKASGILTSEKMANIEQENEKLKAELEKLKAHLGHQLSMHYESKTKGTEKIIAENERLRKELKKETDAAEKLRIAKNNLEILNEKMTVQLEETGKRLQFAESRGPQ 936          
BLAST of NPHP6 vs. Ensembl Human
Match: CEP290 (centrosomal protein 290 [Source:HGNC Symbol;Acc:HGNC:29021])

HSP 1 Score: 169.474 bits (428), Expect = 6.805e-42
Identity = 175/596 (29.36%), Postives = 317/596 (53.19%), Query Frame = 2
Query:  638 LDNAQEKILELHQEMDHLKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQMRRIKELRQMLDDKEKMLRETVERLNKVENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVL--QXXXXXXXXXXXXXXXXVRMLARQAGLRAGSAGMEAGDVMDAYKALELESSMQNI-EYDPV----MQSMARKYESAPQGNNTW---RIKEREMSSELSNAVKERAVKEDEIAKLMTRNRQLQTENDAMCDALRQIKEELVTRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDXXX---XXXXXXXXXXXXXXIGFXXXXXXXXXXXXXXXVMDPMVMMENGWNLEER-IGLPENLSASASQTIAALNQHLIIVLQEKSLKEQA 2383
            L  A EKI   +QEM   ++NLE +  E+E++T EY  MK+    TD  +   + E    ++Q++ L + +  +N+ DD IM+ VN +VE+WK I+  +D EI    +    LR  L+ + ++++K+NV AL + ++ER+ ++K L++Q+      +E+N  +IE+LK +L+R  G S+  Q   +K ++  LD  ++  +E        E    ++++EL +AL+R K YE G +GL +AV EIK CK Q+++++RE E   + +NK      +   EN  LR ++ +     +D+  +R  K  + ++ RA N +L  +  IE LE+ERL LKKK+R +A++ G R+ ++G+   D+          +  +NI + D +    +  ++ K  S  Q  N +    + E+E   E S  V   A  ++++ +L+  N+QL+   + M + L+ IKE  + ++     G   L  P L++L+ A+E++   G FD  ++LK ++D L        +   E R   I + Q     +     L+    ++    G N+  + I LP+ ++ S++  I + N++LI +LQE   KE+ 
Sbjct:  225 LTEANEKIEVQNQEM---RKNLEESVQEMEKMTDEYNRMKAIVHQTDNVIDQLKKENDHYQLQVQELTDLLKSKNEEDDPIMVAVNAKVEEWKLILSSKDDEIIEYQQMLHNLREKLKNAQLDADKSNVMALQQGIQERDSQIKMLTEQVEQYTKEMEKNTCIIEDLKNELQRNKGASTLSQQTHMK-IQSTLDILKEKTKEAERTAELAEADAREKDKELVEALKRLKDYESGVYGLEDAVVEIKNCKNQIKIRDREIEILTKEINKLELKISDFLDENEALRERVGLEPKTMIDLTEFRNSKHLKQQQYRAENQILLKEASIESLEEERLDLKKKIRQMAQERGKRSATSGLTTEDL----------NLTENISQGDRISERKLDLLSLKNMSEAQSKNEFLSRELIEKERDLERSRTV--IAKFQNKLKELVEENKQLE---EGMKEILQAIKE--MQKDPDVKGGETSLIIPSLERLVNAIESKNAEGIFDASLHLKAQVDQLTGRNEELRQELRESRKEAINYSQQLAKANLKIDHLEKETSLLRQSEGSNVVFKGIDLPDGIAPSSASIINSQNEYLIHLLQELENKEKV 799          
BLAST of NPHP6 vs. Ensembl Zebrafish
Match: cep290 (centrosomal protein 290 [Source:NCBI gene;Acc:560588])

HSP 1 Score: 848.195 bits (2190), Expect = 0.000e+0
Identity = 742/2337 (31.75%), Postives = 1292/2337 (55.28%), Query Frame = 2
Query:   29 SSSDWDRILKVKTDQLNSMSPDDIDIIYELMVNIDDISNVDDADKLYKAFNIAQFIMSYKAEENKGLNEDL-----EEANVDXXXXXXXXXXXXXXNAALQRSDGTDINVVR-EKRNWEMEKESMNQEIRELKSKYNSLTEDNDK-------KEETINKQQKEIEGLKDSNAKLSDNVEFLRQRTNQLXXXXXXXXXXX-XXELAYTRSELRQKKIDLDNAQEKILELHQEMDHLKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQMRRIKELRQMLDDKEKMLRETVERLNKVENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVLQXXXXXXXXXXXXXXXXVRMLARQAGLRAGSAGMEAGDVMDAYKALELESSMQNIEYDPVMQSMARKYESAPQGNNTWRIKEREMSSELSNAVKERAVKEDEIAKLMTRNRQLQTENDAMCDALRQIKEEL--VTRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDXXX----XXXXXXXXXXXXXXIGFXXXXXXXXXXXXXXXVMDPMVMMENGWNLEERIGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEELGEAPASEQSIKSTSNSPRKTKSKLAV-DSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNTWXXXXXXXXXXXXXXXXXXXXXXXXQKIERELRDELIDSVSKEINDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAKFDLETEFQVANIARQTETELKDAMATKRNEKSV--LESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKXXXXXXXXXXXXGTRRAGYNG--QLPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQLSIQKQKMETTDKINQSRLXXXXXXXXXXXXDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHT-------RDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKN-LRNLSSNDAMKQELDAMKIKLRLIEEE-NNQLKRNPA-KSANSKQD--SQEKVNNWEEGKRNQRXXXXXXXXXXXXXNDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRLMRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRLTQ--------SGSTSVITLEKEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADXXXXXXXXXXQVGHKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLKQMARDVDKLEKQNADLESKLAISESRG 6904
            +++DW  ++ +  + L        D+I  LMV   D+   DD++K+ + F I+Q ++  K +E K   E +     E+A ++ +    + +   +   A +   G D + +R E R  E   E   +E+ +L+ +     + N++        EE   K ++EI+ L   N +L  ++EF R+   Q ++ + + + +  +  L     +L Q   +L +A++    L  E +HL++NLE +  E+E++T EY  MK     TD  +     +    ++Q+  L +Q+  R + DD +M  VN +VE+WK ++  +D EI    +    LR  L+ + ++S+K+N+ AL + V+ER+ ++K LS+Q+      +E N  LIE LK+ L++  G SS HQ RR+++L   L   E+ + E        E    D+++EL D L R ++YE G  GL  A++EIK CK Q++V++RE E  ++ +N+       L  EN  LR +L +   E+LD+  +RR K  +  + +A N VL KEIE+LE+ERL LK+++R L +  G+   S  +             L++S   +E  PV    + +  S    +   R  ER +  ELSN  KE  ++  E  +   +  ++  EN  +   +++I + +    +      GV +   P L++L+ A+E +   G+FD  ++L+T++D L        +E++     +     QL   ++K+ +    M+ M          + + LPE ++ ++++ I ALN++ + +LQE   K  ++++   AL+ Y+RKFA +RH+QGLLY+++  E++ +++E ++       +E  R  D  +I E++ +L+TL +D SE++R +A+  R+I VL+VNE  LTRRY+ + E+EQ +R+EN KLK +  Q++A VT+R+GY +RFKE A +K+  LQK LD SVP  ++ +   ++ E+T KYRN L+K N L+ +  S+  +E+E   ++   +++ K LE  K++ H LE   E          +I +T       K+  AV +S ++S+S+++ TLEMK++NE++RA+HA +MYE+++N+  + E+RN ELE K  ELT  NLE Q+IERELRDEL DSVSK I+DA+++R+ ELEK E   + E+ KL+E++++A MQ +AL  +Q SREKE  SLR+Q+ D Q +SDEK+LI KLH+HIV LQ+SET+A+ +L+  +   ++LEAQ LR EQ  DE+ Q L+  R +G  R +HLR TI +LR QFSG++PL++ E+F++T++ L ED+ ++ ++ Q+T   +   E + Q   +  +    L++ +AT ++ K    +  W  K+E +RL  ++  R+ +  R E+++L++ +  QE  ++ ++E++ +     +++QL+W+QRE +LER + + E  Q EV+  A  F++AT        G+LPDP+ PL NQLD A+  IK+H+R I + +   K L +  KE E  +   E  +L R++ INELRLRLPA+ +R + +  +S          ++ +   + T+  A  T++ LQ RL  K+E L +Y+ LL +AR++     ++H EE++ L ++L         R        +   T  V TS       E+   +A Q  +   L  +L  +  +L  Q+Q        + + +   E K   ++  L +    L+ +L + E ++ +   E+   K    RSP+  MKN + +L  QL  KEKQL+ L   L +++  +T Q+   +     +     N+Q+++DK T       RDL+ EL+  +D +       R+A+A +  ++ +L+ L  D    + +  KL+++K  LE+  +EL+ ++QR+ + L+    +D     +DA++ K+R +E E + +    PA K +  K+D  S+E+V  WEEGK+ Q   DK++  L++KE ++ + +KQL T  +   R+ +EK +++ +L    G G   D               +  A        +++L +RN ELE++I ++M+   +       + A+++   RNR L+  +  +E RL++        SG  S    ++E   QKE +RL+ +NLEL+F+ E A K++PRLK++V+D K+   +LK EK  +E + N           +++  G SGK+  ELEK IG MKKVVEK QRENE LK    V + EQ+  L  ++  LK E   LK +   +L  R ++K +G+ +++ + E+LRK++ +EAE  EK R+    +    +KL+ +  +   +L +++S+G
Sbjct:    3 AAADWRLLMGMDPEDLGDEDEKICDLI--LMVKPRDL-KADDSEKMIQLFRISQTLLRMKLDEIKCAYEVVDSAGAEQARIENELKAKVLKLESELEMAQRVMGGGDKHFLRDEIRQLESHLERKEKEVTQLEKEMGKERKSNEELALRAEEAEEKNRKLKREIKQLTRKNEQLQQDIEFYRKEAEQRESLQTKEESNEIQRRLTKANQQLYQCMEELQHAEDMAANLRSENEHLQKNLEESVKEMEKMTDEYNKMKIAVQQTDAIMDQLRKDRDHAKLQVRELTDQIQARVEEDDPVMAAVNAKVEEWKSVLSGKDLEILEYQQMIRDLREKLRTAQMDSDKSNIIALQQAVQERDNQIKMLSEQVEQYTTEMERNAMLIEELKRPLKKDKGHSSDHQ-RRLEDLSAKLQVAERKVLEAQRAAQLAERDARDKDKELNDTLSRIRLYESGTDGLEAAISEIKECKNQIRVRDREIEGMIKEINQLEMKINNLLDENEDLRERLGLNPKEELDLSEFRRSKILKQRQYKAENQVLLKEIERLEEERLELKQRIRALVKDKGVTVVSNSL-------------LDNS---VEEKPVR---SLRPSSGSTDDEIKRKNER-LQKELSNKEKELELRRSESTQFKAKLNEMLNENKQLEQGMKEILQAIQDTQKKTPTSTGVSI---PSLERLVNALEMKYSEGKFDASLHLRTQVDQLTGRNEELRQEMKTAREEAANTLSQLTKANEKIARLESEMESMSKSTGSSIPHKTLALPEEMTPTSAEAINALNEYTVQLLQEIKNKGDSIEQLGSALEEYKRKFAVIRHQQGLLYKEHQSERESWQKERDSFAELKSKLEEQREVDAVKIKEYNHLLETLEKDPSEIRREMAETGRKIVVLRVNEKCLTRRYTTLLELEQHLRKENAKLKEDFTQMQAAVTERIGYLQRFKEMAAFKMASLQKSLDVSVPASELERANKQYTELTIKYRNLLQKDNHLVQKTTSLEHLETENMSLRERIDSINKELEISKEKLHTLEQAFE----------NISTTGGEIIMDKATKAVANSEIVSVSRRITTLEMKELNERQRAEHAQKMYEHLRNSLKQVEERNFELETKFAELTKLNLEAQRIERELRDELADSVSKHISDADRKRITELEKTEANLRIEVSKLREVSDVAKMQVSALDARQQSREKEVESLRRQVLDYQAESDEKALIAKLHQHIVALQLSETTAISRLEATNTRLQKLEAQKLRDEQKLDEQQQALWHARQEGHQRARHLRHTIQALRRQFSGALPLAQQEKFSNTMLHLQEDRARVREDAQITEEERRKAEGKAQELELKLKG---LEELIATLKDAKGAQKVSEWHKKLEDVRLLEMRQSRELNTQREEIKYLKNCVAEQERTISGLEEELVQQNNLLEERQLIWDQREVQLERQLDSYEKQQNEVLNTAQKFEEAT--------GSLPDPNQPLANQLDYALGKIKEHVRTILETKTTCKILEEKLKEKEAALWSSEQNVLSRDKVINELRLRLPAAAEREKLLADLS----------KQEDSESQPTLKVAHQTINNLQGRLDQKEEVLKKYQNLLGKARQEQEEIAKRHEEEVRALHQKLDVYMDTSLDRFKQTALELIKKPTITVPTSKHLVRLAEMEQTVAEQDNSLSSLSQKLKIVTQELDQQRQVTAAQAMEHAADMARLEDKHAAQMKGLSQEAEELRAQLIQMEKELHYLRTELEAQKEANVRSPSNTMKNLVERLKNQLALKEKQLKALSKALLELRAELTSQAEQQIITNAAQKEEALNVQQIVDKQTKELRACVRDLNEELQLAKDGV-------RAAKARENSLKEDLETLNKDLQRSQKSQNKLQSEKEALEEHLNELKKKIQRLSSGLQAQVESDGPT--VDALQKKIRKLEHELDRKSISEPADKRSTLKEDKSSKEEVVRWEEGKKWQARVDKMRNVLKEKEREVDSQAKQLATMKELYSRLEQEKVSLQKKLK---GRGVTAD--------------QVVGARTLEADKEIEELHKRNAELEQQI-KVMKQQQA----LPRDAAMEDITNRNRYLEERLYSMESRLSKEPPSRPSTSGRGSDTPSQREHEFQKENLRLSTENLELRFQLEQANKDLPRLKDQVSDLKEMCSVLKKEKAEVEKRLN-----------HLRGSGRSGKTIPELEKTIGLMKKVVEKVQRENENLKRTSEVNVQEQLATLERDHEKLKSEYEKLKGKQEEQLNSRLESKTKGIEKIMMENERLRKEIKKEAEAAEKLRVAKASLEVANEKLKAELEETHQRLLLAQSKG 2239          
BLAST of NPHP6 vs. Ensembl Zebrafish
Match: cep290 (centrosomal protein 290 [Source:NCBI gene;Acc:560588])

HSP 1 Score: 848.195 bits (2190), Expect = 0.000e+0
Identity = 742/2337 (31.75%), Postives = 1292/2337 (55.28%), Query Frame = 2
Query:   29 SSSDWDRILKVKTDQLNSMSPDDIDIIYELMVNIDDISNVDDADKLYKAFNIAQFIMSYKAEENKGLNEDL-----EEANVDXXXXXXXXXXXXXXNAALQRSDGTDINVVR-EKRNWEMEKESMNQEIRELKSKYNSLTEDNDK-------KEETINKQQKEIEGLKDSNAKLSDNVEFLRQRTNQLXXXXXXXXXXX-XXELAYTRSELRQKKIDLDNAQEKILELHQEMDHLKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQMRRIKELRQMLDDKEKMLRETVERLNKVENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVLQXXXXXXXXXXXXXXXXVRMLARQAGLRAGSAGMEAGDVMDAYKALELESSMQNIEYDPVMQSMARKYESAPQGNNTWRIKEREMSSELSNAVKERAVKEDEIAKLMTRNRQLQTENDAMCDALRQIKEEL--VTRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDXXX----XXXXXXXXXXXXXXIGFXXXXXXXXXXXXXXXVMDPMVMMENGWNLEERIGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEELGEAPASEQSIKSTSNSPRKTKSKLAV-DSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNTWXXXXXXXXXXXXXXXXXXXXXXXXQKIERELRDELIDSVSKEINDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAKFDLETEFQVANIARQTETELKDAMATKRNEKSV--LESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKXXXXXXXXXXXXGTRRAGYNG--QLPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQLSIQKQKMETTDKINQSRLXXXXXXXXXXXXDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHT-------RDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKN-LRNLSSNDAMKQELDAMKIKLRLIEEE-NNQLKRNPA-KSANSKQD--SQEKVNNWEEGKRNQRXXXXXXXXXXXXXNDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRLMRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRLTQ--------SGSTSVITLEKEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADXXXXXXXXXXQVGHKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLKQMARDVDKLEKQNADLESKLAISESRG 6904
            +++DW  ++ +  + L        D+I  LMV   D+   DD++K+ + F I+Q ++  K +E K   E +     E+A ++ +    + +   +   A +   G D + +R E R  E   E   +E+ +L+ +     + N++        EE   K ++EI+ L   N +L  ++EF R+   Q ++ + + + +  +  L     +L Q   +L +A++    L  E +HL++NLE +  E+E++T EY  MK     TD  +     +    ++Q+  L +Q+  R + DD +M  VN +VE+WK ++  +D EI    +    LR  L+ + ++S+K+N+ AL + V+ER+ ++K LS+Q+      +E N  LIE LK+ L++  G SS HQ RR+++L   L   E+ + E        E    D+++EL D L R ++YE G  GL  A++EIK CK Q++V++RE E  ++ +N+       L  EN  LR +L +   E+LD+  +RR K  +  + +A N VL KEIE+LE+ERL LK+++R L +  G+   S  +             L++S   +E  PV    + +  S    +   R  ER +  ELSN  KE  ++  E  +   +  ++  EN  +   +++I + +    +      GV +   P L++L+ A+E +   G+FD  ++L+T++D L        +E++     +     QL   ++K+ +    M+ M          + + LPE ++ ++++ I ALN++ + +LQE   K  ++++   AL+ Y+RKFA +RH+QGLLY+++  E++ +++E ++       +E  R  D  +I E++ +L+TL +D SE++R +A+  R+I VL+VNE  LTRRY+ + E+EQ +R+EN KLK +  Q++A VT+R+GY +RFKE A +K+  LQK LD SVP  ++ +   ++ E+T KYRN L+K N L+ +  S+  +E+E   ++   +++ K LE  K++ H LE   E          +I +T       K+  AV +S ++S+S+++ TLEMK++NE++RA+HA +MYE+++N+  + E+RN ELE K  ELT  NLE Q+IERELRDEL DSVSK I+DA+++R+ ELEK E   + E+ KL+E++++A MQ +AL  +Q SREKE  SLR+Q+ D Q +SDEK+LI KLH+HIV LQ+SET+A+ +L+  +   ++LEAQ LR EQ  DE+ Q L+  R +G  R +HLR TI +LR QFSG++PL++ E+F++T++ L ED+ ++ ++ Q+T   +   E + Q   +  +    L++ +AT ++ K    +  W  K+E +RL  ++  R+ +  R E+++L++ +  QE  ++ ++E++ +     +++QL+W+QRE +LER + + E  Q EV+  A  F++AT        G+LPDP+ PL NQLD A+  IK+H+R I + +   K L +  KE E  +   E  +L R++ INELRLRLPA+ +R + +  +S          ++ +   + T+  A  T++ LQ RL  K+E L +Y+ LL +AR++     ++H EE++ L ++L         R        +   T  V TS       E+   +A Q  +   L  +L  +  +L  Q+Q        + + +   E K   ++  L +    L+ +L + E ++ +   E+   K    RSP+  MKN + +L  QL  KEKQL+ L   L +++  +T Q+   +     +     N+Q+++DK T       RDL+ EL+  +D +       R+A+A +  ++ +L+ L  D    + +  KL+++K  LE+  +EL+ ++QR+ + L+    +D     +DA++ K+R +E E + +    PA K +  K+D  S+E+V  WEEGK+ Q   DK++  L++KE ++ + +KQL T  +   R+ +EK +++ +L    G G   D               +  A        +++L +RN ELE++I ++M+   +       + A+++   RNR L+  +  +E RL++        SG  S    ++E   QKE +RL+ +NLEL+F+ E A K++PRLK++V+D K+   +LK EK  +E + N           +++  G SGK+  ELEK IG MKKVVEK QRENE LK    V + EQ+  L  ++  LK E   LK +   +L  R ++K +G+ +++ + E+LRK++ +EAE  EK R+    +    +KL+ +  +   +L +++S+G
Sbjct:    3 AAADWRLLMGMDPEDLGDEDEKICDLI--LMVKPRDL-KADDSEKMIQLFRISQTLLRMKLDEIKCAYEVVDSAGAEQARIENELKAKVLKLESELEMAQRVMGGGDKHFLRDEIRQLESHLERKEKEVTQLEKEMGKERKSNEELALRAEEAEEKNRKLKREIKQLTRKNEQLQQDIEFYRKEAEQRESLQTKEESNEIQRRLTKANQQLYQCMEELQHAEDMAANLRSENEHLQKNLEESVKEMEKMTDEYNKMKIAVQQTDAIMDQLRKDRDHAKLQVRELTDQIQARVEEDDPVMAAVNAKVEEWKSVLSGKDLEILEYQQMIRDLREKLRTAQMDSDKSNIIALQQAVQERDNQIKMLSEQVEQYTTEMERNAMLIEELKRPLKKDKGHSSDHQ-RRLEDLSAKLQVAERKVLEAQRAAQLAERDARDKDKELNDTLSRIRLYESGTDGLEAAISEIKECKNQIRVRDREIEGMIKEINQLEMKINNLLDENEDLRERLGLNPKEELDLSEFRRSKILKQRQYKAENQVLLKEIERLEEERLELKQRIRALVKDKGVTVVSNSL-------------LDNS---VEEKPVR---SLRPSSGSTDDEIKRKNER-LQKELSNKEKELELRRSESTQFKAKLNEMLNENKQLEQGMKEILQAIQDTQKKTPTSTGVSI---PSLERLVNALEMKYSEGKFDASLHLRTQVDQLTGRNEELRQEMKTAREEAANTLSQLTKANEKIARLESEMESMSKSTGSSIPHKTLALPEEMTPTSAEAINALNEYTVQLLQEIKNKGDSIEQLGSALEEYKRKFAVIRHQQGLLYKEHQSERESWQKERDSFAELKSKLEEQREVDAVKIKEYNHLLETLEKDPSEIRREMAETGRKIVVLRVNEKCLTRRYTTLLELEQHLRKENAKLKEDFTQMQAAVTERIGYLQRFKEMAAFKMASLQKSLDVSVPASELERANKQYTELTIKYRNLLQKDNHLVQKTTSLEHLETENMSLRERIDSINKELEISKEKLHTLEQAFE----------NISTTGGEIIMDKATKAVANSEIVSVSRRITTLEMKELNERQRAEHAQKMYEHLRNSLKQVEERNFELETKFAELTKLNLEAQRIERELRDELADSVSKHISDADRKRITELEKTEANLRIEVSKLREVSDVAKMQVSALDARQQSREKEVESLRRQVLDYQAESDEKALIAKLHQHIVALQLSETTAISRLEATNTRLQKLEAQKLRDEQKLDEQQQALWHARQEGHQRARHLRHTIQALRRQFSGALPLAQQEKFSNTMLHLQEDRARVREDAQITEEERRKAEGKAQELELKLKG---LEELIATLKDAKGAQKVSEWHKKLEDVRLLEMRQSRELNTQREEIKYLKNCVAEQERTISGLEEELVQQNNLLEERQLIWDQREVQLERQLDSYEKQQNEVLNTAQKFEEAT--------GSLPDPNQPLANQLDYALGKIKEHVRTILETKTTCKILEEKLKEKEAALWSSEQNVLSRDKVINELRLRLPAAAEREKLLADLS----------KQEDSESQPTLKVAHQTINNLQGRLDQKEEVLKKYQNLLGKARQEQEEIAKRHEEEVRALHQKLDVYMDTSLDRFKQTALELIKKPTITVPTSKHLVRLAEMEQTVAEQDNSLSSLSQKLKIVTQELDQQRQVTAAQAMEHAADMARLEDKHAAQMKGLSQEAEELRAQLIQMEKELHYLRTELEAQKEANVRSPSNTMKNLVERLKNQLALKEKQLKALSKALLELRAELTSQAEQQIITNAAQKEEALNVQQIVDKQTKELRACVRDLNEELQLAKDGV-------RAAKARENSLKEDLETLNKDLQRSQKSQNKLQSEKEALEEHLNELKKKIQRLSSGLQAQVESDGPT--VDALQKKIRKLEHELDRKSISEPADKRSTLKEDKSSKEEVVRWEEGKKWQARVDKMRNVLKEKEREVDSQAKQLATMKELYSRLEQEKVSLQKKLK---GRGVTAD--------------QVVGARTLEADKEIEELHKRNAELEQQI-KVMKQQQA----LPRDAAMEDITNRNRYLEERLYSMESRLSKEPPSRPSTSGRGSDTPSQREHEFQKENLRLSTENLELRFQLEQANKDLPRLKDQVSDLKEMCSVLKKEKAEVEKRLN-----------HLRGSGRSGKTIPELEKTIGLMKKVVEKVQRENENLKRTSEVNVQEQLATLERDHEKLKSEYEKLKGKQEEQLNSRLESKTKGIEKIMMENERLRKEIKKEAEAAEKLRVAKASLEVANEKLKAELEETHQRLLLAQSKG 2239          
BLAST of NPHP6 vs. Ensembl Xenopus
Match: CEP290 (centrosomal protein 290 [Source:HGNC Symbol;Acc:HGNC:29021])

HSP 1 Score: 811.216 bits (2094), Expect = 0.000e+0
Identity = 729/2252 (32.37%), Postives = 1271/2252 (56.44%), Query Frame = 2
Query:  689 LKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGH-QMRRIKELRQMLDDKEKMLRETVERLNKV-ENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVLQXXXXXXXXXXXXXXXXVRMLARQAGLRAGSAGMEAGDVMDAYKALELESSMQNIEYDPVMQSMARKYESAPQGNN---TWRIKERE--------MSSELSNAVKERAVKEDEIAKLMTRNRQLQTENDAMCDALRQIKEELVTRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDXXX---XXXXXXXXXXXXXXIGFXXXXXXXXXXXXXXXVMDPMVMMENGWNL-EERIGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEELGEA---PASEQSIKSTSNSPRKTKSKLAVDSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNTWXXXXXXXXXXXXXXXXXXXXXXXXQKIERELRDELIDSVSKEINDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAK-----FDLETEFQVANIARQTETELKDAMATKRNEKSVLESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKXXXXXXXXXXXXGTRRAGYNGQLPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQL-----SIQKQKMETTDKINQ-----SRLXXXXXXXXXXXXDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKNLRNLSSNDAMKQEL-------DAMKIKLRLIEEE----NNQLKRNPAKSANSKQDSQEKVNNWEEGKRNQRXXXXXXXXXXXXXNDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRL-MRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRLTQSGSTSVITL-----EKEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADXXXXXXXXXXQVGHKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLKQMARDVDKLEKQNADL-ESKLAISESRGRQ------------NVSRIAN---KELQDENRKLSSIIANLQSQLKDK--------------HNQN------PDSSKVEE--------LKLLYNKATERVSFLEKQLQSFSEQFGVAIDLGY*SGDY 7156
            L ++LE +  E+E++T EY  MK     +D  +     E    R+Q++ L EQ+  +N+ DD +M  VN +V++WK I+  +D EI    ++   LR  L+ + ++++K++V AL + ++ER   +K L+++L      +E N   IE LK  L+ T  G SGH ++++ +EL  ML+  E+ ++E+ ER+ K+ E+   ++++EL +AL R + YE G +GL EAV+EIK  K Q++++++E E  ++++NK +    ++  EN  L+ +L +     +D+  ++  KA ++++ RA N VL KE+E LE+ER+ LKK++R LA++ G RA   G+ A D+  +  + E   S +    + ++   A       +G N   + ++ E+E        +++EL + +KE  + ED+        + L+     +  AL+ ++++  TRN  A     ++  P L++L+ A+E+R   G FD  I+LK ++D L        +   E R   I         ++    L+    M+    G N+  + I LP+ +S +++  + +LN++++ +LQE   KEQ++ K + AL+ Y+RKFA +RH+ GLLY++Y  E++ +++E++ L+     +E  +  D  +I E+  +LD L  D  E+K+++A+  R++TVL+VNE  LTRRY+ + EMEQ +R++N KLK+++  +EA V +R+GY +R+KE A +K+  LQ+ LD+SVP  ++     +++E+T KYR+ L+K N+L+ R   +  +E E + +K       K LE  K++ + LE  LE +      PA +++ K+ +N            + ++S+SKK+  LEMK++NE++RA+H+ +MYE+++ T  + E+RN ELE K  ELT  NLE QK+E+ LRD+L +SVSK ++DA+++R++ELEK E E K E+ KL+ +++IA MQ +AL  +Q SREKE  S+R+Q+ D Q QSDEK+LI KLH+ IV LQ+SE++A+ KL+      +++EA  LR EQ  D+KDQ LY  R++GR R KHLR+T++SLR QFSG++PL++ E+F+ T+++L  DK+K   E++   + +       +E E ++  +     T LKDA    R  + V E W  K+E LRL+ LK  R+    + E+++L ++I  QE  ++ ++ED+ +  + H+++Q+ W+QRE ELER +   E+ Q EV+ AA  F++AT        G +PD + PLP QL+ A+  IK+H++ + + ++  + L +  KE ++ +R  E  +L R+R INELRL+LPA+          +   + S LN  K +    + +  A  T++ +Q RL  K+E L +Y+ LL +ARE+     +KH E++K L ++L+  +           +  M   ++         N +R  LA   +T  + +  LA + +QL      ++KQK  T  K+N+     +RL+E  I    +   LK +  +L+ ++ E E +I + N E+   K   TR+P   MKN + +L  Q+  KEKQ Q L   L  ++  +T Q+   +     +     N+Q+++DK T+DL   +E   +Q L+ +  L+++++ +  +  E + L  D   KE    KL+ DK ++E++N+EL+      K +++L+ N   K +L       + ++ +++ +E E    + + +R P +   S   S+E++  WEE K+ Q   + ++ KL+DKE ++ +L+KQL T      +  +EK  ++ +L  +   G  +D               +  A  +     V++LR++N ELE EI  +  + A   DS  ++++ LK     NR LQ  ++ LER+L+Q  ++   T      ++ + ++KE ++L  +N+EL+F  E A K++PRLK+++ + K+  DLLK EK   E K           +++++  G SGK+  ELEK I  MK+VVE+ Q+ENE LK+APG++ NE++  L  EN  LKLE+  L+  VG +L+ RY+AK +G+ +++++ ++LRK+L  E E  EK RI  + +    +KL +   DL E+++ I+E  G Q             VS++     KEL+ E +K +  I +L+  LK+                N+N      P+ +K EE        L+L  N+     + LE QL+ + ++ GV+   G+  GDY
Sbjct:  139 LTKHLEYSVQEMEKMTDEYNKMKLMVQNSDSIMDRLRKEKEQHRLQVQELAEQLKAKNEEDDPVMRAVNAKVDEWKIILASKDEEISDYQKKIVDLREKLKIAQLDADKSSVLALQQALQERNNHIKMLTEKLEQHTQEMESNTFHIEKLKLQLQ-TEKGVSGHIEIKQAEELVGMLNILEERVKES-ERIAKLAESDAREKDKELVEALRRMREYEAGVYGLVEAVSEIKELKTQIKIRDQEIESLIKDLNKHHLKLNDILDENEELKQRLGLDPKTAIDLTEFKNIKALKEQQYRAENQVLLKEVECLEEERIRLKKQIRKLAQEKGKRAACLGLTADDLNLSVDSPEDHKSKKKKPSNSIVLDHA-------EGMNEHLSKQLSEKEQELERYKTITAELKSKLKE--ISEDK--------KHLEQIPKDIFQALKDVEKD-HTRNGEA----TIISVPSLERLIHAIESRNTEGIFDVSIHLKAQVDQLTGRNEELRQELKESRKEAINISCALEKANEKILHLENELEMLRQLEGANMIFKPINLPDGMSPTSTNLLNSLNEYILHLLQEVESKEQSVIKFEEALEEYKRKFAVIRHQHGLLYKEYMSEQESWQEELKKLKEENAKLENQKETDMVQIKEYTNLLDALKMDPDEMKKQVAENLRKMTVLRVNEKLLTRRYTTLLEMEQHLRKDNGKLKNDISDMEAAVAERLGYLQRYKEIAAFKIASLQRALDDSVPISELETANKQYNELTSKYRDMLQKDNLLVQRTADMEHLEHENASLKSQIAFYNKELEITKEKCNTLEQALEHINNLDGNPAMDKATKAITN------------NEIVSISKKITMLEMKELNERQRAEHSQKMYEHLRTTLTQLEERNFELETKFAELTKINLEAQKVEQALRDDLANSVSKAVSDADRKRIMELEKTEAELKAEMSKLRNVSDIAKMQVSALASRQQSREKEVESMRKQILDYQDQSDEKALIAKLHQQIVALQISESTAVGKLEAATAKLRKMEAYNLRLEQKIDDKDQALYYARMEGRNRAKHLRQTVHSLRRQFSGALPLAQQEKFSKTMMQLQNDKLKTIHEMERVQQERREAENHSVELELKLKGLEELIST-LKDA----RGAQKVTE-WHRKIEELRLQDLKLSRELSQKKEEIKYLNNMISEQERTISILEEDLVQQGKFHEERQMSWDQREVELERQLDMYEHQQNEVLSAAQKFEEAT--------GEVPDSNLPLPEQLEIALRKIKEHVKAVVETKSVCRTLEEKLKEKDSLLRTAENNILSRDRVINELRLQLPAT---------AAKETLLSNLNQIKEDSEQHQALKVAHQTVANMQARLNQKEEMLKKYQHLLAKAREEQEEVTKKHAEDLKELHQKLNLYSDTSINNFKEAAKEFMKKPSLQIPSSA---NLIR--LAEMEQTVAEQENSLASLSNQLRKATSELEKQKQITIAKVNEFENSKTRLEEKHIVEIKK---LKNDAEDLRARIAETEKEINYLNTELEAQKEANTRAPTSTMKNLVERLKNQVALKEKQQQALSKALLTLRAEMTSQAEQHIIAAAAQKEENINVQQIVDKETKDLKARIEKLNEQQLKLKEALKNSKSRENALIEEAENLNQDLRGKEKALSKLQKDKDEMERDNEELK------KRIKDLTINFQGKVDLHNKHNTSEDLQRRIKKLEAELAKKSEEAERKPVRDDKS---SKEEIIRWEESKKWQIKIEGMRSKLKDKEKEVDSLTKQLTTLKDLYSKGEQEKLMLQKKLKSR---GVTVD--------------QVVGARTAESEREVEELRKKNQELENEIQHMKTKQALPRDS-VIDDLHLK-----NRFLQEKLQALERQLSQENTSRPSTSGLGSDDQTRELEKENLKLTSENVELQFHLEQANKDLPRLKDQIENLKEMCDLLKKEKIEAERK-----------VASVRGSGRSGKTVPELEKTIALMKRVVERVQKENEELKKAPGIVSNEKLTNLEMENEKLKLEIEKLQLHVGGQLSMRYEAKTKGIEKLIAENDRLRKELKTETETSEKLRIAKRNLEVIKEKLAR---DLEEARMNIAERSGPQLEGTQGKAWKSTVVSKMFENKIKELESELKKKNDGIVDLKKLLKEATERELKTEKIVGNLKNENELLKNFPEEAKTEEGLARDFQILRLANNRLQNEKAELEHQLEIYRKKSGVS---GH--GDY 2272          
BLAST of NPHP6 vs. Ensembl Xenopus
Match: CEP290 (centrosomal protein 290 [Source:HGNC Symbol;Acc:HGNC:29021])

HSP 1 Score: 804.283 bits (2076), Expect = 0.000e+0
Identity = 725/2268 (31.97%), Postives = 1265/2268 (55.78%), Query Frame = 2
Query:  689 LKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGH-QMRRIKELRQMLDDKEKMLRETVERLNKV-ENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVLQXXXXXXXXXXXXXXXXVRMLARQAGLRAGSAGMEAGDVMDAYKALELESSMQNIEYDPVMQSMARKYESAPQGNNTWRIKEREMSSELSNAVKERAVKEDEIAKLMTRNRQLQTENDAMCDALRQIKEELVTRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDXXX---XXXXXXXXXXXXXXIGFXXXXXXXXXXXXXXXVMDPMVMMENGWNL-EERIGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEELGEA---PASEQSIKSTSNSPRKTKSKLAVDSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNTWXXXXXXXXXXXXXXXXXXXXXXXXQKIERELRDELIDSVSKEINDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAK-----FDLETEFQVANIARQTETELKDAMATKRNEKSVLESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKXXXXXXXXXXXXGTRRAGYNGQLPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQL-----SIQKQKMETTDKINQ-----SRLXXXXXXXXXXXXDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKNLRNLSSNDAMKQEL-------DAMKIKLRLIEEE----NNQLKRNPAKSANSKQDSQEKVNNWEEGKRNQRXXXXXXXXXXXXXNDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRL-MRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRLTQSGSTSVITL-----EKEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADXXXXXXXXXXQVGHKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLKQMARDVDKLEKQNADL-ESKLAISESRGRQ------------NVSRIAN---KELQDENRKLSSIIANLQSQLKDK--------------HNQN------PDSSKVEE------------------------------------------LKLLYNKATERVSFLEKQLQSFSEQFGVAIDL 7135
            L ++LE +  E+E++T EY  MK     +D  +     E    R+Q++ L EQ+  +N+ DD +M  VN +V++WK I+  +D EI    ++   LR  L+ + ++++K++V AL + ++ER   +K L+++L      +E N   IE LK  L+ T  G SGH ++++ +EL  ML+  E+ ++E+ ER+ K+ E+   ++++EL +AL R + YE G +GL EAV+EIK  K Q++++++E E  ++++NK +    ++  EN  L+ +L +     +D+  ++  KA ++++ RA N VL KE+E LE+ER+ LKK++R LA++ G RA         +M  Y    + + M  + +    + ++++     Q    ++     +++EL + +KE  + ED+        + L+     +  AL+ ++++  TRN  A     ++  P L++L+ A+E+R   G FD  I+LK ++D L        +   E R   I         ++    L+    M+    G N+  + I LP+ +S +++  + +LN++++ +LQE   KEQ++ K + AL+ Y+RKFA +RH+ GLLY++Y  E++ +++E++ L+     +E  +  D  +I E+  +LD L  D  E+K+++A+  R++TVL+VNE  LTRRY+ + EMEQ +R++N KLK+++  +EA V +R+GY +R+KE A +K+  LQ+ LD+SVP  ++     +++E+T KYR+ L+K N+L+ R   +  +E E + +K       K LE  K++ + LE  LE +      PA +++ K+ +N            + ++S+SKK+  LEMK++NE++RA+H+ +MYE+++ T  + E+RN ELE K  ELT  NLE QK+E+ LRD+L +SVSK ++DA+++R++ELEK E E K E+ KL+ +++IA MQ +AL  +Q SREKE  S+R+Q+ D Q QSDEK+LI KLH+ IV LQ+SE++A+ KL+      +++EA  LR EQ  D+KDQ LY  R++GR R KHLR+T++SLR QFSG++PL++ E+F+ T+++L  DK+K   E++   + +       +E E ++  +     T LKDA    R  + V E W  K+E LRL+ LK  R+    + E+++L ++I  QE  ++ ++ED+ +  + H+++Q+ W+QRE ELER +   E+ Q EV+ AA  F++AT        G +PD + PLP QL+ A+  IK+H++ + + ++  + L +  KE ++ +R  E  +L R+R INELRL+LPA+          +   + S LN  K +    + +  A  T++ +Q RL  K+E L +Y+ LL +ARE+     +KH E++K L ++L+  +           ++ +         + R  N +R  LA   +T  + +  LA + +QL      ++KQK  T  K+N+     +RL+E  I    +   LK +  +L+ ++ E E +I + N E+   K   TR+P   MKN + +L  Q+  KEKQ Q L   L  ++  +T Q+   +     +     N+Q+++DK T+DL   +E   +Q L+ +  L+++++ +  +  E + L  D   KE    KL+ DK ++E++N+EL+      K +++L+ N   K +L       + ++ +++ +E E    + + +R P +   S   S+E++  WEE K+ Q   + ++ KL+DKE ++ +L+KQL T      +  +EK  ++ +L  +   G  +D               +  A  +     V++LR++N ELE EI  +  + A   DS  ++++ LK     NR LQ  ++ LER+L+Q  ++   T      ++ + ++KE ++L  +N+EL+F  E A K++PRLK+++ + K+  DLLK EK   E K           +++++  G SGK+  ELEK I  MK+VVE+ Q+ENE LK+APG++ NE++  L  EN  LKLE+  L+  VG +L+ RY+AK +G+ +++++ ++LRK+L  E E  EK RI  + +    +KL +   DL E+++ I+E  G Q             VS++     KEL+ E +K +  I +L+  LK+                N+N      P+ +K EE                                          LK  YN+  ++   LE++L++ SEQFGV ID 
Sbjct:  139 LTKHLEYSVQEMEKMTDEYNKMKLMVQNSDSIMDRLRKEKEQHRLQVQELAEQLKAKNEEDDPVMRAVNAKVDEWKIILASKDEEISDYQKKIVDLREKLKIAQLDADKSSVLALQQALQERNNHIKMLTEKLEQHTQEMESNTFHIEKLKLQLQ-TEKGVSGHIEIKQAEELVGMLNILEERVKES-ERIAKLAESDAREKDKELVEALRRMREYEAGVYGLVEAVSEIKELKTQIKIRDQEIESLIKDLNKHHLKLNDILDENEELKQRLGLDPKTAIDLTEFKNIKALKEQQYRAENQVLLKEVECLEEERIRLKKQIRKLAQEKGKRA---------LM--YNFWHMLTHM-TLHFFFKNEHLSKQLSEKEQELERYKT----ITAELKSKLKE--ISEDK--------KHLEQIPKDIFQALKDVEKD-HTRNGEA----TIISVPSLERLIHAIESRNTEGIFDVSIHLKAQVDQLTGRNEELRQELKESRKEAINISCALEKANEKILHLENELEMLRQLEGANMIFKPINLPDGMSPTSTNLLNSLNEYILHLLQEVESKEQSVIKFEEALEEYKRKFAVIRHQHGLLYKEYMSEQESWQEELKKLKEENAKLENQKETDMVQIKEYTNLLDALKMDPDEMKKQVAENLRKMTVLRVNEKLLTRRYTTLLEMEQHLRKDNGKLKNDISDMEAAVAERLGYLQRYKEIAAFKIASLQRALDDSVPISELETANKQYNELTSKYRDMLQKDNLLVQRTADMEHLEHENASLKSQIAFYNKELEITKEKCNTLEQALEHINNLDGNPAMDKATKAITN------------NEIVSISKKITMLEMKELNERQRAEHSQKMYEHLRTTLTQLEERNFELETKFAELTKINLEAQKVEQALRDDLANSVSKAVSDADRKRIMELEKTEAELKAEMSKLRNVSDIAKMQVSALASRQQSREKEVESMRKQILDYQDQSDEKALIAKLHQQIVALQISESTAVGKLEAATAKLRKMEAYNLRLEQKIDDKDQALYYARMEGRNRAKHLRQTVHSLRRQFSGALPLAQQEKFSKTMMQLQNDKLKTIHEMERVQQERREAENHSVELELKLKGLEELIST-LKDA----RGAQKVTE-WHRKIEELRLQDLKLSRELSQKKEEIKYLNNMISEQERTISILEEDLVQQGKFHEERQMSWDQREVELERQLDMYEHQQNEVLSAAQKFEEAT--------GEVPDSNLPLPEQLEIALRKIKEHVKAVVETKSVCRTLEEKLKEKDSLLRTAENNILSRDRVINELRLQLPAT---------AAKETLLSNLNQIKEDSEQHQALKVAHQTVANMQARLNQKEEMLKKYQHLLAKAREEQEEVTKKHAEDLKELHQKLNLYSDTSINNFKEAAKVSILMVFFF---KKRHANLIR--LAEMEQTVAEQENSLASLSNQLRKATSELEKQKQITIAKVNEFENSKTRLEEKHIVEIKK---LKNDAEDLRARIAETEKEINYLNTELEAQKEANTRAPTSTMKNLVERLKNQVALKEKQQQALSKALLTLRAEMTSQAEQHIIAAAAQKEENINVQQIVDKETKDLKARIEKLNEQQLKLKEALKNSKSRENALIEEAENLNQDLRGKEKALSKLQKDKDEMERDNEELK------KRIKDLTINFQGKVDLHNKHNTSEDLQRRIKKLEAELAKKSEEAERKPVRDDKS---SKEEIIRWEESKKWQIKIEGMRSKLKDKEKEVDSLTKQLTTLKDLYSKGEQEKLMLQKKLKSR---GVTVD--------------QVVGARTAESEREVEELRKKNQELENEIQHMKTKQALPRDS-VIDDLHLK-----NRFLQEKLQALERQLSQENTSRPSTSGLGSDDQTRELEKENLKLTSENVELQFHLEQANKDLPRLKDQIENLKEMCDLLKKEKIEAERK-----------VASVRGSGRSGKTVPELEKTIALMKRVVERVQKENEELKKAPGIVSNEKLTNLEMENEKLKLEIEKLQLHVGGQLSMRYEAKTKGIEKLIAENDRLRKELKTETETSEKLRIAKRNLEVIKEKLAR---DLEEARMNIAERSGPQLEGTQGKAWKSTVVSKMFENKIKELESELKKKNDGIVDLKKLLKEATERELKTEKIVGNLKNENELLKNFPEEAKTEEEFIINMVNIINSKVFSILQEEIKNLKKELQNFDPTFFEEIEDLKYNYNEEVKKNIILEEKLKALSEQFGVHIDF 2284          
BLAST of NPHP6 vs. Ensembl Xenopus
Match: CEP290 (centrosomal protein 290 [Source:HGNC Symbol;Acc:HGNC:29021])

HSP 1 Score: 789.26 bits (2037), Expect = 0.000e+0
Identity = 702/2165 (32.42%), Postives = 1228/2165 (56.72%), Query Frame = 2
Query:  689 LKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQMRRIKELRQMLDDKEKMLRETVERLNKV-ENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVLQXXXXXXXXXXXXXXXXVRMLARQAGLRAGSAGMEAGDVMDAYKALELESSMQNIEYDPVMQSMARKYESAPQGNNTWRIKEREMSSELSNAVKERAVKEDEIAKLMTRNRQLQTENDAMCDALRQIKEELVTRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDXXX---XXXXXXXXXXXXXXIGFXXXXXXXXXXXXXXXVMDPMVMMENGWNL-EERIGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEELGEA---PASEQSIKSTSNSPRKTKSKLAVDSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNTWXXXXXXXXXXXXXXXXXXXXXXXXQKIERELRDELIDSVSKEINDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAK-----FDLETEFQVANIARQTETELKDAMATKRNEKSVLESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKXXXXXXXXXXXXGTRRAGYNGQLPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQL-----SIQKQKMETTDKINQ-----SRLXXXXXXXXXXXXDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKNLR-NLSSNDAMKQELDAMKIKLRLIEEENNQLKRNPAKSANSKQDSQEKVNNWEEGKRNQRXXXXXXXXXXXXXNDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRL-MRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRLTQSGSTSVITL-----EKEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADXXXXXXXXXXQVGHKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLK-------QMARDVDKLEKQNADLESKLAISESRGRQNVSRIANKELQDENRKLSSIIANLQSQLKDKHNQNPDSSKVEELKLLYNKATER 7072
            L ++LE +  E+E++T EY  MK     +D  +     E    R+Q++ L EQ+  +N+ DD +M  VN +V++WK I+  +D EI    ++   LR  L+ + ++++K++V AL + ++ER   +K L+++L      +E N   IE LK  L          Q  + +EL  ML+  E+ ++E+ ER+ K+ E+   ++++EL +AL R + YE G +GL EAV+EIK  K Q++++++E E  ++++NK +    ++  EN  L+ +L +     +D+  ++  KA ++++ RA N VL KE+E LE+ER+ LKK++R LA++ G RA         +M  Y    + + M  + +    + ++++     Q    ++     +++EL + +KE  + ED+        + L+     +  AL+ ++++  TRN  A     ++  P L++L+ A+E+R   G FD  I+LK ++D L        +   E R   I         ++    L+    M+    G N+  + I LP+ +S +++  + +LN++++ +LQE   KEQ++ K + AL+ Y+RKFA +RH+ GLLY++Y  E++ +++E++ L+     +E  +  D  +I E+  +LD L  D  E+K+++A+  R++TVL+VNE  LTRRY+ + EMEQ +R++N KLK+++  +EA V +R+GY +R+KE A +K+  LQ+ LD+SVP  ++     +++E+T KYR+ L+K N+L+ R   +  +E E + +K       K LE  K++ + LE  LE +      PA +++ K+ +N            + ++S+SKK+  LEMK++NE++RA+H+ +MYE+++ T  + E+RN ELE K  ELT  NLE QK+E+ LRD+L +SVSK ++DA+++R++ELEK E E K E+ KL+ +++IA MQ +AL  +Q SREKE  S+R+Q+ D Q QSDEK+LI KLH+ IV LQ+SE++A+ KL+      +++EA  LR EQ  D+KDQ LY  R++GR R KHLR+T++SLR QFSG++PL++ E+F+ T+++L  DK+K   E++   + +       +E E ++  +     T LKDA    R  + V E W  K+E LRL+ LK  R+    + E+++L ++I  QE  ++ ++ED+ +  + H+++Q+ W+QRE ELER +   E+ Q EV+ AA  F++AT        G +PD + PLP QL+ A+  IK+H++ + + ++  + L +  KE ++ +R  E  +L R+R INELRL+LPA+          +   + S LN  K +    + +  A  T++ +Q RL  K+E L +Y+ LL +ARE+     +KH E++K L ++L+  +           +  M   ++         N +R  LA   +T  + +  LA + +QL      ++KQK  T  K+N+     +RL+E  I    +   LK +  +L+ ++ E E +I + N E+   K   TR+P   MKN + +L  Q+  KEKQ Q L   L  ++  +T Q+   +     +     N+Q+++DK T+DL   +E   +Q L+ +  L+++++ +  +  E + L  D   KE    KL+ DK ++E++N+EL+   +RIK+L  N      +  + +  +   R I++   +L +  ++ A  K  S+E++  WEE K+ Q   + ++ KL+DKE ++ +L+KQL T      +  +EK  ++ +L  +   G  +D               +  A  +     V++LR++N ELE EI  +  + A   DS  ++++ LK     NR LQ  ++ LER+L+Q  ++   T      ++ + ++KE ++L  +N+EL+F  E A K++PRLK+++ + K+  DLLK EK   E K           +++++  G SGK+  ELEK I  MK+VVE+ Q+ENE LK+APG++ NE++  L  EN  LKLE+  L+  VG +L+ RY+AK +G+ +++++ ++LRK+L  E E  EK RI  +       ++ARD+++  + N    S   +  ++G+   S + +K  +++       I  L+S+LK K++   D      LK L  +ATER
Sbjct:  139 LTKHLEYSVQEMEKMTDEYNKMKLMVQNSDSIMDRLRKEKEQHRLQVQELAEQLKAKNEEDDPVMRAVNAKVDEWKIILASKDEEISDYQKKIVDLREKLKIAQLDADKSSVLALQQALQERNNHIKMLTEKLEQHTQEMESNTFHIEKLKLQL----------QTEKAEELVGMLNILEERVKES-ERIAKLAESDAREKDKELVEALRRMREYEAGVYGLVEAVSEIKELKTQIKIRDQEIESLIKDLNKHHLKLNDILDENEELKQRLGLDPKTAIDLTEFKNIKALKEQQYRAENQVLLKEVECLEEERIRLKKQIRKLAQEKGKRA---------LM--YNFWHMLTHM-TLHFFFKNEHLSKQLSEKEQELERYKT----ITAELKSKLKE--ISEDK--------KHLEQIPKDIFQALKDVEKD-HTRNGEA----TIISVPSLERLIHAIESRNTEGIFDVSIHLKAQVDQLTGRNEELRQELKESRKEAINISCALEKANEKILHLENELEMLRQLEGANMIFKPINLPDGMSPTSTNLLNSLNEYILHLLQEVESKEQSVIKFEEALEEYKRKFAVIRHQHGLLYKEYMSEQESWQEELKKLKEENAKLENQKETDMVQIKEYTNLLDALKMDPDEMKKQVAENLRKMTVLRVNEKLLTRRYTTLLEMEQHLRKDNGKLKNDISDMEAAVAERLGYLQRYKEIAAFKIASLQRALDDSVPISELETANKQYNELTSKYRDMLQKDNLLVQRTADMEHLEHENASLKSQIAFYNKELEITKEKCNTLEQALEHINNLDGNPAMDKATKAITN------------NEIVSISKKITMLEMKELNERQRAEHSQKMYEHLRTTLTQLEERNFELETKFAELTKINLEAQKVEQALRDDLANSVSKAVSDADRKRIMELEKTEAELKAEMSKLRNVSDIAKMQVSALASRQQSREKEVESMRKQILDYQDQSDEKALIAKLHQQIVALQISESTAVGKLEAATAKLRKMEAYNLRLEQKIDDKDQALYYARMEGRNRAKHLRQTVHSLRRQFSGALPLAQQEKFSKTMMQLQNDKLKTIHEMERVQQERREAENHSVELELKLKGLEELIST-LKDA----RGAQKVTE-WHRKIEELRLQDLKLSRELSQKKEEIKYLNNMISEQERTISILEEDLVQQGKFHEERQMSWDQREVELERQLDMYEHQQNEVLSAAQKFEEAT--------GEVPDSNLPLPEQLEIALRKIKEHVKAVVETKSVCRTLEEKLKEKDSLLRTAENNILSRDRVINELRLQLPAT---------AAKETLLSNLNQIKEDSEQHQALKVAHQTVANMQARLNQKEEMLKKYQHLLAKAREEQEEVTKKHAEDLKELHQKLNLYSDTSINNFKEAAKEFMKKPSLQIPSSA---NLIR--LAEMEQTVAEQENSLASLSNQLRKATSELEKQKQITIAKVNEFENSKTRLEEKHIVEIKK---LKNDAEDLRARIAETEKEINYLNTELEAQKEANTRAPTSTMKNLVERLKNQVALKEKQQQALSKALLTLRAEMTSQAEQHIIAAAAQKEENINVQQIVDKETKDLKARIEKLNEQQLKLKEALKNSKSRENALIEEAENLNQDLRGKEKALSKLQKDKDEMERDNEELK---KRIKDLTINFQGKVDLHNKHNTSEDLQRRIKKLEAELAK-KSEEAERKPSSKEEIIRWEESKKWQIKIEGMRSKLKDKEKEVDSLTKQLTTLKDLYSKGEQEKLMLQKKLKSR---GVTVD--------------QVVGARTAESEREVEELRKKNQELENEIQHMKTKQALPRDS-VIDDLHLK-----NRFLQEKLQALERQLSQENTSRPSTSGLGSDDQTRELEKENLKLTSENVELQFHLEQANKDLPRLKDQIENLKEMCDLLKKEKIEAERK-----------VASVRGSGRSGKTVPELEKTIALMKRVVERVQKENEELKKAPGIVSNEKLTNLEMENEKLKLEIEKLQLHVGGQLSMRYEAKTKGIEKLIAENDRLRKELKTETETSEKLRIAKRNLEVIKEKLARDLEEA-RMNIAERSGPQLEGTQGKAWKSTVVSKMFENK-------IKELESELKKKNDGIVD------LKKLLKEATER 2166          
BLAST of NPHP6 vs. Ensembl Xenopus
Match: CEP290 (centrosomal protein 290 [Source:HGNC Symbol;Acc:HGNC:29021])

HSP 1 Score: 697.197 bits (1798), Expect = 0.000e+0
Identity = 591/1817 (32.53%), Postives = 1020/1817 (56.14%), Query Frame = 2
Query: 1988 TRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDXXX---XXXXXXXXXXXXXXIGFXXXXXXXXXXXXXXXVMDPMVMMENGWNL-EERIGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEELGEA---PASEQSIKSTSNSPRKTKSKLAVDSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNTWXXXXXXXXXXXXXXXXXXXXXXXXQKIERELRDELIDSVSKEINDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAK-----FDLETEFQVANIARQTETELKDAMATKRNEKSVLESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKXXXXXXXXXXXXGTRRAGYNGQLPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQL-----SIQKQKMETTDKINQ-----SRLXXXXXXXXXXXXDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKNLRNLSSNDAMKQEL-------DAMKIKLRLIEEE----NNQLKRNPAKSANSKQDSQEKVNNWEEGKRNQRXXXXXXXXXXXXXNDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRL-MRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRLTQSGSTSVITL-----EKEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADXXXXXXXXXXQVGHKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLK-------QMARDVDKLEKQNADLESKLAISESRGRQNVSRIANKELQDENRKLSS----------------------------IIANLQSQLK------------------------DKHNQNPDSS---KVEELKLLYNKATERVSFLEKQLQSFSEQFGVAIDL 7135
            TRN  A     ++  P L++L+ A+E+R   G FD  I+LK ++D L        +   E R   I         ++    L+    M+    G N+  + I LP+ +S +++  + +LN++++ +LQE   KEQ++ K + AL+ Y+RKFA +RH+ GLLY++Y  E++ +++E++ L+     +E  +  D  +I E+  +LD L  D  E+K+++A+  R++TVL+VNE  LTRRY+ + EMEQ +R++N KLK+++  +EA V +R+GY +R+KE A +K+  LQ+ LD+SVP  ++     +++E+T KYR+ L+K N+L+ R   +  +E E + +K       K LE  K++ + LE  LE +      PA +++ K+ +N            + ++S+SKK+  LEMK++NE++RA+H+ +MYE+++ T  + E+RN ELE K  ELT  NLE QK+E+ LRD+L +SVSK ++DA+++R++ELEK E E K E+ KL+ +++IA MQ +AL  +Q SREKE  S+R+Q+ D Q QSDEK+LI KLH+ IV LQ+SE++A+ KL+      +++EA  LR EQ  D+KDQ LY  R++GR R KHLR+T++SLR QFSG++PL++ E+F+ T+++L  DK+K   E++   + +       +E E ++  +     T LKDA    R  + V E W  K+E LRL+ LK  R+    + E+++L ++I  QE  ++ ++ED+ +  + H+++Q+ W+QRE ELER +   E+ Q EV+ AA  F++AT        G +PD + PLP QL+ A+  IK+H++ + + ++  + L +  KE ++ +R  E  +L R+R INELRL+LPA+          +   + S LN  K +    + +  A  T++ +Q RL  K+E L +Y+ LL +ARE+     +KH E++K L ++L+  +           +  M   ++         N +R  LA   +T  + +  LA + +QL      ++KQK  T  K+N+     +RL+E  I    +   LK +  +L+ ++ E E +I + N E+   K   TR+P   MKN + +L  Q+  KEKQ Q L   L  ++  +T Q+   +     +     N+Q+++DK T+DL   +E   +Q L+ +  L+++++ +  +  E + L  D   KE    KL+ DK ++E++N+EL+      K +++L+ N   K +L       + ++ +++ +E E    + + +R P +   S   S+E++  WEE K+ Q   + ++ KL+DKE ++ +L+KQL T      +  +EK  ++ +L  +   G  +D               +  A  +     V++LR++N ELE EI  +  + A   DS  ++++ LK     NR LQ  ++ LER+L+Q  ++   T      ++ + ++KE ++L  +N+EL+F  E A K++PRLK+++ + K+  DLLK EK   E K           +++++  G SGK+  ELEK I  MK+VVE+ Q+ENE LK+APG++ NE++  L  EN  LKLE+  L+  VG +L+ RY+AK +G+ +++++ ++LRK+L  E E  EK RI  +       ++ARD+++  + N    S   +  ++G+   S + +K  +++ ++L S                            I+ NL++++K                         K  QN D +   ++E+LK  YN+  ++   LE++L++ SEQFGV ID 
Sbjct:  369 TRNGEA----TIISVPSLERLIHAIESRNTEGIFDVSIHLKAQVDQLTGRNEELRQELKESRKEAINISCALEKANEKILHLENELEMLRQLEGANMIFKPINLPDGMSPTSTNLLNSLNEYILHLLQEVESKEQSVIKFEEALEEYKRKFAVIRHQHGLLYKEYMSEQESWQEELKKLKEENAKLENQKETDMVQIKEYTNLLDALKMDPDEMKKQVAENLRKMTVLRVNEKLLTRRYTTLLEMEQHLRKDNGKLKNDISDMEAAVAERLGYLQRYKEIAAFKIASLQRALDDSVPISELETANKQYNELTSKYRDMLQKDNLLVQRTADMEHLEHENASLKSQIAFYNKELEITKEKCNTLEQALEHINNLDGNPAMDKATKAITN------------NEIVSISKKITMLEMKELNERQRAEHSQKMYEHLRTTLTQLEERNFELETKFAELTKINLEAQKVEQALRDDLANSVSKAVSDADRKRIMELEKTEAELKAEMSKLRNVSDIAKMQVSALASRQQSREKEVESMRKQILDYQDQSDEKALIAKLHQQIVALQISESTAVGKLEAATAKLRKMEAYNLRLEQKIDDKDQALYYARMEGRNRAKHLRQTVHSLRRQFSGALPLAQQEKFSKTMMQLQNDKLKTIHEMERVQQERREAENHSVELELKLKGLEELIST-LKDA----RGAQKVTE-WHRKIEELRLQDLKLSRELSQKKEEIKYLNNMISEQERTISILEEDLVQQGKFHEERQMSWDQREVELERQLDMYEHQQNEVLSAAQKFEEAT--------GEVPDSNLPLPEQLEIALRKIKEHVKAVVETKSVCRTLEEKLKEKDSLLRTAENNILSRDRVINELRLQLPAT---------AAKETLLSNLNQIKEDSEQHQALKVAHQTVANMQARLNQKEEMLKKYQHLLAKAREEQEEVTKKHAEDLKELHQKLNLYSDTSINNFKEAAKEFMKKPSLQIPSSA---NLIR--LAEMEQTVAEQENSLASLSNQLRKATSELEKQKQITIAKVNEFENSKTRLEEKHIVEIKK---LKNDAEDLRARIAETEKEINYLNTELEAQKEANTRAPTSTMKNLVERLKNQVALKEKQQQALSKALLTLRAEMTSQAEQHIIAAAAQKEENINVQQIVDKETKDLKARIEKLNEQQLKLKEALKNSKSRENALIEEAENLNQDLRGKEKALSKLQKDKDEMERDNEELK------KRIKDLTINFQGKVDLHNKHNTSEDLQRRIKKLEAELAKKSEEAERKPVRDDKS---SKEEIIRWEESKKWQIKIEGMRSKLKDKEKEVDSLTKQLTTLKDLYSKGEQEKLMLQKKLKSR---GVTVD--------------QVVGARTAESEREVEELRKKNQELENEIQHMKTKQALPRDS-VIDDLHLK-----NRFLQEKLQALERQLSQENTSRPSTSGLGSDDQTRELEKENLKLTSENVELQFHLEQANKDLPRLKDQIENLKEMCDLLKKEKIEAERK-----------VASVRGSGRSGKTVPELEKTIALMKRVVERVQKENEELKKAPGIVSNEKLTNLEMENEKLKLEIEKLQLHVGGQLSMRYEAKTKGIEKLIAENDRLRKELKTETETSEKLRIAKRNLEVIKEKLARDLEEA-RMNIAERSGPQLEGTQGKAWKSTVVSKMFENKIKELESELKKKNDGIVDLKKLLKEATERELKTEKIVGNLKNEVKFIINMVNIINSKVFSILQEEIKNLKKELQNFDPTFFEEIEDLKYNYNEEVKKNIILEEKLKALSEQFGVHIDF 2094          

HSP 2 Score: 130.954 bits (328), Expect = 2.024e-29
Identity = 97/303 (32.01%), Postives = 182/303 (60.07%), Query Frame = 2
Query:  689 LKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGH-QMRRIKELRQMLDDKEKMLRETVERLNKV-ENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVL 1591
            L ++LE +  E+E++T EY  MK     +D  +     E    R+Q++ L EQ+  +N+ DD +M  VN +V++WK ++  +D EI    ++   LR  L+ + ++++K++V AL + ++ER   +K L+++L      +E N   IE LK  L+ T  G SGH ++++ +EL  ML+  E+ ++E+ ER+ K+ E+   ++++EL +AL R + YE G +GL EAV+EIK  K Q++++++E E  ++++NK +    ++  EN  L+ +L +     +D+  ++  KA ++++ RA N VL
Sbjct:   33 LTKHLEYSVQEMEKMTDEYNKMKLMVQNSDSIMDRLRKEKEQHRLQVQELAEQLKAKNEEDDPVMRAVNAKVDEWK-VLTSKDEEISDYQKKIVDLREKLKIAQLDADKSSVLALQQALQERNNHIKMLTEKLEQHTQEMESNTFHIEKLKLQLQ-TEKGVSGHIEIKQAEELVGMLNILEERVKES-ERIAKLAESDAREKDKELVEALRRMREYEAGVYGLVEAVSEIKELKTQIKIRDQEIESLIKDLNKHHLKLNDILDENEELKQRLGLDPKTAIDLTEFKNIKALKEQQYRAENQVL 332          
BLAST of NPHP6 vs. Ensembl Xenopus
Match: CEP290 (centrosomal protein 290 [Source:HGNC Symbol;Acc:HGNC:29021])

HSP 1 Score: 688.337 bits (1775), Expect = 0.000e+0
Identity = 579/1731 (33.45%), Postives = 991/1731 (57.25%), Query Frame = 2
Query: 1988 TRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDXXX---XXXXXXXXXXXXXXIGFXXXXXXXXXXXXXXXVMDPMVMMENGWNL-EERIGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEELGEA---PASEQSIKSTSNSPRKTKSKLAVDSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNTWXXXXXXXXXXXXXXXXXXXXXXXXQKIERELRDELIDSVSKEINDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAK-----FDLETEFQVANIARQTETELKDAMATKRNEKSVLESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKXXXXXXXXXXXXGTRRAGYNGQLPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQL-----SIQKQKMETTDKINQ-----SRLXXXXXXXXXXXXDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKNLR-NLSSNDAMKQELDAMKIKLRLIEEENNQLKRNPAKSANSKQDSQEKVNNWEEGKRNQRXXXXXXXXXXXXXNDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRL-MRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRLTQSGSTSVITL-----EKEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADXXXXXXXXXXQVGHKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLK-------QMARDVDKLEKQNADLESKLAISESRGRQNVSRIANKELQDENRKLSSIIANLQSQLKDKHNQNPDSSKVEELKLLYNKATER 7072
            TRN  A     ++  P L++L+ A+E+R   G FD  I+LK ++D L        +   E R   I         ++    L+    M+    G N+  + I LP+ +S +++  + +LN++++ +LQE   KEQ++ K + AL+ Y+RKFA +RH+ GLLY++Y  E++ +++E++ L+     +E  +  D  +I E+  +LD L  D  E+K+++A+  R++TVL+VNE  LTRRY+ + EMEQ +R++N KLK+++  +EA V +R+GY +R+KE A +K+  LQ+ LD+SVP  ++     +++E+T KYR+ L+K N+L+ R   +  +E E + +K       K LE  K++ + LE  LE +      PA +++ K+ +N            + ++S+SKK+  LEMK++NE++RA+H+ +MYE+++ T  + E+RN ELE K  ELT  NLE QK+E+ LRD+L +SVSK ++DA+++R++ELEK E E K E+ KL+ +++IA MQ +AL  +Q SREKE  S+R+Q+ D Q QSDEK+LI KLH+ IV LQ+SE++A+ KL+      +++EA  LR EQ  D+KDQ LY  R++GR R KHLR+T++SLR QFSG++PL++ E+F+ T+++L  DK+K   E++   + +       +E E ++  +     T LKDA    R  + V E W  K+E LRL+ LK  R+    + E+++L ++I  QE  ++ ++ED+ +  + H+++Q+ W+QRE ELER +   E+ Q EV+ AA  F++AT        G +PD + PLP QL+ A+  IK+H++ + + ++  + L +  KE ++ +R  E  +L R+R INELRL+LPA+          +   + S LN  K +    + +  A  T++ +Q RL  K+E L +Y+ LL +ARE+     +KH E++K L ++L+  +           +  M   ++         N +R  LA   +T  + +  LA + +QL      ++KQK  T  K+N+     +RL+E  I    +   LK +  +L+ ++ E E +I + N E+   K   TR+P   MKN + +L  Q+  KEKQ Q L   L  ++  +T Q+   +     +     N+Q+++DK T+DL   +E   +Q L+ +  L+++++ +  +  E + L  D   KE    KL+ DK ++E++N+EL+   +RIK+L  N      +  + +  +   R I++   +L +  ++ A  K  S+E++  WEE K+ Q   + ++ KL+DKE ++ +L+KQL T      +  +EK  ++ +L  +   G  +D               +  A  +     V++LR++N ELE EI  +  + A   DS  ++++ LK     NR LQ  ++ LER+L+Q  ++   T      ++ + ++KE ++L  +N+EL+F  E A K++PRLK+++ + K+  DLLK EK   E K           +++++  G SGK+  ELEK I  MK+VVE+ Q+ENE LK+APG++ NE++  L  EN  LKLE+  L+  VG +L+ RY+AK +G+ +++++ ++LRK+L  E E  EK RI  +       ++ARD+++  + N    S   +  ++G+   S + +K  +++       I  L+S+LK K++   D      LK L  +ATER
Sbjct:  503 TRNGEA----TIISVPSLERLIHAIESRNTEGIFDVSIHLKAQVDQLTGRNEELRQELKESRKEAINISCALEKANEKILHLENELEMLRQLEGANMIFKPINLPDGMSPTSTNLLNSLNEYILHLLQEVESKEQSVIKFEEALEEYKRKFAVIRHQHGLLYKEYMSEQESWQEELKKLKEENAKLENQKETDMVQIKEYTNLLDALKMDPDEMKKQVAENLRKMTVLRVNEKLLTRRYTTLLEMEQHLRKDNGKLKNDISDMEAAVAERLGYLQRYKEIAAFKIASLQRALDDSVPISELETANKQYNELTSKYRDMLQKDNLLVQRTADMEHLEHENASLKSQIAFYNKELEITKEKCNTLEQALEHINNLDGNPAMDKATKAITN------------NEIVSISKKITMLEMKELNERQRAEHSQKMYEHLRTTLTQLEERNFELETKFAELTKINLEAQKVEQALRDDLANSVSKAVSDADRKRIMELEKTEAELKAEMSKLRNVSDIAKMQVSALASRQQSREKEVESMRKQILDYQDQSDEKALIAKLHQQIVALQISESTAVGKLEAATAKLRKMEAYNLRLEQKIDDKDQALYYARMEGRNRAKHLRQTVHSLRRQFSGALPLAQQEKFSKTMMQLQNDKLKTIHEMERVQQERREAENHSVELELKLKGLEELIST-LKDA----RGAQKVTE-WHRKIEELRLQDLKLSRELSQKKEEIKYLNNMISEQERTISILEEDLVQQGKFHEERQMSWDQREVELERQLDMYEHQQNEVLSAAQKFEEAT--------GEVPDSNLPLPEQLEIALRKIKEHVKAVVETKSVCRTLEEKLKEKDSLLRTAENNILSRDRVINELRLQLPAT---------AAKETLLSNLNQIKEDSEQHQALKVAHQTVANMQARLNQKEEMLKKYQHLLAKAREEQEEVTKKHAEDLKELHQKLNLYSDTSINNFKEAAKEFMKKPSLQIPSSA---NLIR--LAEMEQTVAEQENSLASLSNQLRKATSELEKQKQITIAKVNEFENSKTRLEEKHIVEIKK---LKNDAEDLRARIAETEKEINYLNTELEAQKEANTRAPTSTMKNLVERLKNQVALKEKQQQALSKALLTLRAEMTSQAEQHIIAAAAQKEENINVQQIVDKETKDLKARIEKLNEQQLKLKEALKNSKSRENALIEEAENLNQDLRGKEKALSKLQKDKDEMERDNEELK---KRIKDLTINFQGKVDLHNKHNTSEDLQRRIKKLEAELAK-KSEEAERKPSSKEEIIRWEESKKWQIKIEGMRSKLKDKEKEVDSLTKQLTTLKDLYSKGEQEKLMLQKKLKSR---GVTVD--------------QVVGARTAESEREVEELRKKNQELENEIQHMKTKQALPRDS-VIDDLHLK-----NRFLQEKLQALERQLSQENTSRPSTSGLGSDDQTRELEKENLKLTSENVELQFHLEQANKDLPRLKDQIENLKEMCDLLKKEKIEAERK-----------VASVRGSGRSGKTVPELEKTIALMKRVVERVQKENEELKKAPGIVSNEKLTNLEMENEKLKLEIEKLQLHVGGQLSMRYEAKTKGIEKLIAENDRLRKELKTETETSEKLRIAKRNLEVIKEKLARDLEEA-RMNIAERSGPQLEGTQGKAWKSTVVSKMFENK-------IKELESELKKKNDGIVD------LKKLLKEATER 2134          

HSP 2 Score: 139.043 bits (349), Expect = 8.848e-32
Identity = 114/334 (34.13%), Postives = 205/334 (61.38%), Query Frame = 2
Query:  689 LKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGH-QMRRIKELRQMLDDKEKMLRETVERLNKV-ENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVLQXXXXXXXXXXXXXXXXVRMLARQAGLRAGS 1684
            L ++LE +  E+E++T EY  MK     +D  +     E    R+Q++ L EQ+  +N+ DD +M  VN +V++WK I+  +D EI    ++   LR  L+ + ++++K++V AL + ++ER   +K L+++L      +E N   IE LK  L+ T  G SGH ++++ +EL  ML+  E+ ++E+ ER+ K+ E+   ++++EL +AL R + YE G +GL EAV+EIK  K Q++++++E E  ++++NK +    ++  EN  L+ +L +     +D+  ++  KA ++++ RA N VL KE+E LE+ER+ LKK++R LA++ G RA  
Sbjct:  141 LTKHLEYSVQEMEKMTDEYNKMKLMVQNSDSIMDRLRKEKEQHRLQVQELAEQLKAKNEEDDPVMRAVNAKVDEWKIILASKDEEISDYQKKIVDLREKLKIAQLDADKSSVLALQQALQERNNHIKMLTEKLEQHTQEMESNTFHIEKLKLQLQ-TEKGVSGHIEIKQAEELVGMLNILEERVKES-ERIAKLAESDAREKDKELVEALRRMREYEAGVYGLVEAVSEIKELKTQIKIRDQEIESLIKDLNKHHLKLNDILDENEELKQRLGLDPKTAIDLTEFKNIKALKEQQYRAENQVLLKEVECLEEERIRLKKQIRKLAQEKGKRAAC 472          
BLAST of NPHP6 vs. Ensembl Mouse
Match: Cep290 (centrosomal protein 290 [Source:MGI Symbol;Acc:MGI:2384917])

HSP 1 Score: 800.045 bits (2065), Expect = 0.000e+0
Identity = 688/2120 (32.45%), Postives = 1199/2120 (56.56%), Query Frame = 2
Query:  638 LDNAQEKILELHQEMDHLKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQ---MRRIKELRQMLDDKEKMLRETVERLNKV-ENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVLQXXXXXXXXXXXXXXXXVRMLARQAGLRAGSAGMEAGDVMDAYKALELESSMQNIEYDPVMQSMARKYESAPQGN-NTWRIKEREMSSELSNAVKERAVKEDEIAKLMTRNRQLQTENDAMCDALRQIKEEL--VTRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDXXX---XXXXXXXXXXXXXXIGFXXXXXXXXXXXXXXXVMDPMVMMENGWNLEER-IGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEELGEAPASEQSIKSTSNSPRKTKSKLAVDSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNTWXXXXXXXXXXXXXXXXXXXXXXXXQKIERELRDELIDSVSKEINDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAKFDLETEFQVANIARQTETELKDAMATKRNEKSVLESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKXXXXXXXXXXXXGTRRAGYNGQ--LPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQLSIQKQKMETTDKINQSRLXXXXXXXXXXXXDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKN-LRNLSSNDAMKQELDAMKIKLRLIEEENNQLKR-------NPAKSANSKQDSQEKVNNWEEGKRNQRXXXXXXXXXXXXXNDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRLMRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRLTQSGSTSVITLE--------KEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADXXXXXXXXXXQVGHKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLKQMARDVDKLEKQNADLESKLAISESRGRQ 6910
            L  A EKI   +QEM   ++NLE +  E+E++T EY  MK+    +D  +   + E    R+Q+  L + +  +++ DD +M+ VN +VE+WK I+  +D EI    +    LR  L+ + ++++K+N+ AL + ++ER+ ++K L++Q+      +E+N  +IE+LK +L++  G S+ +Q     +I    Q+L++K K      ER+ ++ E    ++++EL +AL+R K YE G +GL +AV EIK CKAQ+++++ E E   + +NK      ++  EN  LR +  +     +D+  +R  K  + ++ RA N VL KEIE LE+ERL LK+K+R +A++ G R  ++G+     +D     E  S    IE         RK       N N  + K   +S EL+   K+       IAK  ++ ++L  EN  + + +++I + +  + ++     G   L  P L++L+ AME++   G FD  ++LK ++D L        +   + R   + + Q  +  +     L+    ++    G N+  + I LP+ ++ S++  I + N++LI +LQE   KE+ L   + +L++Y RKFA +RH+Q LLY++Y  EK  ++ + E ++   + +E    +D  ++ E++ +L  L  D +E+K+ L++  R+ITVL+VNE +L R+Y+ + EME+ +R+EN K ++++I +EA VT+++G  +RFKE A +K+  LQK +D SV   ++     +++E+T KYR+ L+K N+L+ R  ++  +E E + +K   EA+ K LE  K++ H +E   E+       E  + + SN  +  KS    +S ++S+SKK+  LEMK++NE++RA+H  +MYE+++ +  + E+RN ELE K TELT  NL+ QK+E+ LRDEL DSV+K ++DA+++R+LELEK E+E K E+ KL+EI++IA  Q + L  QQ SREKE  SLR QL D Q QSDEK+LI KLH+H+V LQ+SE +AL KL+ +    +++EA  LR EQ  DEK+Q LY  RL+GR R KHLR+TI SLR QFSG++PL++ E+F+ T+I+L  DK+K+ QE++ + +   ++E +     +  +   EL   +   R  + V+ +W  K+E LRL+ LK  R+    + E+++L ++I   E  +  ++E+I + ++ H+++Q+ W+QRE ELER +   ++ Q E++ AA  F+ +T        G++PDPS PLPNQL+ A+  IK++I+VI   +   K+L +  KE E+ +R  E  +L R++ INELRLRLPA+ DR + + ++    +       KS++    TM  A  T++ +Q RL  K+E L +Y+ LL++ARE+     +KH E++ +L  +L  +A     +     Q  L  +   V T+  +    E+   +A Q  +   L  +L  +   L  QK+  E   +  ++     +    +E+  +K  + +L+  L +     +    E+   K   +R+P   M+N + +L  QL  KEKQ + L   L +++  +T  + + +    ++     N+Q+V+++HTR+L +++E   + +L+ +  L++++  +  +  +L+ L  +   K+    K+  +K  ++QENDELR Q++R+ + L++ +  D  +  +D ++ K++ +E   +QL+R        P K  +SK    E++  WEEGK+ Q   + L+ +L++KE +   L+KQL+T  +   +  +EK  ++ +L      G  +D    +  + A   +           D  +D+              MR   +    +V    +++  ++N+ LQ  +  LE++L++   +  +T E        KE+ +QKE ++L+ +N+ELKF+ E A K++PRLK +V D K+  + LK  K  LE K           +  ++  G SGK+  ELEK IG MKKVVEK QRENE+LK+A G++ +E++  +  EN +LK EL  LK   G +L+ ++++K +G  ++V++ E+LRK+L +E E  EK RI    +    DK+  Q  +   +L  +ESR  Q
Sbjct:  218 LTEANEKIEVQNQEM---RKNLEESVQEMEKMTDEYNRMKALVHQSDAVMDQIKKENEHYRLQVRELTDLLKAKDEEDDPVMMAVNAKVEEWKLILSSKDDEIIEYQQMLQSLRGKLKNAQLDADKSNIMALKQGIQERDSQIKMLTEQVEQYTKEMEKNTFIIEDLKNELQKDKGTSNFYQQTHYMKIHSKVQILEEKTK----EAERIAELAEADAREKDKELVEALKRLKDYESGVYGLEDAVIEIKNCKAQIKIRDGEMEVLTKEINKLEMKINDILDENEALRERAGLEPKTMIDLTEFRNSKRLKQQQYRAENQVLLKEIESLEEERLDLKRKIRQMAQERGKRNAASGL----TIDDLNLSETFSHENKIE--------GRKLNFMSLNNMNETQSKNEFLSRELAEKEKDLERSRTVIAKFQSKLKELVEENKQLEEGMKEILQAIKDMPKDSDVKGGETSLIIPSLERLVNAMESKNAEGIFDASLHLKAQVDQLTGRNEELRQELRQSRKEAVNYSQQLVKANLKIDHLEKETDLLRQSAGSNVVYKGIDLPDGIAPSSAYIINSQNEYLIHLLQELDNKEKKLKHLEDSLEDYNRKFAVIRHQQSLLYKEYLSEKDIWKTDSEMIREEKRKLEDQAEQDAVKVKEYNNLLSALQMDSNEMKKMLSENSRKITVLQVNEKSLIRQYTTLVEMERHLRKENGKHRNDVIAMEAEVTEKLGSLQRFKEMAIFKIAALQKVIDNSVSLSELELANKQYNELTTKYRDILQKDNMLVQRTSNLEHLECENASLKEQMEAISKELEITKEKLHTIEQAWEQ-------ETKLGNDSNMDKAKKS--MTNSDIVSISKKITVLEMKELNERQRAEHCQKMYEHLRTSLKQMEERNFELETKFTELTKINLDAQKVEQMLRDELADSVTKAVSDADRQRILELEKSEVELKVEVSKLREISDIAKRQVDFLNSQQQSREKEVESLRTQLLDFQAQSDEKALIAKLHQHVVSLQISEATALGKLESVTSKLQKMEAYNLRLEQKLDEKEQALYYARLEGRNRAKHLRQTIQSLRRQFSGALPLAQQEKFSKTMIQLQNDKLKIMQEMKNSQQEHRNMENKTLELELKLKGLEELISTLKDARGAQKVI-NWHVKIEELRLQELKLNRELVKGKEEIKYLNNIISEYEHTINSLEEEIVQQSKFHEERQMAWDQREVELERQLDIFDHQQNEILSAAQKFEDST--------GSMPDPSLPLPNQLEIALRKIKENIQVILKTQATCKSLEEKLKEKESALRLAEQNILSRDKVINELRLRLPATADREKLIAELERKELEP-----KSHH----TMKIAHQTIANMQARLNHKEEVLKKYQHLLEKAREEQREIVKKHEEDLHVLHHKLEQQADNSLNKFRQTAQDLLKQSPAPVPTNKHFIRLAEMEQTVAEQDDSLSSLLTKLKKVSKDLEKQKEITELKVREFENTKLRLQETHASEVKKVKAEVEDLRHALAQAHKDSQSLKSELQAQKEANSRAPTTTMRNLVDRLKSQLALKEKQQKALSRALLELRSEMTAAAEERIIAVTSQKEANLNVQQVVERHTRELKSQIEDLNENLLKLKEALKTSKNKENSLADDLNELNNELQKKQKAYNKILREKDGIDQENDELRRQIKRLSSGLQSKTLIDNKQSLIDELQKKVKKLE---SQLERKVDDVDIKPVKEKSSK----EELIRWEEGKKWQTKVEGLRNRLKEKEGEAHGLAKQLNTLKELFAKADKEKLTLQKKLK---TTGMTVD---QVLGVRALESEKELEELKKKNLDLENDI------------LYMRTQQALPRDSV----VEDLHLQNKYLQEKLHTLEKKLSKEKYSQSLTSEIESDDHCQKEQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVKDLKEMCEFLKKGKLELERK-----------LGQVRGAGRSGKTIPELEKTIGLMKKVVEKVQRENEQLKKASGILTSEKMATIEEENRNLKAELEKLKAHFGRQLSMQFESKNKGTEKIVAENERLRKELKKEIEASEKLRIAKNNLELVNDKMAAQLEETGKRLQFAESRAPQ 2251          
BLAST of NPHP6 vs. Ensembl Mouse
Match: Cep290 (centrosomal protein 290 [Source:MGI Symbol;Acc:MGI:2384917])

HSP 1 Score: 799.275 bits (2063), Expect = 0.000e+0
Identity = 688/2120 (32.45%), Postives = 1199/2120 (56.56%), Query Frame = 2
Query:  638 LDNAQEKILELHQEMDHLKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQ---MRRIKELRQMLDDKEKMLRETVERLNKV-ENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVLQXXXXXXXXXXXXXXXXVRMLARQAGLRAGSAGMEAGDVMDAYKALELESSMQNIEYDPVMQSMARKYESAPQGN-NTWRIKEREMSSELSNAVKERAVKEDEIAKLMTRNRQLQTENDAMCDALRQIKEEL--VTRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDXXX---XXXXXXXXXXXXXXIGFXXXXXXXXXXXXXXXVMDPMVMMENGWNLEER-IGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEELGEAPASEQSIKSTSNSPRKTKSKLAVDSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNTWXXXXXXXXXXXXXXXXXXXXXXXXQKIERELRDELIDSVSKEINDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAKFDLETEFQVANIARQTETELKDAMATKRNEKSVLESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKXXXXXXXXXXXXGTRRAGYNGQ--LPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQLSIQKQKMETTDKINQSRLXXXXXXXXXXXXDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKN-LRNLSSNDAMKQELDAMKIKLRLIEEENNQLKR-------NPAKSANSKQDSQEKVNNWEEGKRNQRXXXXXXXXXXXXXNDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRLMRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRLTQSGSTSVITLE--------KEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADXXXXXXXXXXQVGHKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLKQMARDVDKLEKQNADLESKLAISESRGRQ 6910
            L  A EKI   +QEM   ++NLE +  E+E++T EY  MK+    +D  +   + E    R+Q+  L + +  +++ DD +M+ VN +VE+WK I+  +D EI    +    LR  L+ + ++++K+N+ AL + ++ER+ ++K L++Q+      +E+N  +IE+LK +L++  G S+ +Q     +I    Q+L++K K      ER+ ++ E    ++++EL +AL+R K YE G +GL +AV EIK CKAQ+++++ E E   + +NK      ++  EN  LR +  +     +D+  +R  K  + ++ RA N VL KEIE LE+ERL LK+K+R +A++ G R  ++G+     +D     E  S    IE         RK       N N  + K   +S EL+   K+       IAK  ++ ++L  EN  + + +++I + +  + ++     G   L  P L++L+ AME++   G FD  ++LK ++D L        +   + R   + + Q  +  +     L+    ++    G N+  + I LP+ ++ S++  I + N++LI +LQE   KE+ L   + +L++Y RKFA +RH+Q LLY++Y  EK  ++ + E ++   + +E    +D  ++ E++ +L  L  D +E+K+ L++  R+ITVL+VNE +L R+Y+ + EME+ +R+EN K ++++I +EA VT+++G  +RFKE A +K+  LQK +D SV   ++     +++E+T KYR+ L+K N+L+ R  ++  +E E + +K   EA+ K LE  K++ H +E   E+       E  + + SN  +  KS    +S ++S+SKK+  LEMK++NE++RA+H  +MYE+++ +  + E+RN ELE K TELT  NL+ QK+E+ LRDEL DSV+K ++DA+++R+LELEK E+E K E+ KL+EI++IA  Q + L  QQ SREKE  SLR QL D Q QSDEK+LI KLH+H+V LQ+SE +AL KL+ +    +++EA  LR EQ  DEK+Q LY  RL+GR R KHLR+TI SLR QFSG++PL++ E+F+ T+I+L  DK+K+ QE++ + +   ++E +     +  +   EL   +   R  + V+ +W  K+E LRL+ LK  R+    + E+++L ++I   E  +  ++E+I + ++ H+++Q+ W+QRE ELER +   ++ Q E++ AA  F+ +T        G++PDPS PLPNQL+ A+  IK++I+VI   +   K+L +  KE E+ +R  E  +L R++ INELRLRLPA+ DR + + ++    +       KS++    TM  A  T++ +Q RL  K+E L +Y+ LL++ARE+     +KH E++ +L  +L  +A     +     Q  L  +   V T+  +    E+   +A Q  +   L  +L  +   L  QK+  E   +  ++     +    +E+  +K  + +L+  L +     +    E+   K   +R+P   M+N + +L  QL  KEKQ + L   L +++  +T  + + +    ++     N+Q+V+++HTR+L +++E   + +L+ +  L++++  +  +  +L+ L  +   K+    K+  +K  ++QENDELR Q++R+ + L++ +  D  +  +D ++ K++ +E   +QL+R        P K  +SK    E++  WEEGK+ Q   + L+ +L++KE +   L+KQL+T  +   +  +EK  ++ +L      G  +D    +  + A   +           D  +D+              MR   +    +V    +++  ++N+ LQ  +  LE++L++   +  +T E        KE+ +QKE ++L+ +N+ELKF+ E A K++PRLK +V D K+  + LK  K  LE K           +  ++  G SGK+  ELEK IG MKKVVEK QRENE+LK+A G++ +E++  +  EN +LK EL  LK   G +L+ ++++K +G  ++V++ E+LRK+L +E E  EK RI    +    DK+  Q  +   +L  +ESR  Q
Sbjct:  225 LTEANEKIEVQNQEM---RKNLEESVQEMEKMTDEYNRMKALVHQSDAVMDQIKKENEHYRLQVRELTDLLKAKDEEDDPVMMAVNAKVEEWKLILSSKDDEIIEYQQMLQSLRGKLKNAQLDADKSNIMALKQGIQERDSQIKMLTEQVEQYTKEMEKNTFIIEDLKNELQKDKGTSNFYQQTHYMKIHSKVQILEEKTK----EAERIAELAEADAREKDKELVEALKRLKDYESGVYGLEDAVIEIKNCKAQIKIRDGEMEVLTKEINKLEMKINDILDENEALRERAGLEPKTMIDLTEFRNSKRLKQQQYRAENQVLLKEIESLEEERLDLKRKIRQMAQERGKRNAASGL----TIDDLNLSETFSHENKIE--------GRKLNFMSLNNMNETQSKNEFLSRELAEKEKDLERSRTVIAKFQSKLKELVEENKQLEEGMKEILQAIKDMPKDSDVKGGETSLIIPSLERLVNAMESKNAEGIFDASLHLKAQVDQLTGRNEELRQELRQSRKEAVNYSQQLVKANLKIDHLEKETDLLRQSAGSNVVYKGIDLPDGIAPSSAYIINSQNEYLIHLLQELDNKEKKLKHLEDSLEDYNRKFAVIRHQQSLLYKEYLSEKDIWKTDSEMIREEKRKLEDQAEQDAVKVKEYNNLLSALQMDSNEMKKMLSENSRKITVLQVNEKSLIRQYTTLVEMERHLRKENGKHRNDVIAMEAEVTEKLGSLQRFKEMAIFKIAALQKVIDNSVSLSELELANKQYNELTTKYRDILQKDNMLVQRTSNLEHLECENASLKEQMEAISKELEITKEKLHTIEQAWEQ-------ETKLGNDSNMDKAKKS--MTNSDIVSISKKITVLEMKELNERQRAEHCQKMYEHLRTSLKQMEERNFELETKFTELTKINLDAQKVEQMLRDELADSVTKAVSDADRQRILELEKSEVELKVEVSKLREISDIAKRQVDFLNSQQQSREKEVESLRTQLLDFQAQSDEKALIAKLHQHVVSLQISEATALGKLESVTSKLQKMEAYNLRLEQKLDEKEQALYYARLEGRNRAKHLRQTIQSLRRQFSGALPLAQQEKFSKTMIQLQNDKLKIMQEMKNSQQEHRNMENKTLELELKLKGLEELISTLKDARGAQKVI-NWHVKIEELRLQELKLNRELVKGKEEIKYLNNIISEYEHTINSLEEEIVQQSKFHEERQMAWDQREVELERQLDIFDHQQNEILSAAQKFEDST--------GSMPDPSLPLPNQLEIALRKIKENIQVILKTQATCKSLEEKLKEKESALRLAEQNILSRDKVINELRLRLPATADREKLIAELERKELEP-----KSHH----TMKIAHQTIANMQARLNHKEEVLKKYQHLLEKAREEQREIVKKHEEDLHVLHHKLEQQADNSLNKFRQTAQDLLKQSPAPVPTNKHFIRLAEMEQTVAEQDDSLSSLLTKLKKVSKDLEKQKEITELKVREFENTKLRLQETHASEVKKVKAEVEDLRHALAQAHKDSQSLKSELQAQKEANSRAPTTTMRNLVDRLKSQLALKEKQQKALSRALLELRSEMTAAAEERIIAVTSQKEANLNVQQVVERHTRELKSQIEDLNENLLKLKEALKTSKNKENSLADDLNELNNELQKKQKAYNKILREKDGIDQENDELRRQIKRLSSGLQSKTLIDNKQSLIDELQKKVKKLE---SQLERKVDDVDIKPVKEKSSK----EELIRWEEGKKWQTKVEGLRNRLKEKEGEAHGLAKQLNTLKELFAKADKEKLTLQKKLK---TTGMTVD---QVLGVRALESEKELEELKKKNLDLENDI------------LYMRTQQALPRDSV----VEDLHLQNKYLQEKLHTLEKKLSKEKYSQSLTSEIESDDHCQKEQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVKDLKEMCEFLKKGKLELERK-----------LGQVRGAGRSGKTIPELEKTIGLMKKVVEKVQRENEQLKKASGILTSEKMATIEEENRNLKAELEKLKAHFGRQLSMQFESKNKGTEKIVAENERLRKELKKEIEASEKLRIAKNNLELVNDKMAAQLEETGKRLQFAESRAPQ 2258          
BLAST of NPHP6 vs. Ensembl Mouse
Match: Cep290 (centrosomal protein 290 [Source:MGI Symbol;Acc:MGI:2384917])

HSP 1 Score: 799.275 bits (2063), Expect = 0.000e+0
Identity = 688/2120 (32.45%), Postives = 1199/2120 (56.56%), Query Frame = 2
Query:  638 LDNAQEKILELHQEMDHLKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQ---MRRIKELRQMLDDKEKMLRETVERLNKV-ENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVLQXXXXXXXXXXXXXXXXVRMLARQAGLRAGSAGMEAGDVMDAYKALELESSMQNIEYDPVMQSMARKYESAPQGN-NTWRIKEREMSSELSNAVKERAVKEDEIAKLMTRNRQLQTENDAMCDALRQIKEEL--VTRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDXXX---XXXXXXXXXXXXXXIGFXXXXXXXXXXXXXXXVMDPMVMMENGWNLEER-IGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEELGEAPASEQSIKSTSNSPRKTKSKLAVDSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNTWXXXXXXXXXXXXXXXXXXXXXXXXQKIERELRDELIDSVSKEINDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAKFDLETEFQVANIARQTETELKDAMATKRNEKSVLESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKXXXXXXXXXXXXGTRRAGYNGQ--LPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQLSIQKQKMETTDKINQSRLXXXXXXXXXXXXDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKN-LRNLSSNDAMKQELDAMKIKLRLIEEENNQLKR-------NPAKSANSKQDSQEKVNNWEEGKRNQRXXXXXXXXXXXXXNDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRLMRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRLTQSGSTSVITLE--------KEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADXXXXXXXXXXQVGHKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLKQMARDVDKLEKQNADLESKLAISESRGRQ 6910
            L  A EKI   +QEM   ++NLE +  E+E++T EY  MK+    +D  +   + E    R+Q+  L + +  +++ DD +M+ VN +VE+WK I+  +D EI    +    LR  L+ + ++++K+N+ AL + ++ER+ ++K L++Q+      +E+N  +IE+LK +L++  G S+ +Q     +I    Q+L++K K      ER+ ++ E    ++++EL +AL+R K YE G +GL +AV EIK CKAQ+++++ E E   + +NK      ++  EN  LR +  +     +D+  +R  K  + ++ RA N VL KEIE LE+ERL LK+K+R +A++ G R  ++G+     +D     E  S    IE         RK       N N  + K   +S EL+   K+       IAK  ++ ++L  EN  + + +++I + +  + ++     G   L  P L++L+ AME++   G FD  ++LK ++D L        +   + R   + + Q  +  +     L+    ++    G N+  + I LP+ ++ S++  I + N++LI +LQE   KE+ L   + +L++Y RKFA +RH+Q LLY++Y  EK  ++ + E ++   + +E    +D  ++ E++ +L  L  D +E+K+ L++  R+ITVL+VNE +L R+Y+ + EME+ +R+EN K ++++I +EA VT+++G  +RFKE A +K+  LQK +D SV   ++     +++E+T KYR+ L+K N+L+ R  ++  +E E + +K   EA+ K LE  K++ H +E   E+       E  + + SN  +  KS    +S ++S+SKK+  LEMK++NE++RA+H  +MYE+++ +  + E+RN ELE K TELT  NL+ QK+E+ LRDEL DSV+K ++DA+++R+LELEK E+E K E+ KL+EI++IA  Q + L  QQ SREKE  SLR QL D Q QSDEK+LI KLH+H+V LQ+SE +AL KL+ +    +++EA  LR EQ  DEK+Q LY  RL+GR R KHLR+TI SLR QFSG++PL++ E+F+ T+I+L  DK+K+ QE++ + +   ++E +     +  +   EL   +   R  + V+ +W  K+E LRL+ LK  R+    + E+++L ++I   E  +  ++E+I + ++ H+++Q+ W+QRE ELER +   ++ Q E++ AA  F+ +T        G++PDPS PLPNQL+ A+  IK++I+VI   +   K+L +  KE E+ +R  E  +L R++ INELRLRLPA+ DR + + ++    +       KS++    TM  A  T++ +Q RL  K+E L +Y+ LL++ARE+     +KH E++ +L  +L  +A     +     Q  L  +   V T+  +    E+   +A Q  +   L  +L  +   L  QK+  E   +  ++     +    +E+  +K  + +L+  L +     +    E+   K   +R+P   M+N + +L  QL  KEKQ + L   L +++  +T  + + +    ++     N+Q+V+++HTR+L +++E   + +L+ +  L++++  +  +  +L+ L  +   K+    K+  +K  ++QENDELR Q++R+ + L++ +  D  +  +D ++ K++ +E   +QL+R        P K  +SK    E++  WEEGK+ Q   + L+ +L++KE +   L+KQL+T  +   +  +EK  ++ +L      G  +D    +  + A   +           D  +D+              MR   +    +V    +++  ++N+ LQ  +  LE++L++   +  +T E        KE+ +QKE ++L+ +N+ELKF+ E A K++PRLK +V D K+  + LK  K  LE K           +  ++  G SGK+  ELEK IG MKKVVEK QRENE+LK+A G++ +E++  +  EN +LK EL  LK   G +L+ ++++K +G  ++V++ E+LRK+L +E E  EK RI    +    DK+  Q  +   +L  +ESR  Q
Sbjct:  225 LTEANEKIEVQNQEM---RKNLEESVQEMEKMTDEYNRMKALVHQSDAVMDQIKKENEHYRLQVRELTDLLKAKDEEDDPVMMAVNAKVEEWKLILSSKDDEIIEYQQMLQSLRGKLKNAQLDADKSNIMALKQGIQERDSQIKMLTEQVEQYTKEMEKNTFIIEDLKNELQKDKGTSNFYQQTHYMKIHSKVQILEEKTK----EAERIAELAEADAREKDKELVEALKRLKDYESGVYGLEDAVIEIKNCKAQIKIRDGEMEVLTKEINKLEMKINDILDENEALRERAGLEPKTMIDLTEFRNSKRLKQQQYRAENQVLLKEIESLEEERLDLKRKIRQMAQERGKRNAASGL----TIDDLNLSETFSHENKIE--------GRKLNFMSLNNMNETQSKNEFLSRELAEKEKDLERSRTVIAKFQSKLKELVEENKQLEEGMKEILQAIKDMPKDSDVKGGETSLIIPSLERLVNAMESKNAEGIFDASLHLKAQVDQLTGRNEELRQELRQSRKEAVNYSQQLVKANLKIDHLEKETDLLRQSAGSNVVYKGIDLPDGIAPSSAYIINSQNEYLIHLLQELDNKEKKLKHLEDSLEDYNRKFAVIRHQQSLLYKEYLSEKDIWKTDSEMIREEKRKLEDQAEQDAVKVKEYNNLLSALQMDSNEMKKMLSENSRKITVLQVNEKSLIRQYTTLVEMERHLRKENGKHRNDVIAMEAEVTEKLGSLQRFKEMAIFKIAALQKVIDNSVSLSELELANKQYNELTTKYRDILQKDNMLVQRTSNLEHLECENASLKEQMEAISKELEITKEKLHTIEQAWEQ-------ETKLGNDSNMDKAKKS--MTNSDIVSISKKITVLEMKELNERQRAEHCQKMYEHLRTSLKQMEERNFELETKFTELTKINLDAQKVEQMLRDELADSVTKAVSDADRQRILELEKSEVELKVEVSKLREISDIAKRQVDFLNSQQQSREKEVESLRTQLLDFQAQSDEKALIAKLHQHVVSLQISEATALGKLESVTSKLQKMEAYNLRLEQKLDEKEQALYYARLEGRNRAKHLRQTIQSLRRQFSGALPLAQQEKFSKTMIQLQNDKLKIMQEMKNSQQEHRNMENKTLELELKLKGLEELISTLKDARGAQKVI-NWHVKIEELRLQELKLNRELVKGKEEIKYLNNIISEYEHTINSLEEEIVQQSKFHEERQMAWDQREVELERQLDIFDHQQNEILSAAQKFEDST--------GSMPDPSLPLPNQLEIALRKIKENIQVILKTQATCKSLEEKLKEKESALRLAEQNILSRDKVINELRLRLPATADREKLIAELERKELEP-----KSHH----TMKIAHQTIANMQARLNHKEEVLKKYQHLLEKAREEQREIVKKHEEDLHVLHHKLEQQADNSLNKFRQTAQDLLKQSPAPVPTNKHFIRLAEMEQTVAEQDDSLSSLLTKLKKVSKDLEKQKEITELKVREFENTKLRLQETHASEVKKVKAEVEDLRHALAQAHKDSQSLKSELQAQKEANSRAPTTTMRNLVDRLKSQLALKEKQQKALSRALLELRSEMTAAAEERIIAVTSQKEANLNVQQVVERHTRELKSQIEDLNENLLKLKEALKTSKNKENSLADDLNELNNELQKKQKAYNKILREKDGIDQENDELRRQIKRLSSGLQSKTLIDNKQSLIDELQKKVKKLE---SQLERKVDDVDIKPVKEKSSK----EELIRWEEGKKWQTKVEGLRNRLKEKEGEAHGLAKQLNTLKELFAKADKEKLTLQKKLK---TTGMTVD---QVLGVRALESEKELEELKKKNLDLENDI------------LYMRTQQALPRDSV----VEDLHLQNKYLQEKLHTLEKKLSKEKYSQSLTSEIESDDHCQKEQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVKDLKEMCEFLKKGKLELERK-----------LGQVRGAGRSGKTIPELEKTIGLMKKVVEKVQRENEQLKKASGILTSEKMATIEEENRNLKAELEKLKAHFGRQLSMQFESKNKGTEKIVAENERLRKELKKEIEASEKLRIAKNNLELVNDKMAAQLEETGKRLQFAESRAPQ 2258          
BLAST of NPHP6 vs. UniProt/SwissProt
Match: sp|P85001|CE290_DANRE (Centrosomal protein of 290 kDa OS=Danio rerio OX=7955 GN=cep290 PE=2 SV=1)

HSP 1 Score: 852.047 bits (2200), Expect = 0.000e+0
Identity = 746/2337 (31.92%), Postives = 1299/2337 (55.58%), Query Frame = 2
Query:   29 SSSDWDRILKVKTDQLNSMSPDDIDIIYELMVNIDDISNVDDADKLYKAFNIAQFIMSYKAEENKGLNEDL-----EEANVDXXXXXXXXXXXXXXNAALQRSDGTDINVVR-EKRNWEMEKESMNQEIRELKSKYNSLTEDNDK-------KEETINKQQKEIEGLKDSNAKLSDNVEFLRQRTNQLXXXXXXXXXXX-XXELAYTRSELRQKKIDLDNAQEKILELHQEMDHLKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQMRRIKELRQMLDDKEKMLRETVERLNKVENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVLQXXXXXXXXXXXXXXXXVRMLARQAGLRAGSAGMEAGDVMDAYKALELESSMQNIEYDPVMQSMARKYESAPQGNNTWRIKEREMSSELSNAVKERAVKEDEIAKLMTRNRQLQTENDAMCDALRQIKEEL--VTRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDXXXXXXXX----XXXXXXXXXIGFXXXXXXXXXXXXXXXVMDPMVMMENGWNLEERIGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEELGEAPASEQSIKSTSNSPRKTKSKLAV-DSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNTWXXXXXXXXXXXXXXXXXXXXXXXXQKIERELRDELIDSVSKEINDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAKFDLETEFQVANIARQTETELKDAMATKRNEKSV--LESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKXXXXXXXXXXXXGTRRAGYNG--QLPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQLSIQKQKMETTDKINQSRLXXXXXXXXXXXXDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHT-------RDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKN-LRNLSSNDAMKQELDAMKIKLRLIEEE-NNQLKRNPA-KSANSKQD--SQEKVNNWEEGKRNQRXXXXXXXXXXXXXNDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRLMRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRLTQ--------SGSTSVITLEKEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADXXXXXXXXXXQVGHKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLKQMARDVDKLEKQNADLESKLAISESRG 6904
            +++DW  ++ +  + L        D+I  LMV   D+   DD++K+ + F I+Q ++  K +E K   E +     E+A ++ +    + +   +   A +   G D + +R E R  E   E   +E+ +L+ +     + N++        EE   K ++EI+ L   N +L  ++EF R+   Q ++ + + + +  +  L     +L Q   +L +A++    L  E +HL++NLE +  E+E++T EY  MK     TD  +     +    ++Q+  L +Q+  R + DD +M  VN +VE+WK ++  +D EI    +    LR  L+ + ++S+K+N+ AL + V+ER+ ++K LS+Q+      +E N  LIE LK+ L++  G SS HQ RR+++L   L   E+ + E        E    D+++EL D L R ++YE G  GL  A++EIK CK Q++V++RE E  ++ +N+       L  EN  LR +L +   E+LD+  +RR K  +  + +A N VL KEIE+LE+ERL LK+++R L +  G+   S  +             L++S   +E  PV    + +  S    +   R  ER +  ELSN  KE  ++  E A+   +  ++  EN  +   +++I + +    +      GV +   P L++L+ A+E +   G+FD  ++L+T++D L GRNEE    ++     +     QL   ++K+ +    M+ M          + + LPE ++ ++++ I ALN++ + +LQE   K  ++++   AL+ Y+RKFA +RH+QGLLY+++  E++ +++E ++       +E  R  D  +I E++ +L+TL +D SE++R +A+  R+I VL+VNE  LTRRY+ + E+EQ +R+EN KLK +  Q++AVVT+R+GY +RFKE A +K+  LQK LD SVP  ++ +   ++ E+T KYRN L+K N L+ +  S+  +E+E   ++   +++ K LE  K++ H LE   E          +I +T       K+  AV +S ++S+S+++ TLEMK++NE++RA+HA +MYE+++N+  + E+RN ELE K  ELT  NLE Q+IERELRDEL DSVSK I+DA+++R+ ELEK E   + E+ KL+E++++A MQ +AL  +Q SREKE  SLR+Q+ D Q +SDEK+LI KLH+HIV LQ+SET+A+ +L+  +   ++LEAQ LR EQ  DE+ Q L+  R +G  R +HLR TI +LR QFSG++PL++ E+F++T++ L ED+ ++ ++ Q+    +   E + Q   +  +    L++ +AT ++ K    +  W  K+E +RL  ++  R+ +  R E+++L++ +  QE  ++ ++E++ +     +++QL+W+QRE +LER + + E  Q EV+  A  F++AT        G+LPDP+ PL NQLD A+  IK+H+R I + +   K L +  KE E  +   E  +L R++ INELRLRLPA+ +R + +  +S          ++ +   + T+  A  T++ LQ RL  K+E L +Y+ LL +AR++     ++H EE++ L ++L         R        +   T  V TS       E+   +A Q  +   L  +L  +  +L  Q+Q        + + +   E K   ++  L +    L+ +L + E ++ +   E+   K    RSP+  MKN + +L  QL  KEKQL+ L   L +++  +T Q+   +     +     N+Q+++DK T       RDL+ EL+  +D +       R+A+A +  ++ +L+ L  D    + +  KL+++K  LE+  +EL+ ++QR+ + L+    +D     +D+++ K+R +E E + +    PA K +  K+D  S+E+V  WEEGK+ Q   DK++  L++KE ++ + +KQL T  +   R+ +EK +++ +L    G G   D               +  A        +++L +RN ELE++I ++M+   +       + A+++  +RNR L+  +  +E RL++        SG  S    ++E   QKE +RL+ +NLEL+F+ E A K++PRLK++V+D K+   +LK EK  +E +           +S+++  G SGK+  ELEK IG MKKVVEK QRENE LK+   V + EQ+  L  ++  LK E   LK +   +L  R ++K +G+ +++ + E+LRK++ +EAE  EK R+    +    +KL+ +  +   +L +++S+G
Sbjct:    3 AAADWRLLMGMDPEDLGDEDEKICDLI--LMVKPRDL-KADDSEKMIQLFRISQTLLRMKLDEIKCAYEVVDSAGAEQARIENELKAKVLKLESELEMAQRVMGGGDKHFLRDEIRQLESHLERKEKEVTQLEKEMGKERKSNEELALRAEEAEEKNRKLKREIKQLTRKNEQLQQDIEFYRKEAEQRESLQTKEESNEIQRRLTKANQQLYQCMEELQHAEDMAANLRSENEHLQKNLEESVKEMEKMTDEYNKMKIAVQQTDAIMDQLRKDRDHAKLQVRELTDQIQARVEEDDPVMAAVNAKVEEWKSVLSGKDLEILEYQQMIRDLREKLRTAQMDSDKSNIIALQQAVQERDNQIKMLSEQVEQYTTEMERNAMLIEELKRPLKKDKGHSSDHQ-RRLEDLSAKLQVAERKVLEAQRAAQLAERDARDKDKELNDTLSRIRLYESGTDGLEAAISEIKECKNQIRVRDREIEGMIKEINQLEMKINNLLDENEDLRERLGLNPKEELDLSEFRRSKILKQRQYKAENQVLLKEIERLEEERLELKQRIRALVKDKGVTVVSNSL-------------LDNS---VEEKPVR---SLRPSSGSTDDEIKRKNER-LQKELSNKEKELELRRSESAQFKAKLNEMLNENKQLEQGMKEILQAIQDTQKKTPTSTGVSI---PSLERLVNALEMKYSEGKFDASLHLRTQVDQLTGRNEELRLEMKTAREEAANTLSQLTKANEKIARLESEMESMSKSTGSSIPHKTLALPEEMTPTSAEAINALNEYTVQLLQEIKNKGDSIEQLGSALEEYKRKFAVIRHQQGLLYKEHQSERESWQKERDSFAELKSKLEEQREVDAVKIKEYNHLLETLEKDPSEIRREMAETGRKIVVLRVNEKCLTRRYTTLLELEQHLRKENAKLKEDFTQMQAVVTERIGYLQRFKEMAAFKMASLQKSLDVSVPASELERANKQYTELTIKYRNLLQKDNHLVQKTTSLEHLETENMSLRERIDSINKELEISKEKLHTLEQAFE----------NISTTGGEIIMDKATKAVANSEIVSVSRRITTLEMKELNERQRAEHAQKMYEHLRNSLKQVEERNFELETKFAELTKLNLEAQRIERELRDELADSVSKHISDADRKRITELEKTEANLRIEVSKLREVSDVAKMQVSALDARQQSREKEVESLRRQVLDYQAESDEKALIAKLHQHIVALQLSETTAISRLEATNTRLQKLEAQKLRDEQKLDEQQQALWHARQEGHQRARHLRHTIQALRRQFSGALPLAQQEKFSNTMLHLQEDRARVREDAQIAEEERRKAEGKAQELELKLKG---LEELIATLKDAKGAQKVSEWHKKLEDVRLLEMRQSRELNTQREEIKYLKNCVAEQECTISGLEEELVQQNNLLEERQLIWDQREVQLERQLDSYEKQQNEVLNTAQKFEEAT--------GSLPDPNQPLANQLDYALGKIKEHVRTILETKTTCKILEEKLKEKEAALWSSEQNVLSRDKVINELRLRLPAAAEREKLLADLS----------KQEDSESQPTLKVAHQTINNLQGRLDQKEEVLKKYQNLLGKARQEQEEIAKRHEEEVRALHQKLDVYMDTSLDRFKQTALELIKKPTITVPTSKHLVRLAEMEQTVAEQDNSLSSLSQKLKIVTQELDQQRQVTAAQAMEHAADMARLEDKHAAQMKGLSQEAEELRAQLIQMEKELHYLRTELEAQKEANVRSPSNTMKNLVERLKNQLALKEKQLKALSKALLELRAELTSQAEQQIITNAAQKEEALNVQQIVDKQTKELRACVRDLNEELQLAKDGV-------RAAKARENSLKEDLETLNKDLQRSQKSQNKLQSEKEALEEHLNELKKKIQRLSSGLQAQVESDGPT--VDSLQKKIRKLEHELDRKSISEPADKRSTLKEDKSSKEEVVRWEEGKKWQARVDKMRNVLKEKEREVDSQAKQLATMKELYSRLEQEKVSLQKKLK---GRGVTAD--------------QVVGARTLEADKEIEELHKRNAELEQQI-KVMKQQQA----LPRDAAMEDITIRNRYLEERLYSMESRLSKEPPSRPSTSGRGSDTPSQREHEFQKENLRLSTENLELRFQLEQANKDLPRLKDQVSDLKEMCSVLKKEKAEVEKR-----------LSHLRGSGRSGKTIPELEKTIGLMKKVVEKVQRENENLKKTSEVNVQEQLATLERDHEKLKSEYEKLKGKQEEQLNSRLESKTKGIEKIMMENERLRKEIKKEAEAAEKLRVAKASLEVANEKLKAELEETHQRLLLAQSKG 2239          
BLAST of NPHP6 vs. UniProt/SwissProt
Match: sp|Q6A078|CE290_MOUSE (Centrosomal protein of 290 kDa OS=Mus musculus OX=10090 GN=Cep290 PE=1 SV=2)

HSP 1 Score: 800.045 bits (2065), Expect = 0.000e+0
Identity = 688/2120 (32.45%), Postives = 1199/2120 (56.56%), Query Frame = 2
Query:  638 LDNAQEKILELHQEMDHLKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQ---MRRIKELRQMLDDKEKMLRETVERLNKV-ENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVLQXXXXXXXXXXXXXXXXVRMLARQAGLRAGSAGMEAGDVMDAYKALELESSMQNIEYDPVMQSMARKYESAPQGN-NTWRIKEREMSSELSNAVKERAVKEDEIAKLMTRNRQLQTENDAMCDALRQIKEEL--VTRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDXXX---XXXXXXXXXXXXXXIGFXXXXXXXXXXXXXXXVMDPMVMMENGWNLEER-IGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEELGEAPASEQSIKSTSNSPRKTKSKLAVDSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNTWXXXXXXXXXXXXXXXXXXXXXXXXQKIERELRDELIDSVSKEINDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAKFDLETEFQVANIARQTETELKDAMATKRNEKSVLESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKXXXXXXXXXXXXGTRRAGYNGQ--LPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQLSIQKQKMETTDKINQSRLXXXXXXXXXXXXDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKN-LRNLSSNDAMKQELDAMKIKLRLIEEENNQLKR-------NPAKSANSKQDSQEKVNNWEEGKRNQRXXXXXXXXXXXXXNDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRLMRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRLTQSGSTSVITLE--------KEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADXXXXXXXXXXQVGHKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLKQMARDVDKLEKQNADLESKLAISESRGRQ 6910
            L  A EKI   +QEM   ++NLE +  E+E++T EY  MK+    +D  +   + E    R+Q+  L + +  +++ DD +M+ VN +VE+WK I+  +D EI    +    LR  L+ + ++++K+N+ AL + ++ER+ ++K L++Q+      +E+N  +IE+LK +L++  G S+ +Q     +I    Q+L++K K      ER+ ++ E    ++++EL +AL+R K YE G +GL +AV EIK CKAQ+++++ E E   + +NK      ++  EN  LR +  +     +D+  +R  K  + ++ RA N VL KEIE LE+ERL LK+K+R +A++ G R  ++G+     +D     E  S    IE         RK       N N  + K   +S EL+   K+       IAK  ++ ++L  EN  + + +++I + +  + ++     G   L  P L++L+ AME++   G FD  ++LK ++D L        +   + R   + + Q  +  +     L+    ++    G N+  + I LP+ ++ S++  I + N++LI +LQE   KE+ L   + +L++Y RKFA +RH+Q LLY++Y  EK  ++ + E ++   + +E    +D  ++ E++ +L  L  D +E+K+ L++  R+ITVL+VNE +L R+Y+ + EME+ +R+EN K ++++I +EA VT+++G  +RFKE A +K+  LQK +D SV   ++     +++E+T KYR+ L+K N+L+ R  ++  +E E + +K   EA+ K LE  K++ H +E   E+       E  + + SN  +  KS    +S ++S+SKK+  LEMK++NE++RA+H  +MYE+++ +  + E+RN ELE K TELT  NL+ QK+E+ LRDEL DSV+K ++DA+++R+LELEK E+E K E+ KL+EI++IA  Q + L  QQ SREKE  SLR QL D Q QSDEK+LI KLH+H+V LQ+SE +AL KL+ +    +++EA  LR EQ  DEK+Q LY  RL+GR R KHLR+TI SLR QFSG++PL++ E+F+ T+I+L  DK+K+ QE++ + +   ++E +     +  +   EL   +   R  + V+ +W  K+E LRL+ LK  R+    + E+++L ++I   E  +  ++E+I + ++ H+++Q+ W+QRE ELER +   ++ Q E++ AA  F+ +T        G++PDPS PLPNQL+ A+  IK++I+VI   +   K+L +  KE E+ +R  E  +L R++ INELRLRLPA+ DR + + ++    +       KS++    TM  A  T++ +Q RL  K+E L +Y+ LL++ARE+     +KH E++ +L  +L  +A     +     Q  L  +   V T+  +    E+   +A Q  +   L  +L  +   L  QK+  E   +  ++     +    +E+  +K  + +L+  L +     +    E+   K   +R+P   M+N + +L  QL  KEKQ + L   L +++  +T  + + +    ++     N+Q+V+++HTR+L +++E   + +L+ +  L++++  +  +  +L+ L  +   K+    K+  +K  ++QENDELR Q++R+ + L++ +  D  +  +D ++ K++ +E   +QL+R        P K  +SK    E++  WEEGK+ Q   + L+ +L++KE +   L+KQL+T  +   +  +EK  ++ +L      G  +D    +  + A   +           D  +D+              MR   +    +V    +++  ++N+ LQ  +  LE++L++   +  +T E        KE+ +QKE ++L+ +N+ELKF+ E A K++PRLK +V D K+  + LK  K  LE K           +  ++  G SGK+  ELEK IG MKKVVEK QRENE+LK+A G++ +E++  +  EN +LK EL  LK   G +L+ ++++K +G  ++V++ E+LRK+L +E E  EK RI    +    DK+  Q  +   +L  +ESR  Q
Sbjct:  218 LTEANEKIEVQNQEM---RKNLEESVQEMEKMTDEYNRMKALVHQSDAVMDQIKKENEHYRLQVRELTDLLKAKDEEDDPVMMAVNAKVEEWKLILSSKDDEIIEYQQMLQSLRGKLKNAQLDADKSNIMALKQGIQERDSQIKMLTEQVEQYTKEMEKNTFIIEDLKNELQKDKGTSNFYQQTHYMKIHSKVQILEEKTK----EAERIAELAEADAREKDKELVEALKRLKDYESGVYGLEDAVIEIKNCKAQIKIRDGEMEVLTKEINKLEMKINDILDENEALRERAGLEPKTMIDLTEFRNSKRLKQQQYRAENQVLLKEIESLEEERLDLKRKIRQMAQERGKRNAASGL----TIDDLNLSETFSHENKIE--------GRKLNFMSLNNMNETQSKNEFLSRELAEKEKDLERSRTVIAKFQSKLKELVEENKQLEEGMKEILQAIKDMPKDSDVKGGETSLIIPSLERLVNAMESKNAEGIFDASLHLKAQVDQLTGRNEELRQELRQSRKEAVNYSQQLVKANLKIDHLEKETDLLRQSAGSNVVYKGIDLPDGIAPSSAYIINSQNEYLIHLLQELDNKEKKLKHLEDSLEDYNRKFAVIRHQQSLLYKEYLSEKDIWKTDSEMIREEKRKLEDQAEQDAVKVKEYNNLLSALQMDSNEMKKMLSENSRKITVLQVNEKSLIRQYTTLVEMERHLRKENGKHRNDVIAMEAEVTEKLGSLQRFKEMAIFKIAALQKVIDNSVSLSELELANKQYNELTTKYRDILQKDNMLVQRTSNLEHLECENASLKEQMEAISKELEITKEKLHTIEQAWEQ-------ETKLGNDSNMDKAKKS--MTNSDIVSISKKITVLEMKELNERQRAEHCQKMYEHLRTSLKQMEERNFELETKFTELTKINLDAQKVEQMLRDELADSVTKAVSDADRQRILELEKSEVELKVEVSKLREISDIAKRQVDFLNSQQQSREKEVESLRTQLLDFQAQSDEKALIAKLHQHVVSLQISEATALGKLESVTSKLQKMEAYNLRLEQKLDEKEQALYYARLEGRNRAKHLRQTIQSLRRQFSGALPLAQQEKFSKTMIQLQNDKLKIMQEMKNSQQEHRNMENKTLELELKLKGLEELISTLKDARGAQKVI-NWHVKIEELRLQELKLNRELVKGKEEIKYLNNIISEYEHTINSLEEEIVQQSKFHEERQMAWDQREVELERQLDIFDHQQNEILSAAQKFEDST--------GSMPDPSLPLPNQLEIALRKIKENIQVILKTQATCKSLEEKLKEKESALRLAEQNILSRDKVINELRLRLPATADREKLIAELERKELEP-----KSHH----TMKIAHQTIANMQARLNHKEEVLKKYQHLLEKAREEQREIVKKHEEDLHVLHHKLEQQADNSLNKFRQTAQDLLKQSPAPVPTNKHFIRLAEMEQTVAEQDDSLSSLLTKLKKVSKDLEKQKEITELKVREFENTKLRLQETHASEVKKVKAEVEDLRHALAQAHKDSQSLKSELQAQKEANSRAPTTTMRNLVDRLKSQLALKEKQQKALSRALLELRSEMTAAAEERIIAVTSQKEANLNVQQVVERHTRELKSQIEDLNENLLKLKEALKTSKNKENSLADDLNELNNELQKKQKAYNKILREKDGIDQENDELRRQIKRLSSGLQSKTLIDNKQSLIDELQKKVKKLE---SQLERKVDDVDIKPVKEKSSK----EELIRWEEGKKWQTKVEGLRNRLKEKEGEAHGLAKQLNTLKELFAKADKEKLTLQKKLK---TTGMTVD---QVLGVRALESEKELEELKKKNLDLENDI------------LYMRTQQALPRDSV----VEDLHLQNKYLQEKLHTLEKKLSKEKYSQSLTSEIESDDHCQKEQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVKDLKEMCEFLKKGKLELERK-----------LGQVRGAGRSGKTIPELEKTIGLMKKVVEKVQRENEQLKKASGILTSEKMATIEEENRNLKAELEKLKAHFGRQLSMQFESKNKGTEKIVAENERLRKELKKEIEASEKLRIAKNNLELVNDKMAAQLEETGKRLQFAESRAPQ 2251          
BLAST of NPHP6 vs. UniProt/SwissProt
Match: sp|O15078|CE290_HUMAN (Centrosomal protein of 290 kDa OS=Homo sapiens OX=9606 GN=CEP290 PE=1 SV=2)

HSP 1 Score: 796.193 bits (2055), Expect = 0.000e+0
Identity = 697/2129 (32.74%), Postives = 1212/2129 (56.93%), Query Frame = 2
Query:  638 LDNAQEKILELHQEMDHLKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQMRRIKELRQMLDDKEKMLRETVERLNKVENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVLQXXXXXXXXXXXXXXXXVRMLARQAGLRAGSAGMEAGDVMDAYKALELESSMQNI-EYDPV----MQSMARKYESAPQGNNTW---RIKEREMSSELSNAVKERAVKEDEIAKLMTRNRQLQTENDAMCDALRQIKEELVTRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDXXX---XXXXXXXXXXXXXXIGFXXXXXXXXXXXXXXXVMDPMVMMENGWNLEER-IGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEE---LGEAPASEQSIKSTSNSPRKTKSKLAVDSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNTWXXXXXXXXXXXXXXXXXXXXXXXXQKIERELRDELIDSVSKEINDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAKFD-----LETEFQVANIARQTETELKDAMATKRNEKSVLESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKXXXXXXXXXXXXGTRRAGYNGQ--LPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQLSIQKQKMETTDKINQSRLXXXXXXXXXXXXDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKN-LRNLSSNDAMKQELDAMKIKLRLIEEENNQLKR-------NPAKSANSKQDSQEKVNNWEEGKRNQRXXXXXXXXXXXXXNDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRLMRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRLTQ--------SGSTSVITLEKEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADXXXXXXXXXXQVGHKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLKQMARDVDKLEKQNADLESKLAISESRGRQ 6910
            L  A EKI   +QEM   ++NLE +  E+E++T EY  MK+    TD  +   + E    ++Q++ L + +  +N+ DD IM+ VN +VE+WK I+  +D EI    +    LR  L+ + ++++K+NV AL + ++ER+ ++K L++Q+      +E+N  +IE+LK +L+R  G S+  Q   +K ++  LD  ++  +E        E    ++++EL +AL+R K YE G +GL +AV EIK CK Q+++++RE E   + +NK      +   EN  LR ++ +     +D+  +R  K  + ++ RA N +L KEIE LE+ERL LKKK+R +A++ G R+ ++G+   D+          +  +NI + D +    +  ++ K  S  Q  N +    + E+E   E S  V   A  ++++ +L+  N+QL+   + M + L+ IKE  + ++     G   L  P L++L+ A+E++   G FD  ++LK ++D L        +   E R   I + Q     +     L+    ++    G N+  + I LP+ ++ S++  I + N++LI +LQE   KE+ L   + +L++Y RKFA +RH+Q LLY++Y  EK+ ++ E + ++   + +E    +D  ++ E++ +L+ L  D  E+K+ LA+  R+ITVL+VNE +L R+Y+ + E+E+ +R+EN K K+E++ +EA V +++G  +RFKE A +K+  LQK +D SV   ++     +++E+T KYR+ L+K N+L+ R  ++  +E E   +K   E++ K LE  K++ H +E   E+   LG   + +++ KS +NS             ++S+SKK+  LEMK++NE++RA+H  +MYE+++ +  + E+RN ELE K  ELT  NL+ QK+E+ LRDEL DSVSK ++DA+++R+LELEK E+E K E+ KL+EI++IA  Q   L  QQ SR+KE  SLR QL D Q QSDEKSLI KLH+H V LQ+SE +AL KL+ +    +++EA  LR EQ  DEK+Q LY  RL+GR R KHLR+TI SLR QFSG++PL++ E+F+ T+I+L  DK+K+ QE++ + +   +     LE E ++  +     T LKD   TK  +K +  +W  K+E LRL+ LK  R+    + E+++L ++I   E  ++ ++E+I +  + H+++Q+ W+QRE +LER +   +  Q E++ AA  F++AT        G++PDPS PLPNQL+ A+  IK++IR+I +     K+L +  KE E+ +R  E  +L R++ INELRLRLPA+ +R + + ++    +       KS++    T+  A  T++ +Q RL  K+E L +Y++LL++ARE+     +KH E++ +L  RL  +A +   +        +  + T V T+  +    E+   +A Q  +   L ++L  +   L  Q++  E   K  ++   + +   E+E+  +K  + +LK  L++ + + +    E+   K   +R+P   M+N + +L  QL  KEKQ + L   L +++  +T  + + +    ++     N+Q+++D+HTR+L  ++E   + +L+ +  L++++  +  +   L+ L  +   K+    K+  +K +++QENDEL+ Q++R+ + L+     D  +  ++ ++ K++ +E   NQL+         P K  N+K    E++  WEEGK+ Q   + ++ KL++KE ++  L+KQL+T      +  +EK  ++ +L      G  +D    +  I A   +                   RN +LE +I   MR   +    +V    +++  ++NR LQ  +  LE++ ++        SG  S    ++E+ +QKE ++L+ +N+ELKF+ E A K++PRLK +V D K+  + LK EK  ++ K           + +++  G SGK+  ELEK IG MKKVVEK QRENE+LK+A G++ +E++  +  EN  LK EL  LK  +GH+L+  Y++K +G  +++++ E+LRK+L +E +  EK RI    +    +K+  Q  +   +L  +ESRG Q
Sbjct:  225 LTEANEKIEVQNQEM---RKNLEESVQEMEKMTDEYNRMKAIVHQTDNVIDQLKKENDHYQLQVQELTDLLKSKNEEDDPIMVAVNAKVEEWKLILSSKDDEIIEYQQMLHNLREKLKNAQLDADKSNVMALQQGIQERDSQIKMLTEQVEQYTKEMEKNTCIIEDLKNELQRNKGASTLSQQTHMK-IQSTLDILKEKTKEAERTAELAEADAREKDKELVEALKRLKDYESGVYGLEDAVVEIKNCKNQIKIRDREIEILTKEINKLELKISDFLDENEALRERVGLEPKTMIDLTEFRNSKHLKQQQYRAENQILLKEIESLEEERLDLKKKIRQMAQERGKRSATSGLTTEDL----------NLTENISQGDRISERKLDLLSLKNMSEAQSKNEFLSRELIEKERDLERSRTV--IAKFQNKLKELVEENKQLE---EGMKEILQAIKE--MQKDPDVKGGETSLIIPSLERLVNAIESKNAEGIFDASLHLKAQVDQLTGRNEELRQELRESRKEAINYSQQLAKANLKIDHLEKETSLLRQSEGSNVVFKGIDLPDGIAPSSASIINSQNEYLIHLLQELENKEKKLKNLEDSLEDYNRKFAVIRHQQSLLYKEYLSEKETWKTESKTIKEEKRKLEDQVQQDAIKVKEYNNLLNALQMDSDEMKKILAENSRKITVLQVNEKSLIRQYTTLVELERQLRKENEKQKNELLSMEAEVCEKIGCLQRFKEMAIFKIAALQKVVDNSVSLSELELANKQYNELTAKYRDILQKDNMLVQRTSNLEHLECENISLKEQVESINKELEITKEKLHTIEQAWEQETKLGNESSMDKAKKSITNSD------------IVSISKKITMLEMKELNERQRAEHCQKMYEHLRTSLKQMEERNFELETKFAELTKINLDAQKVEQMLRDELADSVSKAVSDADRQRILELEKNEMELKVEVSKLREISDIARRQVEILNAQQQSRDKEVESLRMQLLDYQAQSDEKSLIAKLHQHNVSLQLSEATALGKLESITSKLQKMEAYNLRLEQKLDEKEQALYYARLEGRNRAKHLRQTIQSLRRQFSGALPLAQQEKFSKTMIQLQNDKLKIMQEMKNSQQEHRNMENKTLEMELKLKGLEELIST-LKD---TKGAQKVI--NWHMKIEELRLQELKLNRELVKDKEEIKYLNNIISEYERTISSLEEEIVQQNKFHEERQMAWDQREVDLERQLDIFDRQQNEILNAAQKFEEAT--------GSIPDPSLPLPNQLEIALRKIKENIRIILETRATCKSLEEKLKEKESALRLAEQNILSRDKVINELRLRLPATAEREKLIAELGRKEMEP-----KSHH----TLKIAHQTIANMQARLNQKEEVLKKYQRLLEKAREEQREIVKKHEEDLHILHHRLELQADSSLNKFKQTAWDLMKQSPTPVPTNKHFIRLAEMEQTVAEQDDSLSSLLVKLKKVSQDLERQREITELKVKEFENIKLQLQENHEDEVKKVKAEVEDLKYLLDQSQKESQCLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRAEMTAAAEERIISATSQKEAHLNVQQIVDRHTRELKTQVEDLNENLLKLKEALKTSKNRENSLTDNLNDLNNELQKKQKAYNKILREKEEIDQENDELKRQIKRLTSGLQGKPLTDNKQSLIEELQRKVKKLE---NQLEGKVEEVDLKPMKEKNAK----EELIRWEEGKKWQAKIEGIRNKLKEKEGEVFTLTKQLNTLKDLFAKADKEKLTLQRKLK---TTGMTVD---QVLGIRALESEKELEELKK-----------RNLDLENDI-LYMRAHQALPRDSV----VEDLHLQNRYLQEKLHALEKQFSKDTYSKPSISGIESDDHCQREQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMCEFLKKEKAEVQRK-----------LGHVRGSGRSGKTIPELEKTIGLMKKVVEKVQRENEQLKKASGILTSEKMANIEQENEKLKAELEKLKAHLGHQLSMHYESKTKGTEKIIAENERLRKELKKETDAAEKLRIAKNNLEILNEKMTVQLEETGKRLQFAESRGPQ 2257          
BLAST of NPHP6 vs. UniProt/SwissProt
Match: sp|Q9TU23|CE290_BOVIN (Centrosomal protein of 290 kDa (Fragment) OS=Bos taurus OX=9913 GN=CEP290 PE=1 SV=2)

HSP 1 Score: 549.28 bits (1414), Expect = 4.572e-163
Identity = 507/1528 (33.18%), Postives = 873/1528 (57.13%), Query Frame = 2
Query: 2711 EQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEELGEAPASEQSIKSTSNSPRKTKSKLAVDSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNTWXXXXXXXXXXXXXXXXXXXXXXXXQKIERELRDELIDSVSKEINDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQ------LTLRAKFDLETEFQVANIARQTETELKDAMATKRNEKSVLESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKXXXXXXXXXXXXGTRRAGYNGQ--LPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQLSIQKQKMETTDKINQSRLXXXXXXXXXXXXDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSID-ALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRI-KNLRNLSSNDAMKQELDAMKIKLRLIEEENNQLKR-------NPAKSANSKQDSQEKVNNWEEGKRNQRXXXXXXXXXXXXXNDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRLMRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRLTQSG----STSVI----TLEKEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADXXXXXXXXXXQVGHKLAERYDAKERGMARVVSDYEKLRKDL-----------GREAEEHEKTRIDLKQMARDVDKLEKQNADLESKLAISESRGRQNVSRIANKELQDENRKLSSIIANLQSQLKD----------------KHNQNPDSS---KVEELKLLYNKATERVSFLEKQLQSFSEQFGVAI 7129
            E+ +R+EN K K+E++ +EA V +++G  +RFKE A +K+  LQK +D SV   ++     +++E+T KYR+ L+K N+L+ R  ++  +E E   +K   E++ K LE  K++ H +E   E+       E  + + SN  +  KS    +S ++S+SKK+  LEMK++NE++RA+H+ +MYE++K +  + E+RN ELE K  ELT  NLE QK+E+ LRDEL DSVSK ++DA+++ +LELEK E+E K E+ KLKEI++IA  Q   L  QQ SREKE  SLR QL D Q QSDEK+LI KLH+H+V LQ SE +AL K++ +    +++EA  LR EQ  DEK+Q L+  RL+GR R KHLR+TI SLR QFSG++PL++ E+F+ T+I+L  DK+K+ +E++       +L+ K  LE E ++  +     T LKDA    R  + V+ SW +K+E LRL+ LK  R+    + E+++L ++I   E+ ++ ++E+I +  + H+++Q+ W+QRE ELER +   +  Q E++  A  F++AT        G++PDPS P+PNQL+ A+  IK++IR+I + +   ++L +  +E E+ +R  E  +L R++ INELRLRLPA+ ++ + + + S   V       KS++    T+  A  T++ +Q RL  K+E L +Y+ LL++ARE+     +KH EE+  L  +L  +A     +        +  + T V T+  +    E+   +A Q  +   L ++L  +   L  QK+  E   K  ++     +    +E+  +K  + +L+  L + + + +    E+   K   +R+P   M+N + +L  QL  KEKQ + L   L +++  +T  + +  + MT  + AN  N+Q+++D+HT++L +++E   + IL+ +  L++++  +  +   L+ L  +  +K+    K+  +K  ++QEN+EL+ Q++R+   L+     D  +  ++ ++ K++ +E   +QL+R        P K  +++    E+V  WEEGK+ Q   + ++ KL++KE ++  L+KQL T      +  +EK  ++ +L      G  +D             + MA A        +++L++RN +LE +I   MR+  +    +V    +++  ++N+ LQ  +  LE++L++      STS I      ++E+ +Q+E ++L+ +N+ELKF+ E A K++PRLK +V D K+  + LK EK  +E K  R           ++  G SGK+  ELEK IG MKKVVEK QRENE+LK+A G++ +E++  +  EN  LK EL  LK  +G +L+  Y++K +G  ++V++ E+LRK+L           G E E+  +  + + ++A    +LEK+  +L  ++ IS+ +   + S I++ +       L   I +L++QL+                 K  +N D S   ++E+LK  Y +  ++   LE++L+  SEQFGV +
Sbjct:    1 ERQLRKENGKQKNELMAMEAEVGEKIGRLQRFKEMAVFKIAALQKVVDNSVSLSELELANRQYNELTAKYRDILQKDNMLVQRTNNLEHLECENVSLKEQMESINKELEITKEKLHTIEQAWEQ-------ETKLGNESNMDKAKKS--VTNSEIVSISKKITMLEMKELNERQRAEHSQKMYEHVKTSLQQVEERNFELETKFAELTRINLEAQKVEQMLRDELADSVSKTVSDADRQHILELEKSEMELKVEVSKLKEISDIAKRQVEILNAQQQSREKEVESLRTQLLDYQAQSDEKALIAKLHQHVVSLQASEAAALGKVESVASKLQKVEAHTLRLEQKLDEKEQALFYARLEGRNRAKHLRQTIQSLRRQFSGALPLAQQEKFSKTMIQLQNDKLKIMEEMKNSQQEHRSLKNK-TLEMELKLKGLEDLIST-LKDA----RGAQKVI-SWHTKIEELRLQELKLNRELVKDKEEIKYLNNIISEYENTISSLEEEIVQQNKFHEERQMAWDQREVELERQLDVFDRQQSEILREAQKFEEAT--------GSMPDPSLPIPNQLEIALRKIKENIRIILETQATCRSLEEKLREKESALRLAEENILSRDKVINELRLRLPATAEQEKLLAEFSRKEVEP-----KSHH----TLKLAHQTIANMQARLNQKEEVLKKYQHLLEKAREEQREIVKKHEEELHTLHRKLELQADNSLSKFKETAWDLIKQSPTPVPTNKHFIRLAEMEQTVAEQDDSLSSLVIKLKQVSQDLERQKEITELKIKEFENMKLRLQENHADEVKKIKAEVEDLRCLLVQSQKESQSLKSELQTQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRAEMTAAAEERIISMTSQKEANL-NVQQIVDRHTKELKSQIEDLNENILKLKEALKTSKNRENTLTDNLNDLTNELQNKQKAYGKVLREKDAVDQENNELKRQIKRLTSGLQGKPLIDNKQSLIEELQKKIKKLE---SQLERKVDEAEMKPMKEKSAR----EEVIRWEEGKKWQTKIEGIRNKLKEKEGEVYILTKQLTTLKDLFAKADKEKLTLQRKLK---TTGLTVD-------------QVMA-ARVLESEKELEELKKRNLDLENDIS-YMRSHQALPRDSV----IEDLHLQNKYLQEKLHALEKQLSKDAYSRPSTSGIDSDDHYQREQELQRENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMCEFLKKEKAEVERKLGR-----------VRGSGRSGKTIPELEKTIGLMKKVVEKVQRENEQLKKASGILTSEKMANIEMENEKLKAELEKLKVHLGRQLSMHYESKAKGTEKIVAENERLRKELKKIEILKHVPEGDETEQGLQRELRVLRLAN--SQLEKEKEELIHRIEISKDQNGPD-STISDPD------HLMEKIKDLETQLRTSDMEKQHLKEEIQKLKKELENFDPSFFEEIEDLKYNYKEEVKKNILLEEKLKKLSEQFGVEL 1445          
BLAST of NPHP6 vs. TrEMBL
Match: A0A0H3YKK9 (NPHP6 OS=Schmidtea mediterranea OX=79327 GN=NPHP6 PE=2 SV=1)

HSP 1 Score: 4374.7 bits (11345), Expect = 0.000e+0
Identity = 2372/2372 (100.00%), Postives = 2372/2372 (100.00%), Query Frame = 2
Query:   26 MSSSDWDRILKVKTDQLNSMSPDDIDIIYELMVNIDDISNVDDADKLYKAFNIAQFIMSYKAEENKGLNEDLEEANVDXXXXXXXXXXXXXXNAALQRSDGTDINVVREKRNWEMEKESMNQEIRELKSKYNSLTEDNDKKEETINKQQKEIEGLKDSNAKLSDNVEFLRQRTNQLXXXXXXXXXXXXXELAYTRSELRQKKIDLDNAQEKILELHQEMDHLKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQMRRIKELRQMLDDKEKMLRETVERLNKVENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVLQXXXXXXXXXXXXXXXXVRMLARQAGLRAGSAGMEAGDVMDAYKALELESSMQNIEYDPVMQSMARKYESAPQGNNTWRIKEREMSSELSNAVKERAVKEDEIAKLMTRNRQLQTENDAMCDALRQIKEELVTRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDXXXXXXXXXXXXXXXXXIGFXXXXXXXXXXXXXXXVMDPMVMMENGWNLEERIGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEELGEAPASEQSIKSTSNSPRKTKSKLAVDSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNTWXXXXXXXXXXXXXXXXXXXXXXXXQKIERELRDELIDSVSKEINDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAKFDLETEFQVANIARQTETELKDAMATKRNEKSVLESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKXXXXXXXXXXXXGTRRAGYNGQLPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQLSIQKQKMETTDKINQSRLXXXXXXXXXXXXDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKNLRNLSSNDAMKQELDAMKIKLRLIEEENNQLKRNPAKSANSKQDSQEKVNNWEEGKRNQRXXXXXXXXXXXXXNDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRLMRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRLTQSGSTSVITLEKEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADXXXXXXXXXXQVGHKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLKQMARDVDKLEKQNADLESKLAISESRGRQNVSRIANKELQDENRKLSSIIANLQSQLKDKHNQNPDSSKVEELKLLYNKATERVSFLEKQLQSFSEQFGVAIDLGY 7141
            MSSSDWDRILKVKTDQLNSMSPDDIDIIYELMVNIDDISNVDDADKLYKAFNIAQFIMSYKAEENKGLNEDLEEANVDIKKLKIIKEELEKENAALQRSDGTDINVVREKRNWEMEKESMNQEIRELKSKYNSLTEDNDKKEETINKQQKEIEGLKDSNAKLSDNVEFLRQRTNQLKNQKDQNQDSNKSELAYTRSELRQKKIDLDNAQEKILELHQEMDHLKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQMRRIKELRQMLDDKEKMLRETVERLNKVENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVLQKEIEKLEDERLLLKKKVRMLARQAGLRAGSAGMEAGDVMDAYKALELESSMQNIEYDPVMQSMARKYESAPQGNNTWRIKEREMSSELSNAVKERAVKEDEIAKLMTRNRQLQTENDAMCDALRQIKEELVTRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDNLEGRNEELRNELRNSRIGFQQLQLDHDKLKQRLKVMDPMVMMENGWNLEERIGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEELGEAPASEQSIKSTSNSPRKTKSKLAVDSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNTWNEAEKRNKELEEKLTELTNHNLELQKIERELRDELIDSVSKEINDAEKRRVLELEKRELEGKHEIEKLKEIAEIATMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAKFDLETEFQVANIARQTETELKDAMATKRNEKSVLESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKLLRERLSAEAAAGTRRAGYNGQLPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQLSIQKQKMETTDKINQSRLKETEIKTENEIIDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKNLRNLSSNDAMKQELDAMKIKLRLIEEENNQLKRNPAKSANSKQDSQEKVNNWEEGKRNQRLQDKLKEKLQDKENDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRLMRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRLTQSGSTSVITLEKEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADLKLELAALKEQVGHKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLKQMARDVDKLEKQNADLESKLAISESRGRQNVSRIANKELQDENRKLSSIIANLQSQLKDKHNQNPDSSKVEELKLLYNKATERVSFLEKQLQSFSEQFGVAIDLGY
Sbjct:    1 MSSSDWDRILKVKTDQLNSMSPDDIDIIYELMVNIDDISNVDDADKLYKAFNIAQFIMSYKAEENKGLNEDLEEANVDIKKLKIIKEELEKENAALQRSDGTDINVVREKRNWEMEKESMNQEIRELKSKYNSLTEDNDKKEETINKQQKEIEGLKDSNAKLSDNVEFLRQRTNQLKNQKDQNQDSNKSELAYTRSELRQKKIDLDNAQEKILELHQEMDHLKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQMRRIKELRQMLDDKEKMLRETVERLNKVENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVLQKEIEKLEDERLLLKKKVRMLARQAGLRAGSAGMEAGDVMDAYKALELESSMQNIEYDPVMQSMARKYESAPQGNNTWRIKEREMSSELSNAVKERAVKEDEIAKLMTRNRQLQTENDAMCDALRQIKEELVTRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDNLEGRNEELRNELRNSRIGFQQLQLDHDKLKQRLKVMDPMVMMENGWNLEERIGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEELGEAPASEQSIKSTSNSPRKTKSKLAVDSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNTWNEAEKRNKELEEKLTELTNHNLELQKIERELRDELIDSVSKEINDAEKRRVLELEKRELEGKHEIEKLKEIAEIATMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAKFDLETEFQVANIARQTETELKDAMATKRNEKSVLESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKLLRERLSAEAAAGTRRAGYNGQLPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQLSIQKQKMETTDKINQSRLKETEIKTENEIIDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKNLRNLSSNDAMKQELDAMKIKLRLIEEENNQLKRNPAKSANSKQDSQEKVNNWEEGKRNQRLQDKLKEKLQDKENDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRLMRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRLTQSGSTSVITLEKEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADLKLELAALKEQVGHKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLKQMARDVDKLEKQNADLESKLAISESRGRQNVSRIANKELQDENRKLSSIIANLQSQLKDKHNQNPDSSKVEELKLLYNKATERVSFLEKQLQSFSEQFGVAIDLGY 2372          
BLAST of NPHP6 vs. TrEMBL
Match: A0A1S3JQI2 (centrosomal protein of 290 kDa OS=Lingula unguis OX=7574 GN=LOC106175240 PE=4 SV=1)

HSP 1 Score: 1067.37 bits (2759), Expect = 0.000e+0
Identity = 772/2084 (37.04%), Postives = 1274/2084 (61.13%), Query Frame = 2
Query:  665 ELHQEMDHLKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQMRRIKELRQMLDDKEKMLRETVERLNKVENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVLQXXXXXXXXXXXXXXXXVRMLARQAGLRAGSAGMEAGDVMDAYKALELESSMQNIEYDPVMQSMARKYESAPQGNNTWRIKEREMSSELSNAVKERAVKEDEIAKLMTRNRQLQTENDAMCDALRQIKEELVTRNW---SAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDXXXXXXXXXXXXXXXXXIGFXXXXXXXXXXXXXXXVM----DPMVMMENGWN--LEERIGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEELGEAPASEQSIKSTSNSPRKTKSKLAVDSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNTWXXXXXXXXXXXXXXXXXXXXXXXXQKIERELRDELIDSVSKEINDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAKFDLETEFQVANIARQTETELKDAMATKRNEKSVLESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKXXXXXXXXXXXXGTRRAGYNG-QL---PMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQLSIQKQKMETTDKINQSRLXXXXXXXXXXXXDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKNLRNLSS--NDAMKQELDAMKIKLRLIEEENNQLKRNPAKSANSKQD-------SQEKVNNWEEGKRNQRXXXXXXXXXXXXXNDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRS-DTVDDLRRRNGELEKEIDRLMRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRLTQSGSTSVIT----------LEKEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSA-STMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADXXXXXXXXXXQVGHKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRI 6814
            +L  + D ++  LE A  +++R T EY  +K+    +D  L   + E  +L+ Q+  L EQ+  + DADD+IM+ VN +V++WK +M ++D EI    EE A+LR  LQ + +++EKA+V  L K V++R+++++ L Q+L  A   IE N  + E+LK +L++TGGG S  QM +IKEL+  L  +E   ++   R  + E    +++Q+L +ALE+ K YE G +GL EAV +IK  K QL VK+R+  +  Q++NK      ++  EN  +R K  +   + +D+  +R  +    +E+RA+N+VLQKE+E LE+ER+ LKK+VR LA+Q G RA + G++A D+M       +E+  + ++        A  Y       +  +I+  +++ E  + VK       ++ +  T+    + EN  +   +++I + L  +N    S G    V+ECP LD++L A+E +++ G++DT ++LK ++DNL+GRN+ELR ELR +R  F+  +   +  K   +V     D  V+ E G    + + + LPE ++ +++  IA+LN+HL+  +QE SLKE+ ++K + +L+ ++RKFA +RH+QGL+Y++Y  EK+ +E++ + L+  LK+ EGI SED  R+ EFDR+LDTL++DD E++RRLAD+ R+ITVL+VNE ALTRRY++MQE+E  +R+E NKLK+EM+ +E  VT+R+GY +R+K+ A +K+  LQK L++SVP  ++     +++++TEKYR+ LEK N L+ + ES   +E E+ +++ +++ LKK +E EK++ H LE  ++E+      +Q I  T             D+ ++S+SKK+ TLEMK++NE++RA+HAVRMYE  K      E+RN +LE+K  ELT  N+E Q++ERELRDEL + V++ +++A++++V EL + E   K+E+ +LKEIAE+ TMQ  A + QQ+SREKE  SLRQQLADIQ QSDEK++IGKLHRHIV LQ+SE +A+RKL    +  K+L+AQLLR +Q  DE+DQ LY +R +   + KHL+ TI  LR QFSG++PLSR E+F   +++L EDK +++  L+     + D+E +     +  +   EL  ++   +  + V+E W SKME LRLE LK KR    ++ +  + E++ K QE  +A+++E+  + ++ +DD+QLLWEQRE ELER I ++E  Q E+  AA+ F++AT        G LPDPS P+ NQL+QA+ TIK++++ I + + ++K L++   E E+ +RE E  ++ R++ I ELR+RLPA+  R + +   +  A  + L     +Y  ++ +  AQ+T+  LQ R+  KDE++ +Y+ LL++ RED+    +KH +E+KLL+++L ++      +      QL   P  T  + TS Q    NEL D +A Q      +  +L   + Q+   K K+E + K      +    + ++ +  LKE +     ++ E+E ++E   QE+   K    R+P   MKN + +L  QL  KEKQ Q L   L +++  +  Q+ + ++    E A + N+Q+V++K+T++L +++E    Q+ + +REL+  R  +  +  E++ LK D   +E    KLK  K KLE + +EL  + +R+   ++  +   D  + EL+ ++ K+RL+E+E  + K+   K    K +       S + V  WEE K+ Q+  D+LK +L++KE ++  + +  D T  ALDR  R+K+++E+RL      G                    +   P+ RS   +++LRR+N ELE+++  L R           + A +E ++RN+ L   +E+LER+L +   T               +KE+++QK+++RL+ +N+EL+FEAE A K+IPRLKE++ D ++++++LKSE          +L +SA S+  NIK++G+SGKST+ELEK I  +KKVVE+ Q ENE LK+APG++ NE++Q+L  EN  LK +L  L++++G  L ERY + ++G A++++DYE+LRKDL +E + +EK RI
Sbjct:  230 DLQVKADEMRFKLEDAVRQMDRTTDEYMKLKTVLNQSDHALDQYKRENEILKAQVVDLTEQVQSKTDADDEIMVAVNNKVQEWKSVMADKDEEIAEYQEELARLREQLQAAKMDTEKASVSVLSKAVEQRDRQIELLQQKLDQAVADIETNTAVTEDLKGELKKTGGGPSDRQMAKIKELQTTLRIREDHNKDAEIRAEQAEKDAREKDQQLNEALEKMKQYEEGTYGLKEAVDDIKDLKHQLNVKDRQIMELTQHINKCELKINDVCDENEAVRRKAGLEAKD-IDLSEFREARKLRQQEDRAMNVVLQKEVESLEEERIELKKQVRKLAQQTGQRAVALGLDADDMM------AIENYTEELKQRHKTGGTA-AYIKQEAETDELKIRNVQLAQETESNVKALEKARQQLVEYRTKLNAAEDENKKLEQGMKEILQALKEQNEDKESRGEQPTVIECPTLDRMLAALEAKQMKGQYDTSLHLKAQVDNLQGRNDELRRELREAR--FEANKARSEAEKTLERVTKLQNDIKVLQEAGAGAGMLQTLALPEGMAPTSADVIASLNEHLVQTIQELSLKEEMINKMEASLETFKRKFAVMRHQQGLVYQEYIQEKKTWEEDKQKLENDLKNSEGIHSEDKVRLQEFDRLLDTLSKDDIEVRRRLADMTRKITVLRVNEKALTRRYNSMQEVEGYLRKEGNKLKNEMVAMETAVTERLGYLQRYKDMAAFKIASLQKALEDSVPMSELELANKQYNDLTEKYRDLLEKGNTLVAQSESTAGLELEIKRLQHENDGLKKEMEIEKEKLHTLEGAMDEM-----RKQGIPGTGAIS---------DAGIVSLSKKITTLEMKELNERQRAEHAVRMYEQQKGALRGMEERNADLEQKFAELTKMNIEAQRVERELRDELANCVTRAVSEADRKKVAELSQSEAFLKNEVSRLKEIAEVGTMQAQAYEAQQVSREKELLSLRQQLADIQAQSDEKTIIGKLHRHIVQLQVSEGTAVRKLLQAEKKIKKLDAQLLRLQQRLDERDQTLYHSRQEANNKSKHLKRTIQELRRQFSGAVPLSRQEKFAKAMVQLHEDKSEIECRLREVNEQRQDVEDKLAELELQHKGLQELMASIKDGKGAQKVVE-WHSKMESLRLEDLKQKRMITKMQEQARYFENLNKNQEKTIAELEEENVKTSKYYDDRQLLWEQREVELERIIASMEKQQAEIAGAASKFEEAT--------GALPDPSLPVANQLEQAITTIKQNVKTILETQVQHKQLKQKVLELEHALREAESNVISRDKVIAELRVRLPATAGRDEMILHATAKATEAAL---AEDYETKQALKVAQSTIGSLQARIAQKDETIQKYQDLLRQVREDMQDMGKKHEQEMKLLQDKLHSKNDDAFSKFKQTAMQLINKPQDT--LPTSKQLARLNELEDTVAEQDNAMAAMTEKLKAAREQIERWKLKLEDSVKTMTQEKERMLDEHQSMVAQLKEQLERYVERVAEQEKEMEVLQQELITQKDANARAPTTAMKNLVERLKNQLAAKEKQQQALSKALTELRADMVSQAQEQVKSHAEEAAVEINVQRVVEKNTKELKDQIEDLESQLQRAKRELKKRREKETALNTEIEELKEDLTKRESQVTKLKETKLKLEHDVEELEKRAERLSASKSQKTVEPDGRQLELEELRRKIRLLEDELKR-KQQAEKPYEVKAELEPRVMKSDDTVARWEESKKWQKTVDRLKARLKEKEEEVDRMQRHADLTKNALDRANRDKESLESRLK---ATGK-------------------STVVPTGRSTHNLEELRRKNYELEEQVADLKRQITQG-----RDAAFEEVQLRNKFLTEKLEELERQLARRTLTGQAPGPESQAYQQLYDKEQSLQKQVIRLSEENIELRFEAEQAAKDIPRLKERIEDLQRYVEVLKSE----------NLNTSARSSGGNIKKIGESGKSTRELEKTIALLKKVVERVQAENETLKKAPGIVSNEELQMLARENEGLKDQLEELRQKMGATLTERYSSAQKGTAKIMTDYERLRKDLKKETDLNEKLRI 2237          
BLAST of NPHP6 vs. TrEMBL
Match: A0A2C9KBV3 (CEP209_CC5 domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106076710 PE=4 SV=1)

HSP 1 Score: 1047.73 bits (2708), Expect = 0.000e+0
Identity = 772/2108 (36.62%), Postives = 1284/2108 (60.91%), Query Frame = 2
Query:  668 LHQEMDHLKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQMRRIKELRQMLDDKEKMLRETVERLNKVENQMAD-----REQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVLQXXXXXXXXXXXXXXXXVRMLARQAGLRAGSAGMEAGD---VMDAYKALELESSMQNIEYDP--VMQSMARKYESAPQGNNTWRIKEREMSSELSNAVKERAVKEDEIAKLMTRNRQLQTENDAMCDALRQIKEELVTRNWSAGAG-----VPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDXXXXXXXXXXXXXXXXXIGFXXXXXXXXXXXXXXXVM--DPMVMMENGWN--LEERIGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEEL---GEAPASEQSIKSTSNSPRKTKSKLAVDSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNTWXXXXXXXXXXXXXXXXXXXXXXXXQKIERELRDELIDSVSKEINDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAKFDLETEFQVANIARQTETELKDAMATKRNEKSVLESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKS--NYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKXXXXXXXXXXXXG------TRRAGYNGQLPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQLSIQKQKMETTDKINQSRLXXXXXXXXXXXXDLKENMNNLKRKLNEKESQIEFQNQ--------------EISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKNLRNLSSNDAMK-QELDAMKIKLRLIEEE-NNQLKRNPAKSANSKQDSQEKVNNWEEGKRNQRXXXXXXXXXXXXXNDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDT-VDDLRRRNGELEKEIDRLMRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRLTQSGSTSVIT-------LEKEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADXXXXXXXXXXQVGHKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLKQM 6829
            L +  + L+ NLE A  +++R + +Y  +K+    +D    +   E  +L+ Q++ L EQ+  + +ADD IM+ VN++V++W++IM+E+D ++  L +E  KL+  L  + ++S+KA+V AL +++K++++++ +L++++      +E+N  LIE+L  +L + G         +++E +    ++ K+LRE +++  + EN+ AD     +++EL++ LER + YE GE+GLAEAV EIK  K Q++++ERE E+  Q +NKA     EL  EN  LR KL +     +D+  +R+ KA   EE +A+N  LQ+EIE LE+ER+  KKK+R LA+Q G RA + G+ A D   V D  + L+ +  +Q  +     +++   +K ES  +G   W    +E  +EL          E ++A+L  +N+QL  +N+ +    +++ + L  +  + G G      PV++ P ++++L A+E +K+LG +DT  +LK ++D L+GRNEELRN LR  R+   +  L+ DK  ++++ +  D  +  E G    + + + LPE ++ S+S+ IA LN+HLII LQE S +E  + K + A +NY+RK+A LRH+QG+LY++Y  EK  +++++E    +LK+++G R ED  RI EFDR++DTL+ DD E++RRL+++ R+ITVL+VNE ALTRR++ M+E+E  +RRE  + ++EM Q+EA V++R+GY +R+K+ A +K+  LQK L++SVP  D+ K+  ++  +TEKYR+ LEK N L+ + E++  +E E+ ++  D+E LKK LE EK++ H LEA +EEL   G A  SE S+                D  +IS+SKK+  LEMK++NE++RA+HA  MY+  +   +E E RNKELEEK  E+T  NLE+QKIER++RDEL +SV+K I+DA+++R+  LE+ EL  K EI KLKE+AEIA+ Q   L+ Q ++REKE  SLRQQL D Q QSDEK++IGKLHRHIV LQ+SE SA+++L++  +   +LEAQ+LR EQ  DEKDQ +Y TR + + + ++LR+++  LR QF+G++PLS+ E+F+ ++++L +DK KL+++L+ +   K ++E +    ++ + +  EL   +   R  + V E W SK++G+RL+ LK +R C  L+ +V +LE +I   E  +++++ D  R+ +D+++KQ+ WE RE ELERTI+ +E    E+  AA+ F+ A        +G+LP    P+ NQL+QA++TIK +++VI D + ENK+L+   +E E  +R+ E  +L+R++ I+ELRLR+PA+ DR   + Q       ++  AE    +Y  ++ +  AQ+T+  LQ+R+  KDE++ +Y  LLK+ RED+V  NQ+H EE++ ++ ++               R   N Q   +++   T+ Q    NEL D +A Q  T   L  ++          KQK E   K++ S L       ++E   L E    +   + +KES+IE  ++              E++ LK    R P   MKN + +L  QL  KEKQ Q L   L D++  +  Q+    ++  N+ + + NIQK++++HT+ +S++LE  +    + ++EL+  + ++  +Q EL+ +K + + KE T +KLK  K++LE E DEL  ++++I   R+L + +  K QELD M+ K R +E++ + QL          ++  QE    WEE K+ QR  +K+K K+++++ +I  L+  ++     L+R  REK+ ++  L  K    +L                    A P  + D   +DL+    +L+ EI  L   A  S      + AL E +MRN+ L+  +E +ER +    S S ++         K + +Q++++RLN +N+EL+FE E++RK+IPRLKE+V D + +++ LK E   L G S R      S++S+IKR+G+SGKS +ELEK I  +KKVVE+ Q EN  LK+APGV+  EQ+ LL+ EN  LK +L  L++ +G +L+ERY A+++G A++V+D++KLRK+L +E +E+EK R+ ++ +
Sbjct:  224 LQKRCEDLQRNLEEAITQMDRTSEDYLKLKNVLQQSDAVTDALREENELLKNQVQDLSEQVRSKGEADDAIMVAVNQKVDEWQEIMQEKDIQMVNLQDEIFKLKSQLIAANMDSDKASVSALSEVLKDKDKQIAELTEKVDQYTIEMEKNAALIEDLNNELHKAGSSQGDRMQTKVREFQ----NENKLLRERLQQ-AEAENKKADQDCRVKDKELSELLERMRQYEAGEYGLAEAVNEIKEGKNQVKIREREIEELTQYINKAELKINELLDENEELRYKLGMDPKAPMDLTEFRKNKAIRQEEMKALNFTLQREIEMLEEERVADKKKIRKLAQQLGQRAVALGLTAEDMLAVQDYTETLKAKRQVQEEQQSAAVIIRQQVQKEESMIRGKE-WDKDYKENVAELHKL-------EVQVAELRAQNQQLNKDNENLEAGFKEVMQAL-QKGATEGQGDVDSSAPVMQFPAIERMLAAIEAKKVLGNYDTTYFLKEQMDILKGRNEELRNTLREIRVEVTKTSLERDKAFEKIEKLEKDHFMFSEAGAGPGMFQFMKLPEGMAPSSSEVIAHLNEHLIITLQELSQREGVMKKTEAAFENYKRKYAVLRHQQGMLYQEYLKEKSVWQEDMEKYSKQLKELQGQREEDLVRIQEFDRLVDTLSTDDVEVRRRLSEMTRRITVLRVNEKALTRRHAIMEEIETQLRREVERQRNEMGQMEAAVSERIGYLQRYKDMAAFKIAALQKALEDSVPSADLEKVNKQYHNLTEKYRDMLEKGNTLVSKAEALEGLEGEIKQLTADNEVLKKTLEMEKEKLHALEAAMEELHRRGVASGSEVSV---------------TDGDIISISKKITMLEMKELNERQRAEHASHMYQQQRQILHEMESRNKELEEKFAEVTKMNLEMQKIERDMRDELSNSVTKSISDADRKRISVLEETELTLKQEISKLKEMAEIASTQVRTLETQHIAREKEYQSLRQQLLDFQVQSDEKTIIGKLHRHIVQLQVSEGSAIKRLEEAQKKVTKLEAQMLRQEQRVDEKDQTIYHTRQEAQGKARYLRKSLQELRIQFAGAVPLSKQEKFSRSMMQLQQDKAKLEKDLKESREHKNEMEDKLAALSLQQNSLQELIAVLKDGRGAQKVAE-WHSKIDGIRLDELKQRRMCAKLQQKVRYLEEIITSHEVTISELEADNVRMMKDYEEKQMRWELRETELERTIITMEKHTAEIAGAASKFELA--------VGSLPSAKLPVANQLEQAISTIKGNVKVILDTQAENKSLKARNQELEKLLRDSERGILERDKLISELRLRMPATADRDDIIIQAQAKVTQAIKKAETGGIDYESQQALKIAQSTVHSLQQRINQKDETIAKYMILLKQGREDMVQMNQRHEEELRAMQHKIHMNTDLAFSKFKEAARELINKQ---SSSKTVTAQQLSRLNELEDTVAEQENTISALHEKI----------KQKEEEILKLHAS-LSIFNRNLKSEQTRLAEQHGEI---VGKKESEIEMVSRENEDLRKEVKLLQDEVAALKDVNQRGPTATMKNMVERLKNQLALKEKQHQALSKALTDLRADMVSQA----QVLANDASQEKNIQKIINEHTKQISDQLEDQQTLADRLKKELKKKKDEEGALQTELEDVKEELNKKERTIEKLKASKARLESEVDELEKKMEKITAARSLKAGEFEKQQELDDMRRKCRALEDQLSRQLAAEKPYEQKEEKTKQEDTIRWEESKKWQRTIEKMKVKIKERDKEIETLNGTVNRLKALLERTNREKE-IQAPLIQKTSAVSL-------------------SAAPGGKLDHEREDLKATIYKLQDEIRTLKHQALMS-----QDAALAEVQMRNQHLREQLEQMERAMAARPSDSGVSAAEYQKLFLKNQELQRDVLRLNEENIELRFEVESSRKDIPRLKERVQDLQSYVEALKFENGQLTGDSAR------SSLSSIKRIGESGKSQRELEKTIALLKKVVERVQAENTALKKAPGVVSQEQLNLLKRENDGLKSQLEELRQTMGLELSERYTAQQKGTAKMVNDFDKLRKELAKEKDENEKLRMKIRSL 2241          
BLAST of NPHP6 vs. TrEMBL
Match: A0A1I8I494 (CEP209_CC5 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 1046.19 bits (2704), Expect = 0.000e+0
Identity = 839/2359 (35.57%), Postives = 1345/2359 (57.02%), Query Frame = 2
Query:   53 LKVKTDQLNSMSPD--DIDIIYELMVNIDDISNVDDADKLY-----KAFNIAQFIMSYKAEENKGLNEDLEEANVDXXXXXXXXXXXXXXNAALQRSDGTDINVVREKRNWEMEKESMNQEIRELKSKYNSLTEDNDKKEETINKQQKEIEGLKDSNAKLSDNVEFLRQRTNQLXXXXXXXXXXXXXELAYTRSELRQK----KIDLDNAQEKILELHQEMDHLKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQMRRIKEL-------RQMLDDKEKMLRETVERLNKVENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVLQXXXXXXXXXXXXXXXXVRMLARQAGLRAGSAGMEAGDVM------DAYKALELESSMQNIEYDPVM--QSMARKYESA----------PQGNNTWR-----IKEREMSSELSNAVKERAVKEDEIAKLMTRNRQLQTENDAMCDALRQIKEELVTRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDXXXXXXXXXXXXXXXXXIGFXXXXXXXXXXXXXXXVMDP-MVMMENGWNLEERI---GLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEELGEAPASEQSIKSTSNSPRKTKSKLAVDSHL-----ISMSKKMATLEMKQINEQERADHAVRMYENIKNTWXXXXXXXXXXXXXXXXXXXXXXXXQKIERELRDELIDSVSKEINDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAKFDLETEFQVANIARQTETELKDAMATKRNEKSVLESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEK-SNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKXXXXXXXXXXXXGTRR------AGYNGQLPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQLSIQKQKMETTDKINQSRLXXXXXXXXXXXXDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKNLRNLSSND-AMKQELDAMKIKLRLIEEENNQLKRNPAKSANS-----------KQDSQEKVNNWEEGKRNQRXXXXXXXXXXXXXNDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRLMRN----ADSSDSKTV-NNVALKEAEMRNRILQRNIEDLERRLTQSGSTSVITL-EKEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADXXXXXXXXXXQVGHKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLKQMARDVDKLEKQNADLESKLAISESRG 6904
            +K   DQ+N   P   D+D   E+++N+ D   + D+ K+      K     Q  +    +EN+ L     E   D  K                     +++++ E      E ES+  +IR+ +   + LT +N+  E   N  ++++  ++  N  LS  +  L++R ++              E  Y  S+L QK    K DLD A +   EL ++++ +++ L     E E   + Y++MK+     D +  +   +  +LR Q++ LQ+++      DD IM  VNE+VE+W++ + ++D E+ R  +E  +LR  L    +++ K  +  L + ++ER+  + +L Q+L +          ++E  + D   +G      Q  RI +L       +Q L++  +   E+     K   ++ ++ +EL +   RN     G FGL EAV E KA + +L+   R  E Y++ +NK +  A+ L+ EN  +R +L I  DE LD   +RR KA + EE+ A  +VLQKEIE LEDER+ LK +V+ LA+Q G +A   G+ +G++M      +A +A  + S +  +   P M   +MA    S           P+   T R      +   +  ELS A +E   +E ++ +L T+N  L  EN  M  AL++IK+ +   N  AG+    LECP LDK L A+E +K++G+ D   YLKTR+D+L+GR +E+R ELR SR      +L  DK +   + +   + M+ N     + I    LPEN++ ++ + I +L + L+  L E   +++ + K D++L ++R KFA  RH+Q LLY ++  E+  + +E   L  RL +++G R ED AR++EFDR+LDTL Q   E  RR+ +  RQ+T+L+ NE AL RR++A+QE E+T+RREN +LKSE  ++E  VT+R+GYYRRFKETA +K+N LQK L + VPR D+ +LQ K DE+TEKYR+FLEK N L+ + E++  +E EL ++++D+E LKK L  EK++RH+LEAT+EEL                     SK  VD+ +     ++MSKK++ LEMK++NE+ERADHA +MYE+ K    + + RN+ELEEK  ELT   LE QK ERELRD L   V+KE +D +++R+  LE+ EL+ K E+E+L+E+++IA  Q+   ++QQ+S+EKE  SLRQQL D QCQSDE+++IG+LHRHIV LQ+SET+ALRKL+D     +R EAQ+LR EQ  DE+D+ L Q RL+ R+R K LRET++SLRSQF+G +PL++ ERFT TL+ L EDK++  + L      +   E E       ++T+ EL +A+ T    K V E W  +ME LRL+ L+ +R C+  R +V+HLE V++ QE+ + Q++ED  R+++D++++QLLWEQRE ELER +  +E+   E+   A    +AT +        +PD   PLP QL+QA+ATIK+ I+ IFD E+ENK L+   +E E  ++E E  L+K+ER INELRLRLPA+ DR +Q    +  A  +  +A    N+V+ KT+ AAQTT++ LQ RL+ K+ESL +Y++LLK A++DL  + ++H EE K+LRE+LS +     R+      +   G+LP  +    T    ++ +EL++LLA +   +  L+ +L + + ++   K   +T  K   +     + + + E     E +   K+++ EK + ++   +++ R K +  R P+  MKN + KL  QL +KEKQ + L   L D++  +   + +  +    +   + ++ ++L++HT+++++ELE  +++  + + E R  R +KE    + + LKA+   K+ TA KL+T+K+++EQE +E++ +++RIK  R     D   K E++ ++ K+RL+EEEN + ++ P K   S                  +  WEE KR +R  DKLK+KL  K+ +   L +Q + T  ALDR         +    +                  Q    +A  T S       D+R +N +LE+E+ RL        D  + + +   V++ E        Q  +E  E       S  V  + EK++ ++ ++  L  +N +L FE + AR+++PRLKE+V    K+++LLK EK  LE   N +  SS S+ SNI+R+G+SGKST+ELE+MI R+K VV++T+ ENERLK APGV+  E +Q LR EN  L+ +L+ L+EQ+G +LAERY+AKERG A+++ DYEKLR++L RE + H++TR +  ++ R++ +  + +    S LA ++ RG
Sbjct:   20 VKSIVDQINDFDPGNMDVDGEAEMVLNLYDA--IIDSQKMAHERMEKQTTDLQIALDDLEKENQRLRRTAREGGADADK---------------------ELDLLNENERLNKEVESLQSDIRKKEQDISKLTGENEDLENKRNSLEQKLSEVESENRSLSSRLTTLQERIDR---------TEKSQETKYAISDLNQKVRQLKTDLDLALQGKAELQEKLEKVQKELLDGAAEYESFCARYQDMKAYVDEKDTEAANATGQIEVLRQQVQELQDEIAMLRRDDDNIMNAVNEKVEEWRKHLADKDDELRRAEQEVRELRSRLGALSVDASKEQLAKLQQRLQERDTTIDELRQELSEGTDECNRVKAMLEQFQLDQAASGNTMVSRQADRIGQLLKENQGLKQRLEEGHQQALES----EKASRELEEKNEELVN---RNDQIVAGVFGLKEAVDETKAKERELEYCRRMIEDYVRQINKLHDDADNLRIENSMMRERLGIAPDEVLDTTAHRRAKAVQQEEDSATIMVLQKEIESLEDERMRLKWQVKSLAKQCGGQAAQMGL-SGNLMVLESFVEAERAGGVHSGIDEM-IQPRMAGSAMAAAPGSTMLSSRGGILEPETARTGRSVAGGAEAAGLRQELSRAAREFEEQEKKVCQLQTQNENLSEENRVMESALKEIKDGM--ENRKAGS----LECPSLDKFLAALEAKKVMGDIDASSYLKTRLDHLQGRYDEVRAELRESRAETAANKLQLDKTRALSERLQADLDMVRNVGAASKTIFSLNLPENMTQTSQEVINSLTEQLVQALAEAKKRKEEVSKLDQSLQHFRAKFAVARHQQSLLYAEHLRERTSWSEEKTRLNQRLDELKGERQEDAARLSEFDRLLDTLAQKPEEQARRMVETTRQVTLLRCNEAALVRRFTALQEAEKTLRRENGRLKSEFTEMEKAVTERLGYYRRFKETAAFKVNSLQKALADCVPRDDLDRLQRKLDELTEKYRDFLEKNNSLVHKAETLDTMEMELRQLRLDNETLKKALTVEKEKRHLLEATMEEL---------------------SKRGVDTGVTEQSQVAMSKKLSMLEMKELNERERADHASQMYESQKLQLQQLDARNRELEEKFAELTTRVLEAQKTERELRDSLATCVTKEASDRDRQRISTLEEAELKLKQEVERLRELSDIALSQSKTFREQQVSQEKELTSLRQQLLDFQCQSDERAVIGRLHRHIVQLQLSETTALRKLEDAFAKSRRSEAQMLRLEQRVDERDETLSQHRLECRSRTKQLRETVSSLRSQFAGCVPLAKQERFTKTLLALQEDKLRTKRLLTEAEEQRAKAEDELLAMKTRQETQAELHEALRTGTGAKKVAE-WHQRMEQLRLQELQQRRACERARQQVKHLEGVVRSQEALIGQLEEDAVRLSKDYEERQLLWEQREAELERVVTRMESAGSEIAGTAKRLGEATAS-------DVPDRELPLPLQLEQAVATIKQKIKAIFDLESENKQLKSQMRELEETLKERERALIKKERAINELRLRLPATADRDRQFAAAAAEADAAAASANPMENFVEAKTLHAAQTTVASLQARLQQKEESLAKYKELLKGAQDDLETAVRRHNEEAKMLREKLSQKEELVMRQTAAQQGSAATGELPRESV---TRKHLKKLHELQELLAHERGKSAGLESELREARREMETWKLSYDTAHKGFDAERAVLKEELDEEKRRCTEEVARAKQEVVEKSALVQQLREDLRRQKSENERGPSATMKNLVRKLEMQLEEKEKQQRALSKALTDLRADMVYHAEETAKAGGVQNEQERDLHRILERHTKEIADELELTKERAFRVKSEQRKLREEKEAAVQQCEELKAEVARKDATAAKLRTEKNRMEQEMEEMQKKMERIKAARRSGGADEQTKTEMEELRRKVRLLEEENVRFRQRPEKPFESDIGLSGGRGFGGGGRSGGIEEWEERKRLERTIDKLKDKLGQKQIEFDRLQRQYELTKNALDRSTGGGGGSRHGPPGR------------------QESVSVARLTGSRLQIADADVREKNFQLEEEVSRLRYQLHTLGDEREKEALRRQVSMLEERTEELERQLRLEKPE------FSVEVERMREKQRRLETQLTGLTRENTDLTFEVDQARRDLPRLKERVAHLTKYVELLKQEKAQLEAAGN-TARSSTSSTSNIRRIGESGKSTRELEEMIARLKNVVKRTEAENERLKRAPGVVSQEALQQLRQENDGLRQQLSELREQMGSRLAERYEAKERGTAKLMQDYEKLRRELQRECQSHDRTREEAARLQRELSEAGRGDT-AASTLATAQFRG 2273          
BLAST of NPHP6 vs. TrEMBL
Match: A0A267E763 (CEP209_CC5 domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006149g4 PE=4 SV=1)

HSP 1 Score: 1042.34 bits (2694), Expect = 0.000e+0
Identity = 838/2359 (35.52%), Postives = 1344/2359 (56.97%), Query Frame = 2
Query:   53 LKVKTDQLNSMSPD--DIDIIYELMVNIDDISNVDDADKLY-----KAFNIAQFIMSYKAEENKGLNEDLEEANVDXXXXXXXXXXXXXXNAALQRSDGTDINVVREKRNWEMEKESMNQEIRELKSKYNSLTEDNDKKEETINKQQKEIEGLKDSNAKLSDNVEFLRQRTNQLXXXXXXXXXXXXXELAYTRSELRQK----KIDLDNAQEKILELHQEMDHLKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQMRRIKEL-------RQMLDDKEKMLRETVERLNKVENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVLQXXXXXXXXXXXXXXXXVRMLARQAGLRAGSAGMEAGDVM------DAYKALELESSMQNIEYDPVM--QSMARKYESA----------PQGNNTWR-----IKEREMSSELSNAVKERAVKEDEIAKLMTRNRQLQTENDAMCDALRQIKEELVTRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDXXXXXXXXXXXXXXXXXIGFXXXXXXXXXXXXXXXVMDP-MVMMENGWNLEERI---GLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEELGEAPASEQSIKSTSNSPRKTKSKLAVDSHL-----ISMSKKMATLEMKQINEQERADHAVRMYENIKNTWXXXXXXXXXXXXXXXXXXXXXXXXQKIERELRDELIDSVSKEINDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAKFDLETEFQVANIARQTETELKDAMATKRNEKSVLESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEK-SNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKXXXXXXXXXXXXGTRR------AGYNGQLPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQLSIQKQKMETTDKINQSRLXXXXXXXXXXXXDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKNLRNLSSND-AMKQELDAMKIKLRLIEEENNQLKRNPAKSANS-----------KQDSQEKVNNWEEGKRNQRXXXXXXXXXXXXXNDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRLMRN----ADSSDSKTV-NNVALKEAEMRNRILQRNIEDLERRLTQSGSTSVITL-EKEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADXXXXXXXXXXQVGHKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLKQMARDVDKLEKQNADLESKLAISESRG 6904
            +K   DQ+N   P   D+D   E+++N+ D   + D+ K+      K     Q  +    +EN+ L     E   D  K                     +++++ E      E ES+  +IR+ +   + LT +N+  E   N  ++++  ++  N  LS  +  L++R ++              E  Y  S+L QK    K DLD A +   EL ++++ +++ L     E E   + Y++MK+     D +  +   +  +LR Q++ LQ+++      DD IM  VNE+VE+W++ + ++D E+ R  +E  +LR  L    +++ K  +  L + ++ER+  + +L Q+L +          ++E  + D   +G      Q  RI +L       +Q L++  +   E+     K   ++ ++ +EL +   RN     G FGL EAV E KA + +L+   R  E Y++ +NK +  A+ L+ EN  +R +L I  DE LD   +RR KA + EE+ A  +VLQKEIE LEDER+ LK +V+ LA+Q G +A   G+ +G++M      +A +A  + S +  +   P M   +MA    S           P+   T R      +   +  ELS A +E   +E ++ +L T+N  L  EN  M  AL++IK+ +   N  AG+    LECP LDK L A+E +K++G+ D   YLKTR+D+L+GR +E+R ELR SR      +L  DK +   + +   + M+ N     + I    LPEN++ ++ + I +L + L+  L E   +++ + K D++L ++R KFA  RH+Q LLY ++  E+  + +E   L  RL +++G R ED AR++EFDR+LDTL Q   E  RR+ +  RQ+T+L+ NE AL RR++A+QE E+T+RREN +LKSE  ++E  VT+R+GYYRRFKETA +K+N LQK L + VPR D+ +LQ K DE+TEKYR+FLEK N L+ + E++  +E EL ++++D+E LKK L  EK++RH+LEAT+EEL                     SK  VD+ +     ++MSKK++ LEMK++NE+ERADHA +MYE+ K    + + RN+ELEEK  ELT   LE QK ERELRD L   V+KE +D +++R+  LE+ EL+ K E+E+L+E+++IA  Q+   ++QQ+S+EKE  SLRQQL D QCQSDE+++IG+LHRHIV LQ+SET+ALRKL+D     +R EAQ+LR EQ  DE+D+ L Q RL+ R+R K LRET++SLRSQF+G +PL++ ERFT TL+ L EDK++  + L      +   E E       ++T+ EL +A+ T    K V E W  +ME LRL+ L+ +R C+  R +V+HLE V++ QE+ + Q++ED  R+++D++++QLLWEQRE ELER +  +E+   E+   A    +AT +        +PD   PLP QL+QA+ATIK+ I+ IFD E+ENK L+   +E E  ++E E  L+K+ER INELRLRLPA+ DR +Q    +  A  +  +A    N+V+ KT+ AAQTT++ LQ RL+ K+ESL +Y++LLK A++DL  + ++H EE K+LRE+LS +     R+      +   G+LP  +    T    ++ +EL++LLA +   +  L+ +L + + ++   K   +T  K   +     + + + E       +   K+++ EK + ++   +++ R K +  R P+  MKN + KL  QL +KEKQ + L   L D++  +   + +  +    +   + ++ ++L++HT+++++ELE  +++  + + E R  R +KE    + + LKA+   K+ TA KL+T+K+++EQE +E++ +++RIK  R     D   K E++ ++ K+RL+EEEN + ++ P K   S                  +  WEE KR +R  DKLK+KL  K+ +   L +Q + T  ALDR         +    +                  Q    +A  T S       D+R +N +LE+E+ RL        D  + + +   V++ E        Q  +E  E       S  V  + EK++ ++ ++  L  +N +L FE + AR+++PRLKE+V    K+++LLK EK  LE   N +  SS S+ SNI+R+G+SGKST+ELE+MI R+K VV++T+ ENERLK APGV+  E +Q LR EN  L+ +L+ L+EQ+G +LAERY+AKERG A+++ DYEKLR++L RE + H++TR +  ++ R++ +  + +    S LA ++ RG
Sbjct:   24 VKSIVDQINDFDPGNMDVDGEAEMVLNLYDA--IIDSQKMAHERMEKQTTDLQIALDDLEKENQRLRRTAREGGADADK---------------------ELDLLNENERLNKEVESLQSDIRKKEQDISKLTGENEDLENKRNSLEQKLSEVESENRSLSSRLTTLQERIDR---------TEKSQETKYAISDLNQKVRQLKTDLDLALQGKAELQEKLEKVQKELLDGAAEYESFCARYQDMKAYVDEKDTEAANATGQIEVLRQQVQELQDEIAMLRRDDDNIMNAVNEKVEEWRKHLADKDDELRRAEQEVRELRSRLGALSVDASKEQLAKLQQRLQERDTTIDELRQELSEGTDECNRVKAMLEQFQLDQAASGNTMVSRQADRIGQLLKENQGLKQRLEEGHQQALES----EKASRELEEKNEELVN---RNDQIVAGVFGLKEAVDETKAKERELEYCRRMIEDYVRQINKLHDDADNLRIENSMMRERLGIAPDEVLDTTAHRRAKAVQQEEDSATIMVLQKEIESLEDERMRLKWQVKSLAKQCGGQAAQMGL-SGNLMVLESFVEAERAGGVHSGIDEM-IQPRMAGSAMAAAPGSTMLSSRGGFLEPETARTGRSVAGGAEAAGLRQELSRAAREFEEQEKKVCQLQTQNENLSEENRVMESALKEIKDGM--ENRKAGS----LECPSLDKFLAALEAKKVMGDIDASSYLKTRLDHLQGRYDEVRAELRESRAETAANKLQLDKTRALSERLQADLDMVRNVGAASKTIFSLNLPENMTQTSQEVINSLTEQLVQALAEAKKRKEEVSKLDQSLQHFRAKFAVARHQQSLLYAEHLRERTSWSEEKTRLNQRLDELKGERQEDAARLSEFDRLLDTLAQKPEEQARRMVETTRQVTLLRCNEAALVRRFTALQEAEKTLRRENGRLKSEFTEMEKAVTERLGYYRRFKETAAFKVNSLQKALADCVPRDDLDRLQRKLDELTEKYRDFLEKNNSLVHKAETLDTMEMELRQLRLDNETLKKALTVEKEKRHLLEATMEEL---------------------SKRGVDTGVTEQSQVAMSKKLSMLEMKELNERERADHASQMYESQKLQLQQLDARNRELEEKFAELTTRVLEAQKTERELRDSLATCVTKEASDRDRQRISTLEEAELKLKQEVERLRELSDIALSQSKTFREQQVSQEKELTSLRQQLLDFQCQSDERAVIGRLHRHIVQLQLSETTALRKLEDAFAKSRRSEAQMLRLEQRVDERDETLSQHRLECRSRTKQLRETVSSLRSQFAGCVPLAKLERFTKTLLALQEDKLRTKRLLTEAEEQRAKAEDELLAMKTRQETQAELHEALRTGTGAKKVAE-WHQRMEQLRLQELQQRRACERARQQVKHLEGVVRSQEALIGQLEEDAVRLSKDYEERQLLWEQREAELERVVTRMESAGSEIAGTAKRLGEATAS-------DVPDRELPLPLQLEQAVATIKQKIKAIFDLESENKQLKSQMRELEETLKERERALIKKERAINELRLRLPATADRDRQFAAAAAEADAAAASANPMENFVEAKTLHAAQTTVASLQARLQQKEESLAKYKELLKGAQDDLETAVRRHNEEAKMLREKLSQKEELVMRQTAAQQGSAATGELPRESV---TRKHLKKLHELQELLAHERGKSAGLESELREARREMETWKLSYDTAHKGFDAERAVLKEELDEEKRRCTVEVARAKQEVVEKSALVQQLREDLRRQKSENERGPSATMKNLVRKLEMQLEEKEKQQRALSKALTDLRADMVYHAEETAKAGGVQNEQERDLHRILERHTKEIADELELTKERAFRVKSEQRKLREEKEAAVQQCEELKAEVARKDATAAKLRTEKNRMEQEMEEMQKKMERIKAARRSGGADEQTKTEMEELRRKVRLLEEENVRFRQRPEKPFESDIGLSGGRGFGGGGRSGGIEEWEERKRLERTIDKLKDKLGQKQIEFDRLQRQYELTKNALDRSTGGGGGSRHGPPGR------------------QESVSVARLTGSRLQIADADVREKNFQLEEEVSRLRYQLHTLGDEREKEALRRQVSMLEERTEELERQLRLEKPE------FSVEVERMREKQRQLETQLTGLTRENTDLTFEVDQARRDLPRLKERVAHLTKYVELLKQEKAQLEAAGN-TARSSTSSTSNIRRIGESGKSTRELEEMIARLKNVVKRTEAENERLKRAPGVVSQEALQQLRQENDGLRQQLSELREQMGSRLAERYEAKERGTAKLMQDYEKLRRELQRECQSHDRTREEAARLQRELSEAGRGDT-AASTLATAQFRG 2277          
BLAST of NPHP6 vs. Ensembl Cavefish
Match: cep290 (centrosomal protein 290 [Source:NCBI gene;Acc:560588])

HSP 1 Score: 759.599 bits (1960), Expect = 0.000e+0
Identity = 673/2149 (31.32%), Postives = 1197/2149 (55.70%), Query Frame = 2
Query:  818 RMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQMRRIKELRQMLDDKEKMLRETVERLNKVENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVLQXXXXXXXXXXXXXXXXVRMLARQAGLRAGSAGMEAGDVMDAY--KALELESSMQNIEYDPVMQSMARKYESAPQGNNTWRIKEREMSSELSNAVKERAVKEDEIAKLMTRNRQLQTENDAMCDALRQIKEELVTRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDXXXXXXXXXXXXXXXXXIGFXXXXXXXXXXXXXXXVMDP---MVMMENGWNLEER-IGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLE---ELGEAPASEQSIKSTSNSPRKTKSKLAVDSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNTWXXXXXXXXXXXXXXXXXXXXXXXXQKIERELRDELIDSVSKEINDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAKFDLETEFQVANIARQTETELK-----DAMATKRNEKSV--LESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKXXXXXXXXXXXXGTRRAGYNGQLPM--ATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQLSIQKQKMETTDKINQSRLXXXXXXXXXXXXDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKN-LRNLSSNDAMKQELDAMKIKLRLIEEE-NNQLKRNPAKSANSKQD---SQEKVNNWEEGKRNQRXXXXXXXXXXXXXNDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRL-MRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRL--------TQSGSTSVITLEKEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADXXXXXXXXXXQVGHKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLKQMARDVDKLEKQNADLESKLAISESRG------------RQNVSRIANKELQDENRKLS---SIIANLQSQLKDKHNQNPDSSKV-----EELKLLYNKATERVS--FLEKQLQS 7102
            R  +  L EQ+  R + DD +M  V+ +VE+WK ++ E+D EI    +    LR  L+ + ++S+K+N+ AL + V+ER+ ++K LS ++      +E+N  LIE LKK +++  G  S  Q+R+++EL+  L   E+ +++     +  E    ++++EL+++L R ++YE G  GL  A+AEI+ CK Q+++++RE E   + +N+      +L  EN  LR KL +   E++D+  +RR KA +  + RA N VL KEIE+LE+ERL LK+ +R L +  G           D+   Y    + L S +QN EY                           + ++L++  KE  +K+ E ++L  R  + Q EN  +   +++I + +  ++ S  + + +   P L++L+ A+E +   G+ D G +L+ ++D L  RNEEL+ EL+ +R           K   ++  ++     V +  G  + ++ + LPE  ++S+ +TI +LN++++ +LQE   K+        AL+ Y+RKFA +RH+QGLLY++Y  EK+ +++E  +       +E  +  D  +I E++  L+ L +D  E++R++++  R++TVL+VNE +LTR+Y+ + E EQ +R+ENNKLK + +Q+E  VT R+GY +RFKE A +K+  LQK LD+SVP  ++ +   +++++T KYR+ L+K N L+ R   +  +E+E   +     ++ K LE  K++ H LE   E   ++GE  +  +++K+ +N            S ++S+SK++ TLEMK++NE++RA+HA +MYE+++N+  + E+RN ELE +  E+   NLE Q+IERELRDEL DSVSKE++DA+++ + ELEK E + + E+ KL+E++++A MQ +AL+ ++ SREKE  SLR+Q+ D Q QSDEKSLI KLH+HIV LQ+SET+A+ KL+       +LEAQ LR EQ+ D + Q L+  R +GR R +HLR  + +LR+QFSG++PL++ E+F++T+++L E + K  ++ Q        ++ E ++A   R  E EL+     + MAT ++ K    +  W  K+E  RL+ L+  R+    R E+ +L+++I  QE  ++ ++E++ +     +++QL W+ RE ELER +   +  Q ++I +A  F++AT         +LPDPS PL +QL QA++ IK+H+R I + +   K L +  K  E  + + E  +L R+R INELRLRLPA+ +R + +  +S          ++ +   +  +  A  T+S LQ RL  K+E L +Y+ LL +AR++   +++KH EE++ L ++L               Q  M   T  V T+ Q     EL   +A Q  +   L  +L  +  +L  Q+Q   +  K + ++  + E +  +++  + +     + ++++ E ++++   E+   K    RSP+  MKN + +L  QL  KEKQ + L   L +++  +T  +   +  +  +     NIQ+++DK T+DL   ++   +++  ++  +R+A++ +  ++ EL+ L  +    + +  +L++++  LE++ +EL+ +++R+ + L+  + ++     ++ ++ K+R +E E + +    PA+     +D   S+E++  WEE K+ Q   +K +  L++KE     LSKQL+T  +   R+ +EK  ++ +L  +   G   D               +  A        ++ L+ RN ELE++I+ + ++ A   D+      A+++  +RNR L+  I  LE +L        + SG  S    ++E  +QK+ +RL+ +NLEL+F+ E A K++PRLK +V+D K+  D+LK EK                 + +    G SGK+  ELEK I  MKKVVEK QRENE LK++      EQ+  L  E+   K E   +KE++   L  R D+K +GM ++V + E+L KD+ + +E  EK R++   +     KL+ +  +   KL +++S+G               V+R+   +++D   +LS   + I+    +LK+ H +  D+ +      E+++LL N   E ++   L +Q QS
Sbjct:  182 RNPVRELTEQIQSRAEEDDPVMAAVSAKVEEWKNVLSEKDVEIMEYQQMIRDLREKLRAAHLDSDKSNIIALQQAVQERDHQIKLLSARVEQYTGEMEKNALLIEELKKPMKKEKGMGSTLQLRKLEELQAKLQAAERRVQQAEREAHLAEADAHEKDKELSESLSRIRLYEAGTDGLEAAIAEIRECKNQIRLRDRELEVMTKEINQLELKINDLLDENEELREKLGMNPKEEVDLTEFRRTKALKQRQYRAENQVLLKEIERLEEERLELKQHIRTLVKDKG----------KDLFSYYLLTFVFLASFLQN-EY---------------------------LQNQLNSREKELELKKAESSQLKARLNKTQKENQQLEQDMKEILQAIQAQSKSP-SQIGISRIPSLERLISALEIKYSEGKVDIGTHLRFQLDQLTSRNEELKQELKAAREEAASTLSQLMKSSDKVARLESEIEAVRLSAGAAVPQKTLPLPEESASSSVKTINSLNEYMVQLLQENKNKQDHNKMLGLALEEYKRKFAVIRHQQGLLYKEYQSEKESWQKERHSFAELKAKMEEQKEVDAVKIKEYNNWLEALEKDPVEMRRQVSEAARRMTVLRVNEKSLTRQYTTLLEQEQHLRKENNKLKEDFVQMETAVTKRIGYLQRFKEMAAFKMAALQKALDDSVPSFELERANKQYNDLTIKYRDLLQKDNYLVQRTTGLEHMENENVSLHEQINSVNKELEITKEKLHTLEQAWEHINDIGEESSINKAVKALAN------------SEIVSVSKRITTLEMKELNERQRAEHAQKMYEHLRNSLKQVEERNLELEGRFAEMAKQNLEAQRIERELRDELADSVSKEVSDADRQHIAELEKSEAQLRIEVSKLREVSDVAKMQVSALEARRQSREKEVESLRRQVLDYQAQSDEKSLIAKLHQHIVALQLSETAAISKLEASTARLLKLEAQQLRAEQHLDAQQQALWHERQEGRQRARHLRHALQALRTQFSGALPLAQQEKFSNTMLQLQEAQQKARKDAQ-------RIQEEHKMAE-GRAQELELRLKSLEELMATIKDGKGAQKVSEWHKKLEEARLQELRKNRELGAQREEIRYLKNMIDEQERIISSLEEELVQQNNLQEERQLSWDHREVELERQLEAYDKQQRQIIGSAQKFEEAT--------DSLPDPSQPLAHQLGQALSKIKEHVRTILETQAVCKTLEEKLKVKEAALWQAEQNVLARDRVINELRLRLPAAAERERLLADLS----------KQEDLNSQPALKIAHQTISNLQGRLDQKEEVLKKYQNLLVKARQEQEETSKKHDEEVRNLHQKLDLHTDKSLDHFRQTAQELMKKPTITVPTTKQLARLAELEQTVAEQDTSILSLTHKLKMLNAELEKQRQATASQAKDHTAQTAKLEERHASQMKAVSQEAEEHRSQVSQMEKELQYLRTELEAQKAANVRSPSNTMKNLVERLKAQLALKEKQQKALSKALLELRAEMTSHAEQQIIASAAQKEESLNIQQIVDKQTKDLKTHVKELSEELQSWKENVRAAKSRESSLKEELESLSRELQKSQKSQSRLQSERGALEEQVEELKQKVRRLHSGLQGQTESEIKGPSVETLQKKIRKLESELDKKSVSEPAERKTLVKDDKTSKEELVRWEEAKKWQAKVEKFQNHLKEKERQTDLLSKQLNTLKELYGRLEQEKAGLQKKLKSR---GVTAD--------------QVVGARTVETDKEIESLKNRNCELEQQIEIMKLQQALPRDA------AMEDINIRNRYLEERIYSLESQLKKDPFSRPSTSGRGSGTPSQREHELQKDNLRLSTENLELRFQLEQANKDLPRLKHQVSDLKEMCDVLKKEK-----------AEVEKKLGHGHGTGRSGKTVPELEKTIALMKKVVEKVQRENESLKKSSATTTQEQLTTLEREHEKFKAEYDKMKEKMDFHLTSRLDSKMKGMEKIVMENERLHKDIKKVSEALEKLRVENTSLVVKNKKLKAELDETTQKLLLAQSKGPSLERADGKSWKSTVVTRLYENKMKDLESELSKNKASISEFNLKLKESHEREKDAQRTIIQLKEQVELLKNTPIEGITEEGLAQQFQS 2219          
BLAST of NPHP6 vs. Ensembl Nematostella
Match: EDO40972 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5V4])

HSP 1 Score: 239.195 bits (609), Expect = 3.031e-69
Identity = 157/398 (39.45%), Postives = 247/398 (62.06%), Query Frame = 2
Query: 3353 QKIERELRDELIDSVSKEINDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAKFDLETEFQVANIARQTETELKDAMATKRNEKSVLESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRER 4546
            Q+IER+LR+EL  +V++ ++++  +R+  LE+ E   K E  +LKE+AE+A  Q  +L+ QQ  +E+E  +LR+QL D+Q +SDEK++IGKLH HIV LQ+SE +A+RKL+   +   +LEAQ+LR EQ  DEKDQ LY ++ + R + K L+ TI  LR Q+SG++PL + E+F +T+  L EDK  L+++L+     +   E +     +  +   EL   +   +    V E W +KM  +R++ LK  R  D ++ +   LE++ K  E  ++  ++DI  +T+ H+++QLLWEQRE ELER I   E  Q EV+ AA  F++AT        G+LPDPS P+ NQL+ A+  I++HIRVI     EN  L K  +E E  +++ E  L ++++
Sbjct:    7 QRIERQLREELEGAVTQAMHESVVKRLQVLEESEARLKVEESRLKEVAEVAAHQAESLKSQQDGQERELMALRKQLYDVQMESDEKTIIGKLHHHIVALQVSEGTAVRKLEAATQKVSKLEAQILRLEQKIDEKDQILYHSKTEARNKAKFLKRTIQDLRRQYSGALPLMKQEKFANTMRALHEDKANLERDLRKVTEDRLLAEDKLSELELKHRNLEELIATLKDGKGAAKVTE-WHTKMNEIRIQDLKLNRTIDRMKEQCRFLENLNKQHERTISDYEDDIVEMTKHHEERQLLWEQREVELERMIDRFEKQQSEVMNAAQKFEEAT--------GSLPDPSLPVANQLELAVRKIREHIRVIISTREENNRLGKKVEEAEQALKQSEERLTQKDK 395          
BLAST of NPHP6 vs. Ensembl Nematostella
Match: EDO40973 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5V5])

HSP 1 Score: 115.161 bits (287), Expect = 7.448e-27
Identity = 89/310 (28.71%), Postives = 170/310 (54.84%), Query Frame = 2
Query:  665 ELHQEMDHLKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQMRRIKELRQMLDDKEKMLRE-TVERLNKVENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVL 1591
            EL  ++D  K  LE AT E+++I  EY  +K+    +D  L+    E   LR Q++ L+ Q++ + DADD+IM+ VN +VE+WK ++  +D EI +  +    L+  ++   ++++   +  L + + E++ +++ L  +L       E +  +++++         G +      + E++   D   K+ R+  +    K E     +++EL+D + R   YE+GE+GL+EAV EIK  KAQLQ++++  E    +VNK + A  +L+ EN  LR +L +   ++LD+E  ++++  + E+  A+N VL
Sbjct:   78 ELEMKLDESKRELEAATTEMDKIADEYTKLKTILQQSDLILEEMRRERDALRAQVQDLRVQVSSKTDADDEIMMAVNVKVEEWKAVLVAKDIEIEQYKDMVNGLQQRIRGLEMDTDSTTMALLQQAIVEKDDQIQMLKSELEKVGKYQETSFVIVDSMHLQASTEMQGIAAQ----VDEVKSQAD---KVYRKRKIRFFFKAEEAARQKDKELSDLMVRMVQYEKGEYGLSEAVQEIKDHKAQLQIRDQNIESLTASVNKLSLAVNDLEMENEELRERLGMDPRDRLDIEEIKQKRKVKKEQSAALNRVL 380          
BLAST of NPHP6 vs. Ensembl Nematostella
Match: EDO29675 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2Z1])

HSP 1 Score: 83.1889 bits (204), Expect = 8.290e-16
Identity = 122/494 (24.70%), Postives = 241/494 (48.79%), Query Frame = 2
Query: 5234 MKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRI-----KNLRNLSSNDAMKQELDAMKIKLRLIEEENNQLKRN--------PAKSANSKQDSQ---------EKVNNWEEGKRNQRXXXXXXXXXXXXXNDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRLMRNADSSDSKTVNNVALKEA-EMRNRILQRNIEDLERRLTQ------------SGSTSVITLEKEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGV 6610
            MK  + +L  QL  KEKQ + L   L  ++  +   + + +++   +   + N+Q V++K T  L + +E  + ++ + +REL+  +  +  +Q E + LK     K+    KL  +  +L +   +L  + + +     K  R  S  D +++++ +++ +L++   E   +           P  +  S +D           E+V  WEEGK+ Q+  + L+EKL +K  ++    K +    +A++R  ++K  +++RL      G+           +A  R P     P    D + +L+ +   LE+E      N D    +T+ +    EA ++RN  LQ  ++ LE  L+Q            +G    +  +K +++QK+++    +N+EL+F+ E ARKE PRLK +V D ++++++LK+E E+   K  ++ + S  T       G  G+S +++E+++  M++VVE+ Q ENE+LK+  G 
Sbjct:    1 MKALVERLRNQLALKEKQQKSLSQALLQLRADMVTTAEENVQIHAKKAEQEVNVQHVVEKETSSLQSRIEELQSRMEKLKRELKRQKEKESTLQGEKERLKEQLAQKDSAINKLGVELKELHEIEQKLDGKAEELAAEKRKATRATSEADKLREKVKSLQEQLKVQRAEGEVVAAATVEVEGAVPPSAEISPRDEDRGTKTSKRGEEVARWEEGKKWQKKVETLREKLSEKTKELEKAEKTISMLREAVNRGEKDKTGLQSRLRSAARVGS-----------TAVTRPP-----PD---DFIQELKHKIFTLEEE------NQDLRRQQTLGHDRQMEALQLRNDQLQDAVQSLENELSQRVTEQRSIDQADAGMYRDLH-QKNQSLQKQLLEARQENMELRFDYEQARKENPRLKARVEDLQEYVEILKAELES-SKKREKARKKSLGT-------GLGGQSVEDMERVLAAMRRVVERLQGENEQLKKTAGA 460          
BLAST of NPHP6 vs. Ensembl Medaka
Match: ENSORLT00000033960.1 (pep primary_assembly:ASM223467v1:6:2318704:2335450:-1 gene:ENSORLG00000023432.1 transcript:ENSORLT00000033960.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.168 bits (300), Expect = 1.556e-27
Identity = 87/302 (28.81%), Postives = 161/302 (53.31%), Query Frame = 2
Query:  686 HLKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQMRRIKELRQMLDDKEKMLRETVERLNKVENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVL 1591
             ++++LE +  E+E++T EY  MK +   TD  +     E    ++Q+  L +++      +D IM  VN +VE+WK ++  +D EI   ++    LR  L+ + ++ +K+NV AL + V+ER+ ++K LS+Q+      +E++  LI+ LK     T     G Q R+++EL+ +L   E    E  + L   E    ++++ L +A  R   YE G +GL  A+AEIK C  Q+++++ E E   + +N+      +L  EN  LR KL +   E++++  ++R +     + +A N +L
Sbjct:  164 QMQKSLEESVKEMEKMTDEYNKMKIDVEQTDSIMDQLRQERDHAKLQVRELADKIQSMTQENDPIMAAVNAKVEEWKVLLSGKDEEILVYHQMIQDLREKLRSAQLDLDKSNVMALQQAVQERDNQIKMLSEQVEQYTGEMEKHAQLIQQLK-----TSTSKGGTQQRKMEELKSLLRAAESRAAEAEQALKLAEAHAEEKDRALIEASNRLTQYESGTYGLEAAIAEIKECNNQIRLRDCEAEAMTKEINQLGLRINDLMDENEGLREKLGLDPREEVNLTEFKRARDLRQRQYKAENQIL 460          
BLAST of NPHP6 vs. Ensembl Medaka
Match: ENSORLT00000043328.1 (pep primary_assembly:ASM223467v1:6:2309345:2331722:-1 gene:ENSORLG00000023432.1 transcript:ENSORLT00000043328.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.153 bits (274), Expect = 9.067e-24
Identity = 96/365 (26.30%), Postives = 181/365 (49.59%), Query Frame = 2
Query:  500 NAKLSDNVEFLRQRTNQ-LXXXXXXXXXXXXXELAYTRSELRQKKIDLDNAQEKILELHQEMDHLKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQMRRIKELRQMLDDKEKMLRETVERLNKVENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVL 1591
            N +L  +V+F R+  +Q +        D  + +L     +L Q   DL   +++   L  + + ++++LE +  E+E++T EY  MK +   TD  +     E    ++Q+  L +++      +D IM  VN +VE+WK ++  +D EI   ++    LR  L+ + ++ +K+NV AL + V+ER+ ++K LS+Q+      +E++  LI+ LK    + G  S     +R        D       E  + L   E    ++++ L +A  R   YE G +GL  A+AEIK C  Q+++++ E E   + +N+      +L  EN  LR KL +   E++++  ++R +     + +A N +L
Sbjct:  109 NEQLQQDVDFYRRELDQRVLLPSRDEADETQRKLNLANRQLYQCLEDLQRTEDENAHLKTQNEQMQKSLEESVKEMEKMTDEYNKMKIDVEQTDSIMDQLRQERDHAKLQVRELADKIQSMTQENDPIMAAVNAKVEEWKVLLSGKDEEILVYHQMIQDLREKLRSAQLDLDKSNVMALQQAVQERDNQIKMLSEQVEQYTGEMEKHAQLIQQLKTSTSKGGRSSCPTTYQR---WFITCDRWSLQTAEAEQALKLAEAHAEEKDRALIEASNRLTQYESGTYGLEAAIAEIKECNNQIRLRDCEAEAMTKEINQLGLRINDLMDENEGLREKLGLDPREEVNLTEFKRARDLRQRQYKAENQIL 470          

HSP 2 Score: 57.7658 bits (138), Expect = 1.665e-7
Identity = 26/64 (40.62%), Postives = 44/64 (68.75%), Query Frame = 2
Query: 2279 IGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQY 2470
            + LPE LS S+++ I++LN++ + +LQE   KE+   K    L+ Y+ KFA + H+QGLLY+++
Sbjct:  602 LTLPEGLSPSSTEVISSLNEYAVRLLQELGNKEELNKKLTGTLEEYKEKFAVVSHQQGLLYKEH 665          
BLAST of NPHP6 vs. Ensembl Medaka
Match: ENSORLT00000041224.1 (pep primary_assembly:ASM223467v1:4:31791053:31792326:-1 gene:ENSORLG00000022320.1 transcript:ENSORLT00000041224.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.1073 bits (196), Expect = 1.802e-16
Identity = 45/150 (30.00%), Postives = 90/150 (60.00%), Query Frame = 2
Query: 2828 LNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEELGEAPASEQSIKSTSNSPRKTKSKLAVDSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNT 3277
            +  LQK LD+SVP  ++ +   ++ E+T KYR+ L++ + LI R  ++  ++SE   ++    A+ K LE  K++ + LE   E++    A          +    + K  +++ ++S ++++ TLEMK++NE++RA+HA +MYE+++N+
Sbjct:    1 MTALQKALDDSVPLSELERANRQYTELTIKYRDVLQRDSCLIQRSTNLQHLQSENDSLQEQISAMIKELEITKEKLNTLEQAWEKVNTVGAE---------TGLDKEGKATINNEMVSAARRITTLEMKELNERQRAEHAHKMYEHVRNS 141          
BLAST of NPHP6 vs. Ensembl Medaka
Match: ENSORLT00000027967.1 (pep primary_assembly:ASM223467v1:6:2304565:2305828:-1 gene:ENSORLG00000028369.1 transcript:ENSORLT00000027967.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 4.681e-13
Identity = 40/145 (27.59%), Postives = 86/145 (59.31%), Query Frame = 2
Query: 2843 KELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEELGEAPASEQSIKSTSNSPRKTKSKLAVDSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNT 3277
            ++L + VP  ++ +   ++ E+T KYR+ L++ + LI R  ++  ++SE   ++    A+ K LE  K++ + LE   E++    A          +    + K  +++ ++S ++++ TLEMK++NE++RA+HA +MYE+++N+
Sbjct:    3 RKLHKCVPLSELERANRQYTELTIKYRDVLQRDSCLIQRSTNLQHLQSENDSLQEQISAMIKELEITKEKLNTLEQAWEKVNTVGAE---------TGLDKEGKATINNEMVSAARRITTLEMKELNERQRAEHAHKMYEHVRNS 138          
BLAST of NPHP6 vs. Planmine SMEST
Match: SMESG000072747.1 (SMESG000072747.1)

HSP 1 Score: 4352.74 bits (11288), Expect = 0.000e+0
Identity = 2359/2372 (99.45%), Postives = 2365/2372 (99.70%), Query Frame = 2
Query:   26 MSSSDWDRILKVKTDQLNSMSPDDIDIIYELMVNIDDISNVDDADKLYKAFNIAQFIMSYKAEENKGLNEDLEEANVDXXXXXXXXXXXXXXNAALQRSDGTDINVVREKRNWEMEKESMNQEIRELKSKYNSLTEDNDKKEETINKQQKEIEGLKDSNAKLSDNVEFLRQRTNQLXXXXXXXXXXXXXELAYTRSELRQKKIDLDNAQEKILELHQEMDHLKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQMRRIKELRQMLDDKEKMLRETVERLNKVENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVLQXXXXXXXXXXXXXXXXVRMLARQAGLRAGSAGMEAGDVMDAYKALELESSMQNIEYDPVMQSMARKYESAPQGNNTWRIKEREMSSELSNAVKERAVKEDEIAKLMTRNRQLQTENDAMCDALRQIKEELVTRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDXXXXXXXXXXXXXXXXXIGFXXXXXXXXXXXXXXXVMDPMVMMENGWNLEERIGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEELGEAPASEQSIKSTSNSPRKTKSKLAVDSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNTWXXXXXXXXXXXXXXXXXXXXXXXXQKIERELRDELIDSVSKEINDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAKFDLETEFQVANIARQTETELKDAMATKRNEKSVLESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKXXXXXXXXXXXXGTRRAGYNGQLPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQLSIQKQKMETTDKINQSRLXXXXXXXXXXXXDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKNLRNLSSNDAMKQELDAMKIKLRLIEEENNQLKRNPAKSANSKQDSQEKVNNWEEGKRNQRXXXXXXXXXXXXXNDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRLMRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRLTQSGSTSVITLEKEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADXXXXXXXXXXQVGHKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLKQMARDVDKLEKQNADLESKLAISESRGRQNVSRIANKELQDENRKLSSIIANLQSQLKDKHNQNPDSSKVEELKLLYNKATERVSFLEKQLQSFSEQFGVAIDLGY 7141
            MSSSDWDRILKVKTDQLNSMSPDDIDIIYELMVNIDDISNVDDADKLYKAFNIAQFIMSYKAEENKGLNEDLEEANVDIKKLKIIKEELEKENAALQRSDGTDINVVREKRNWEMEKESMNQEIRELKSKYNSLTEDNDKKEETINKQQKEIEGLKDSNAKLSDNVEFLRQRTNQLKNQKDQNQDSNKSELAYTRSELRQKKIDLDNAQEKILELHQEMDHLKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMND+NDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQMRRIKELRQMLDDKEKMLRETVERLNKVENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVLQKEIEKLEDERLLLKKKVRMLARQAGLRAGSAGMEAGDVMD YKALELESSMQNIEYDPVMQSMARKYESAPQGNNTWRIKEREMSSELSNAVKERAVKEDEIAKLMTRNRQLQ ENDAMCDALRQIKEELVTRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDNLEGRNEELRNELRNSRIGFQQLQLDHDKLKQRLKVMDPMVMMENGWNLEERIGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEELGEAPASEQSIKSTSNSPRKTKSKLAVDSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNTWNEAEKRNKELEEKLTELTNHNLELQKIERELRDELIDSVSKEINDAEKRRVLELEKRELEGKHEIEKLKEIAEIATMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAKFDLETEFQ ANIARQTETELKDAMATKRNEKSVLESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGT+PDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLV SNQKHGEEIKLLRERLSAEAAAGTRRAGYNGQLPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQLSIQKQKMETTDKINQSRLKETEIK ENEIIDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPN+EMKNAMVKLTEQLRDKEKQLQILKANLADVKKTI DQSIDALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKNLRNLSSNDAMKQELDAMKIKLRLIEEENNQLKRNP+KSANSKQDSQEKVNNWEEGKRNQRLQDKLKEKLQDKENDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRLMRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRLTQSGSTSVITLEKEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADLKLELAALKEQVG+KLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLKQMARDVDKLEKQNADLESKLAI+ESRGRQNVSRIANKELQDENRKLSSIIANLQSQLKDKHNQNPDSSKVEELKL YNKATERVSFLEKQLQSFSEQFGVAIDLGY
Sbjct:    1 MSSSDWDRILKVKTDQLNSMSPDDIDIIYELMVNIDDISNVDDADKLYKAFNIAQFIMSYKAEENKGLNEDLEEANVDIKKLKIIKEELEKENAALQRSDGTDINVVREKRNWEMEKESMNQEIRELKSKYNSLTEDNDKKEETINKQQKEIEGLKDSNAKLSDNVEFLRQRTNQLKNQKDQNQDSNKSELAYTRSELRQKKIDLDNAQEKILELHQEMDHLKENLEMATDEIERITSEYKNMKSNFGMTDGDLQSREAECRMLRMQIEHLQEQMNDKNDADDKIMIHVNEQVEKWKQIMEERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDLSQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQMRRIKELRQMLDDKEKMLRETVERLNKVENQMADREQELTDALERNKMYERGEFGLAEAVAEIKACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLDVEGYRRQKAAEDEEERAINIVLQKEIEKLEDERLLLKKKVRMLARQAGLRAGSAGMEAGDVMDEYKALELESSMQNIEYDPVMQSMARKYESAPQGNNTWRIKEREMSSELSNAVKERAVKEDEIAKLMTRNRQLQAENDAMCDALRQIKEELVTRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDNLEGRNEELRNELRNSRIGFQQLQLDHDKLKQRLKVMDPMVMMENGWNLEERIGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRKFAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEFDRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMRRENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKDMTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALKKILEAEKQRRHVLEATLEELGEAPASEQSIKSTSNSPRKTKSKLAVDSHLISMSKKMATLEMKQINEQERADHAVRMYENIKNTWNEAEKRNKELEEKLTELTNHNLELQKIERELRDELIDSVSKEINDAEKRRVLELEKRELEGKHEIEKLKEIAEIATMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGKLHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQTRLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQELQLTLRAKFDLETEFQAANIARQTETELKDAMATKRNEKSVLESWSSKMEGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHDDKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTMPDPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEGTLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKTMWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVASNQKHGEEIKLLRERLSAEAAAGTRRAGYNGQLPMATTAVATSDQYRENNELRDLLAIQTRTNEDLKLQLADIQHQLSIQKQKMETTDKINQSRLKETEIKAENEIIDLKENMNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNIEMKNAMVKLTEQLRDKEKQLQILKANLADVKKTIADQSIDALRMTKNEMANQDNIQKVLDKHTRDLSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKLKTDKSKLEQENDELRNQLQRIKNLRNLSSNDAMKQELDAMKIKLRLIEEENNQLKRNPSKSANSKQDSQEKVNNWEEGKRNQRLQDKLKEKLQDKENDIANLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQPRKPMAFATPSNRSDTVDDLRRRNGELEKEIDRLMRNADSSDSKTVNNVALKEAEMRNRILQRNIEDLERRLTQSGSTSVITLEKEKAMQKEIMRLNGDNLELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSASTMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQVQLLRTENADLKLELAALKEQVGNKLAERYDAKERGMARVVSDYEKLRKDLGREAEEHEKTRIDLKQMARDVDKLEKQNADLESKLAIAESRGRQNVSRIANKELQDENRKLSSIIANLQSQLKDKHNQNPDSSKVEELKLRYNKATERVSFLEKQLQSFSEQFGVAIDLGY 2372          
The following BLAST results are available for this feature:
BLAST of NPHP6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CEP2900.000e+032.74centrosomal protein 290 [Source:HGNC Symbol;Acc:HG... [more]
CEP2900.000e+032.61centrosomal protein 290 [Source:HGNC Symbol;Acc:HG... [more]
CEP2901.267e-9430.89centrosomal protein 290 [Source:HGNC Symbol;Acc:HG... [more]
CEP2902.084e-8429.41centrosomal protein 290 [Source:HGNC Symbol;Acc:HG... [more]
CEP2906.805e-4229.36centrosomal protein 290 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of NPHP6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NPHP6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NPHP6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cep2900.000e+031.75centrosomal protein 290 [Source:NCBI gene;Acc:5605... [more]
cep2900.000e+031.75centrosomal protein 290 [Source:NCBI gene;Acc:5605... [more]
back to top
BLAST of NPHP6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CEP2900.000e+032.37centrosomal protein 290 [Source:HGNC Symbol;Acc:HG... [more]
CEP2900.000e+031.97centrosomal protein 290 [Source:HGNC Symbol;Acc:HG... [more]
CEP2900.000e+032.42centrosomal protein 290 [Source:HGNC Symbol;Acc:HG... [more]
CEP2902.024e-2932.53centrosomal protein 290 [Source:HGNC Symbol;Acc:HG... [more]
CEP2908.848e-3233.45centrosomal protein 290 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of NPHP6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Cep2900.000e+032.45centrosomal protein 290 [Source:MGI Symbol;Acc:MGI... [more]
Cep2900.000e+032.45centrosomal protein 290 [Source:MGI Symbol;Acc:MGI... [more]
Cep2900.000e+032.45centrosomal protein 290 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of NPHP6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|P85001|CE290_DANRE0.000e+031.92Centrosomal protein of 290 kDa OS=Danio rerio OX=7... [more]
sp|Q6A078|CE290_MOUSE0.000e+032.45Centrosomal protein of 290 kDa OS=Mus musculus OX=... [more]
sp|O15078|CE290_HUMAN0.000e+032.74Centrosomal protein of 290 kDa OS=Homo sapiens OX=... [more]
sp|Q9TU23|CE290_BOVIN4.572e-16333.18Centrosomal protein of 290 kDa (Fragment) OS=Bos t... [more]
back to top
BLAST of NPHP6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YKK90.000e+0100.00NPHP6 OS=Schmidtea mediterranea OX=79327 GN=NPHP6 ... [more]
A0A1S3JQI20.000e+037.04centrosomal protein of 290 kDa OS=Lingula unguis O... [more]
A0A2C9KBV30.000e+036.62CEP209_CC5 domain-containing protein OS=Biomphalar... [more]
A0A1I8I4940.000e+035.57CEP209_CC5 domain-containing protein OS=Macrostomu... [more]
A0A267E7630.000e+035.52CEP209_CC5 domain-containing protein (Fragment) OS... [more]
back to top
BLAST of NPHP6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cep2900.000e+031.32centrosomal protein 290 [Source:NCBI gene;Acc:5605... [more]
back to top
BLAST of NPHP6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NPHP6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NPHP6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO409723.031e-6939.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409737.448e-2728.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO296758.290e-1624.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NPHP6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000033960.11.556e-2728.81pep primary_assembly:ASM223467v1:6:2318704:2335450... [more]
ENSORLT00000043328.19.067e-2426.30pep primary_assembly:ASM223467v1:6:2309345:2331722... [more]
ENSORLT00000041224.11.802e-1630.00pep primary_assembly:ASM223467v1:4:31791053:317923... [more]
ENSORLT00000027967.14.681e-1327.59pep primary_assembly:ASM223467v1:6:2304565:2305828... [more]
back to top
BLAST of NPHP6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000072747.10.000e+099.45SMESG000072747.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30019531
GenBankAKN21708.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019531 ID=SMED30019531|Name=NPHP6|organism=Schmidtea mediterranea sexual|type=transcript|length=7356bp
TCTATATAAATCTTATATGTAAACAATGAGTTCTTCAGATTGGGATAGAA
TTTTGAAAGTTAAGACTGATCAGTTAAATTCTATGTCACCCGACGATATT
GATATAATCTATGAACTAATGGTCAATATCGATGACATCAGTAATGTTGA
TGATGCCGATAAGCTTTACAAGGCTTTCAACATTGCACAATTCATCATGA
GCTACAAAGCTGAGGAAAACAAAGGTCTAAATGAAGATTTAGAAGAAGCC
AATGTTGACATAAAAAAATTGAAAATTATCAAAGAAGAATTAGAAAAAGA
GAATGCTGCGTTGCAAAGAAGTGACGGAACAGATATAAATGTCGTGAGAG
AAAAACGAAACTGGGAAATGGAGAAAGAATCGATGAACCAAGAAATTCGG
GAATTGAAAAGCAAATATAACTCGTTGACCGAGGACAATGACAAGAAAGA
AGAAACAATTAATAAACAGCAAAAGGAAATTGAAGGATTAAAAGACTCAA
ATGCAAAATTATCCGACAATGTGGAATTTCTCCGACAGAGAACGAACCAA
CTCAAAAATCAAAAGGATCAAAATCAGGATTCCAACAAATCAGAATTGGC
TTATACTAGATCGGAATTAAGACAGAAGAAAATCGATCTGGATAATGCCC
AAGAGAAAATCCTTGAACTGCATCAGGAAATGGATCATCTGAAGGAAAAC
CTGGAAATGGCAACTGATGAAATCGAAAGAATAACATCGGAATATAAAAA
TATGAAGAGCAATTTCGGGATGACCGATGGAGATCTACAGAGCAGGGAGG
CAGAATGCAGGATGCTGAGAATGCAAATTGAGCATCTCCAGGAACAGATG
AACGATAGGAATGACGCTGATGACAAAATTATGATTCACGTCAACGAACA
AGTCGAGAAATGGAAACAAATAATGGAAGAAAGAGATTCTGAGATCTGTC
GGCTGTACGAGGAGAATGCTAAATTGCGATACGACCTACAGAAATCCGGC
ATCAACAGCGAGAAAGCTAATGTTCAAGCACTGATAAAGCTGGTAAAGGA
ACGGGAACAAGAGGTGAAGGATTTGAGTCAGCAATTGCTGGATGCGGCAC
ACACAATCGAGGAGAACGGAGATCTCATTGAGAATTTAAAGAAGGATCTA
GAGCGGACTGGAGGAGGATCATCGGGACATCAGATGAGGCGGATAAAGGA
GTTGCGGCAGATGCTTGATGACAAGGAGAAGATGCTGAGAGAAACTGTGG
AGAGATTGAATAAGGTGGAGAATCAGATGGCGGATCGGGAGCAGGAACTG
ACAGATGCCCTTGAGAGGAACAAGATGTATGAGAGAGGAGAATTCGGACT
GGCAGAAGCTGTTGCTGAGATCAAGGCGTGCAAGGCGCAGTTGCAAGTGA
AGGAACGGGAGAAGGAACAATATCTTCAGAATGTCAACAAGGCAAATTAT
GCTGCTGAGGAGCTGAAATTCGAGAATGGACATCTTCGGGCCAAGCTGAA
TATCCCGATTGATGAACAGCTTGATGTAGAGGGCTACAGGAGGCAGAAGG
CAGCCGAGGACGAGGAGGAGAGGGCCATCAATATTGTTCTGCAGAAGGAG
ATTGAGAAATTGGAAGATGAAAGGCTGTTGCTGAAAAAGAAAGTCCGAAT
GCTAGCTCGACAAGCCGGACTGCGTGCTGGCTCAGCTGGGATGGAGGCTG
GCGATGTCATGGATGCGTACAAGGCGTTGGAGCTGGAGAGCTCGATGCAG
AATATCGAATATGATCCGGTGATGCAATCTATGGCTCGCAAATACGAGAG
CGCGCCACAGGGGAATAACACGTGGCGAATCAAGGAGCGGGAGATGAGCA
GCGAGCTGTCGAATGCCGTGAAGGAGAGAGCAGTAAAGGAGGACGAGATA
GCGAAATTGATGACGAGGAACAGGCAGCTGCAAACGGAGAATGATGCGAT
GTGTGACGCGCTGCGACAGATCAAGGAAGAACTGGTGACGAGGAACTGGA
GTGCCGGTGCTGGAGTGCCGGTGCTGGAATGCCCGGTGCTGGACAAGTTA
CTGGTGGCCATGGAGACCAGGAAGCTGCTGGGGGAGTTCGACACGGGAAT
TTACCTCAAGACGAGAATAGATAACTTGGAGGGCCGCAATGAGGAGCTGA
GGAACGAGCTGAGGAACAGCAGGATCGGATTCCAGCAGTTGCAATTGGAT
CACGACAAGTTAAAGCAGCGGCTGAAGGTGATGGATCCGATGGTGATGAT
GGAGAACGGCTGGAACCTGGAGGAAAGGATTGGGTTGCCCGAGAACCTGT
CGGCATCAGCCAGTCAGACGATTGCAGCACTCAATCAGCACCTGATCATT
GTGTTGCAGGAGAAATCACTGAAGGAGCAAGCCCTGGACAAGGCCGACAG
AGCACTGGACAATTACCGGAGGAAATTCGCATTCCTGCGGCACAGACAAG
GCCTCCTGTATCGGCAATATGGCGACGAGAAACAGCGATATGAGCAGGAG
ATCGAGGCGCTGCAAACCCGATTGAAGGACATTGAAGGCATCCGATCAGA
GGACAATGCGAGGATTGCCGAGTTCGATCGCATGCTAGACACTCTCAATC
AGGACGATTCGGAATTGAAGAGGAGATTGGCAGACCTCTGCCGACAGATA
ACTGTTTTGAAGGTCAATGAAACTGCTCTGACACGGAGGTATTCAGCAAT
GCAGGAGATGGAGCAGACAATGAGACGGGAGAATAATAAGCTGAAGAGTG
AGATGATACAAATCGAGGCCGTTGTCACTGACCGAATGGGTTATTATCGA
CGATTCAAGGAAACAGCAAATTATAAGCTGAATGTCCTCCAGAAAGAGCT
GGATGAATCTGTCCCCCGAAAGGACATGACAAAGCTTCAAACGAAATTCG
ATGAAGTGACAGAGAAATACAGGAACTTCCTGGAGAAGCAGAACATTCTC
ATTGGTCGTGGCGAATCGATAATTCAGATCGAGAGTGAACTAAGCAAAAT
GAAAATGGACCACGAAGCTTTGAAAAAGATTTTGGAAGCTGAGAAGCAGC
GTCGACATGTTTTAGAAGCCACCTTGGAGGAACTAGGCGAAGCGCCAGCA
TCAGAGCAATCAATAAAGAGCACAAGTAACTCACCAAGGAAGACCAAAAG
CAAATTGGCAGTTGACAGCCATTTGATATCGATGTCAAAGAAGATGGCAA
CACTGGAAATGAAGCAGATCAATGAGCAGGAACGAGCGGATCACGCAGTG
CGAATGTATGAGAACATAAAAAATACCTGGAACGAGGCGGAAAAACGAAA
CAAAGAACTCGAGGAAAAATTGACTGAACTGACCAATCACAATTTAGAGC
TGCAAAAGATTGAACGCGAGTTGCGAGATGAATTGATTGATTCCGTGTCC
AAGGAAATTAATGATGCCGAAAAACGTCGAGTTCTGGAGTTAGAGAAACG
CGAGCTGGAAGGGAAGCACGAGATTGAGAAGCTGAAGGAGATAGCAGAGA
TCGCCACAATGCAGACTAATGCATTGCAGCAGCAGCAGTTATCCAGGGAG
AAGGAGACCGGGTCACTACGGCAACAGCTGGCGGACATCCAGTGCCAGAG
TGACGAGAAAAGCCTGATAGGAAAGTTGCACCGGCACATCGTGCTGTTGC
AAATGTCAGAGACATCAGCACTGAGGAAGCTGGATGATTTGCATCGAGTC
CAGAAGCGGTTGGAGGCCCAGCTGCTGCGGACGGAGCAGAACTGCGATGA
GAAGGATCAGAACCTGTATCAGACTCGTCTGGACGGCCGGACCCGAGTGA
AACACTTGCGGGAGACGATAAATTCGCTACGCAGCCAGTTCTCAGGCAGC
ATCCCGCTGTCGCGGCACGAGCGGTTCACCAGCACTCTGATCCGGCTGAC
TGAGGACAAGGTCAAATTGGACCAGGAGCTCCAGCTGACTCTCCGTGCCA
AATTCGACTTGGAAACCGAATTCCAGGTCGCAAATATCGCCAGGCAAACC
GAGACAGAATTGAAGGACGCCATGGCAACCAAGAGAAATGAGAAAAGCGT
ACTGGAATCATGGAGCAGCAAGATGGAAGGACTGAGATTAGAAAGCCTGA
AGCACAAGCGCCAGTGTGACTTGTTGCGACACGAGGTGGAACACCTGGAA
AGCGTGATTAAATGCCAGGAATCCCAGCTGGCCCAGGTCGATGAGGATAT
TGCCAGAATTACAAGGGATCATGATGACAAGCAGTTGCTCTGGGAACAAC
GGGAGAACGAGCTAGAACGCACCATTGTCAACCTAGAAAATATCCAAGGG
GAAGTTATTATAGCTGCCAATTCATTTCAGCAAGCAACAGGAACACAGAA
AGAACAATATCTCGGAACTTTGCCAGACCCCAGCGCTCCACTGCCTAATC
AACTGGACCAAGCAATGGCCACCATCAAGAAGCACATCCGAGTTATATTC
GATAAGGAGAATGAGAATAAGGCGCTGAGGAAGCACGGGAAAGAGCATGA
AAATAAGATCCGGGAATTGGAAGGAACCCTATTGAAGCGGGAAAGATACA
TTAATGAGTTGCGGCTGCGATTGCCGGCATCAGAGGACAGACCGCAACAA
ATGGGCCAGATTTCTGATGCGGCAGTGACGTCATTACTGAATGCAGAAAA
AAGTAATTATGTGGACGAGAAAACGATGTGGGCTGCCCAAACAACTCTTT
CTGGGCTCCAGGAACGGTTGCGGGCTAAGGACGAGAGCCTCATGCGGTAC
GAGCAGCTGCTTAAAGAAGCTCGGGAGGATTTGGTGGTCAGCAATCAGAA
ACACGGAGAGGAAATCAAGCTGTTGAGAGAGAGACTAAGTGCTGAGGCTG
CCGCCGGTACTAGGAGGGCTGGATATAATGGCCAATTACCCATGGCAACC
ACAGCTGTAGCAACCAGTGATCAATACAGGGAAAACAATGAGCTGCGTGA
CCTGCTGGCCATTCAAACGAGAACCAATGAGGACCTGAAGCTCCAGCTGG
CTGACATTCAACACCAATTATCGATTCAGAAACAGAAAATGGAAACTACA
GACAAAATCAATCAATCCCGATTGAAGGAGACTGAAATAAAGACTGAGAA
CGAGATTATCGACCTCAAGGAGAACATGAACAATTTGAAGCGCAAACTAA
ATGAGAAGGAAAGCCAGATCGAATTCCAGAATCAGGAAATCTCCCGGTTG
AAAGGTGACGTCACTAGATCACCGAATGTCGAGATGAAAAATGCGATGGT
GAAACTGACTGAGCAACTCCGGGATAAAGAGAAACAGCTGCAAATCCTCA
AGGCCAACCTGGCCGACGTGAAGAAAACAATCACTGATCAATCGATAGAT
GCATTGCGGATGACAAAGAATGAGATGGCTAACCAGGACAACATCCAGAA
GGTGCTTGACAAGCACACTCGAGATCTCAGCAACGAGTTGGAGGCGAATC
GCGACCAAATATTACAATACCAGCGGGAGTTGCGATCAGCCAGAGCCGAC
AAGGAACGGGTACAAATCGAACTCGACGGACTGAAGGCTGACTCCGATCA
CAAGGAATTTACAGCCAAGAAATTGAAAACAGACAAAAGCAAACTGGAAC
AAGAAAATGATGAGCTTCGGAATCAATTGCAGAGAATTAAAAATTTGCGG
AATCTGTCCTCTAATGATGCGATGAAACAAGAACTGGATGCCATGAAAAT
CAAGCTCCGTCTGATCGAGGAAGAGAACAATCAACTGAAGAGAAATCCAG
CAAAATCGGCAAATAGCAAACAGGACTCGCAAGAGAAAGTGAATAATTGG
GAGGAGGGAAAGAGGAATCAAAGGCTGCAGGATAAACTGAAGGAGAAATT
ACAGGACAAGGAAAATGACATTGCCAATCTCAGCAAGCAGCTTGACACGA
CTACCAAAGCTCTAGATAGGATGAGAAGGGAGAAGCAAGCAGTTGAGAAT
CGGTTGACAGATAAATGGGGACCTGGAGCACTGCTGGACATTGATGAGGA
CATCGAGCGGATATCTGCCCAGCCCAGGAAGCCGATGGCGTTCGCAACAC
CCTCGAATCGATCCGACACTGTTGATGATCTGAGACGGAGAAATGGTGAA
CTGGAAAAGGAAATCGATCGACTGATGAGAAATGCCGACAGTTCTGACAG
CAAGACTGTCAATAATGTCGCACTGAAGGAGGCGGAAATGCGCAATCGGA
TCCTCCAACGGAACATTGAGGATCTCGAGAGGAGGCTGACGCAATCAGGC
AGCACGTCGGTAATCACATTGGAGAAGGAGAAAGCGATGCAGAAGGAGAT
AATGCGGCTGAATGGCGACAATCTGGAGCTGAAATTCGAGGCGGAGGCGG
CTCGGAAGGAAATTCCGAGATTAAAGGAAAAAGTCACAGATCAGAAGAAA
TTTATCGATTTACTCAAATCGGAAAAAGAAGCGCTGGAGGGAAAATCGAA
TCGCTCATTGGAATCGTCGGCAAGCACTATGAGCAATATCAAGCGGGTCG
GGGACAGCGGCAAATCGACAAAGGAGCTGGAAAAGATGATCGGGAGGATG
AAAAAGGTGGTGGAGAAAACGCAGCGGGAAAACGAGCGATTGAAGGAGGC
GCCGGGAGTGATAATGAATGAGCAAGTGCAGTTACTGCGCACGGAGAATG
CCGATTTGAAATTGGAGCTGGCGGCACTGAAGGAACAAGTGGGACATAAA
CTGGCCGAGAGATACGATGCCAAGGAGCGTGGAATGGCGAGAGTTGTTAG
CGATTATGAGAAATTGAGAAAGGATTTGGGGCGGGAGGCCGAAGAGCACG
AGAAAACGAGAATTGATCTCAAACAAATGGCACGTGATGTTGACAAATTG
GAAAAGCAAAATGCAGATTTGGAAAGCAAATTGGCAATCTCAGAAAGTCG
AGGACGACAAAATGTGTCGAGAATTGCAAACAAAGAACTTCAGGATGAAA
ATAGGAAGCTCTCATCGATTATCGCAAATTTACAATCCCAATTAAAAGAT
AAGCACAATCAGAATCCCGATTCCTCTAAAGTCGAAGAATTAAAACTCCT
ATATAACAAGGCAACAGAAAGAGTTTCATTTTTGGAGAAGCAATTGCAAA
GTTTCAGTGAACAATTTGGTGTTGCTATTGATCTGGGATATTGATCTGGT
GATTACGCTGATCCGATCTGTGGTTAATGCGCACTACAAATTATGCATAG
TTATATATATATATGAATAGTTTTACCGTGATGATTATGATTGTAATTAG
CTTGACCTTGCTTGCAGGATGACTGGCAGATCTAGTTTGGCCTGTGACAA
TCGTTCCATCCGGAACTCGTCCTGTGCATTTCCACATTTAGATTGTTATT
ATTCGT
back to top

protein sequence of SMED30019531-orf-1

>SMED30019531-orf-1 ID=SMED30019531-orf-1|Name=SMED30019531-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2373bp
MSSSDWDRILKVKTDQLNSMSPDDIDIIYELMVNIDDISNVDDADKLYKA
FNIAQFIMSYKAEENKGLNEDLEEANVDIKKLKIIKEELEKENAALQRSD
GTDINVVREKRNWEMEKESMNQEIRELKSKYNSLTEDNDKKEETINKQQK
EIEGLKDSNAKLSDNVEFLRQRTNQLKNQKDQNQDSNKSELAYTRSELRQ
KKIDLDNAQEKILELHQEMDHLKENLEMATDEIERITSEYKNMKSNFGMT
DGDLQSREAECRMLRMQIEHLQEQMNDRNDADDKIMIHVNEQVEKWKQIM
EERDSEICRLYEENAKLRYDLQKSGINSEKANVQALIKLVKEREQEVKDL
SQQLLDAAHTIEENGDLIENLKKDLERTGGGSSGHQMRRIKELRQMLDDK
EKMLRETVERLNKVENQMADREQELTDALERNKMYERGEFGLAEAVAEIK
ACKAQLQVKEREKEQYLQNVNKANYAAEELKFENGHLRAKLNIPIDEQLD
VEGYRRQKAAEDEEERAINIVLQKEIEKLEDERLLLKKKVRMLARQAGLR
AGSAGMEAGDVMDAYKALELESSMQNIEYDPVMQSMARKYESAPQGNNTW
RIKEREMSSELSNAVKERAVKEDEIAKLMTRNRQLQTENDAMCDALRQIK
EELVTRNWSAGAGVPVLECPVLDKLLVAMETRKLLGEFDTGIYLKTRIDN
LEGRNEELRNELRNSRIGFQQLQLDHDKLKQRLKVMDPMVMMENGWNLEE
RIGLPENLSASASQTIAALNQHLIIVLQEKSLKEQALDKADRALDNYRRK
FAFLRHRQGLLYRQYGDEKQRYEQEIEALQTRLKDIEGIRSEDNARIAEF
DRMLDTLNQDDSELKRRLADLCRQITVLKVNETALTRRYSAMQEMEQTMR
RENNKLKSEMIQIEAVVTDRMGYYRRFKETANYKLNVLQKELDESVPRKD
MTKLQTKFDEVTEKYRNFLEKQNILIGRGESIIQIESELSKMKMDHEALK
KILEAEKQRRHVLEATLEELGEAPASEQSIKSTSNSPRKTKSKLAVDSHL
ISMSKKMATLEMKQINEQERADHAVRMYENIKNTWNEAEKRNKELEEKLT
ELTNHNLELQKIERELRDELIDSVSKEINDAEKRRVLELEKRELEGKHEI
EKLKEIAEIATMQTNALQQQQLSREKETGSLRQQLADIQCQSDEKSLIGK
LHRHIVLLQMSETSALRKLDDLHRVQKRLEAQLLRTEQNCDEKDQNLYQT
RLDGRTRVKHLRETINSLRSQFSGSIPLSRHERFTSTLIRLTEDKVKLDQ
ELQLTLRAKFDLETEFQVANIARQTETELKDAMATKRNEKSVLESWSSKM
EGLRLESLKHKRQCDLLRHEVEHLESVIKCQESQLAQVDEDIARITRDHD
DKQLLWEQRENELERTIVNLENIQGEVIIAANSFQQATGTQKEQYLGTLP
DPSAPLPNQLDQAMATIKKHIRVIFDKENENKALRKHGKEHENKIRELEG
TLLKRERYINELRLRLPASEDRPQQMGQISDAAVTSLLNAEKSNYVDEKT
MWAAQTTLSGLQERLRAKDESLMRYEQLLKEAREDLVVSNQKHGEEIKLL
RERLSAEAAAGTRRAGYNGQLPMATTAVATSDQYRENNELRDLLAIQTRT
NEDLKLQLADIQHQLSIQKQKMETTDKINQSRLKETEIKTENEIIDLKEN
MNNLKRKLNEKESQIEFQNQEISRLKGDVTRSPNVEMKNAMVKLTEQLRD
KEKQLQILKANLADVKKTITDQSIDALRMTKNEMANQDNIQKVLDKHTRD
LSNELEANRDQILQYQRELRSARADKERVQIELDGLKADSDHKEFTAKKL
KTDKSKLEQENDELRNQLQRIKNLRNLSSNDAMKQELDAMKIKLRLIEEE
NNQLKRNPAKSANSKQDSQEKVNNWEEGKRNQRLQDKLKEKLQDKENDIA
NLSKQLDTTTKALDRMRREKQAVENRLTDKWGPGALLDIDEDIERISAQP
RKPMAFATPSNRSDTVDDLRRRNGELEKEIDRLMRNADSSDSKTVNNVAL
KEAEMRNRILQRNIEDLERRLTQSGSTSVITLEKEKAMQKEIMRLNGDNL
ELKFEAEAARKEIPRLKEKVTDQKKFIDLLKSEKEALEGKSNRSLESSAS
TMSNIKRVGDSGKSTKELEKMIGRMKKVVEKTQRENERLKEAPGVIMNEQ
VQLLRTENADLKLELAALKEQVGHKLAERYDAKERGMARVVSDYEKLRKD
LGREAEEHEKTRIDLKQMARDVDKLEKQNADLESKLAISESRGRQNVSRI
ANKELQDENRKLSSIIANLQSQLKDKHNQNPDSSKVEELKLLYNKATERV
SFLEKQLQSFSEQFGVAIDLGY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR026201Cep290
IPR032321Cep209_CC5
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005813centrosome
Vocabulary: biological process
TermDefinition
GO:0060271cilium morphogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 989..1023
NoneNo IPR availableCOILSCoilCoilcoord: 1481..1501
NoneNo IPR availableCOILSCoilCoilcoord: 1219..1246
NoneNo IPR availableCOILSCoilCoilcoord: 780..807
NoneNo IPR availableCOILSCoilCoilcoord: 326..360
NoneNo IPR availableCOILSCoilCoilcoord: 812..839
NoneNo IPR availableCOILSCoilCoilcoord: 1734..1768
NoneNo IPR availableCOILSCoilCoilcoord: 951..971
NoneNo IPR availableCOILSCoilCoilcoord: 1364..1398
NoneNo IPR availableCOILSCoilCoilcoord: 2302..2329
NoneNo IPR availableCOILSCoilCoilcoord: 512..546
NoneNo IPR availableCOILSCoilCoilcoord: 1558..1592
NoneNo IPR availableCOILSCoilCoilcoord: 698..725
NoneNo IPR availableCOILSCoilCoilcoord: 2336..2363
NoneNo IPR availableCOILSCoilCoilcoord: 2165..2192
NoneNo IPR availableCOILSCoilCoilcoord: 1931..1976
NoneNo IPR availableCOILSCoilCoilcoord: 2099..2119
NoneNo IPR availableCOILSCoilCoilcoord: 2050..2077
NoneNo IPR availableCOILSCoilCoilcoord: 442..476
NoneNo IPR availableCOILSCoilCoilcoord: 191..246
NoneNo IPR availableCOILSCoilCoilcoord: 854..874
NoneNo IPR availableCOILSCoilCoilcoord: 1637..1671
NoneNo IPR availableCOILSCoilCoilcoord: 1078..1122
NoneNo IPR availableCOILSCoilCoilcoord: 1847..1907
NoneNo IPR availableCOILSCoilCoilcoord: 611..652
NoneNo IPR availableCOILSCoilCoilcoord: 1150..1170
NoneNo IPR availableCOILSCoilCoilcoord: 1680..1728
NoneNo IPR availableCOILSCoilCoilcoord: 110..186
NoneNo IPR availableCOILSCoilCoilcoord: 254..281
NoneNo IPR availableCOILSCoilCoilcoord: 2016..2043
NoneNo IPR availableCOILSCoilCoilcoord: 2241..2292
NoneNo IPR availableCOILSCoilCoilcoord: 889..912
NoneNo IPR availableCOILSCoilCoilcoord: 65..99
NoneNo IPR availableCOILSCoilCoilcoord: 390..431
NoneNo IPR availableCOILSCoilCoilcoord: 2201..2228
NoneNo IPR availableCOILSCoilCoilcoord: 1798..1839
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1026..1041
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1920..1935
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1019..1044
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1900..1935
NoneNo IPR availablePANTHERPTHR18879:SF20CENTROSOMAL PROTEIN OF 290 KDAcoord: 59..2357
IPR032321Centrosomal protein of 290kDa, coiled-coil regionPFAMPF16574CEP209_CC5coord: 1287..1415
e-value: 1.6E-16
score: 60.7
IPR026201Centrosomal protein of 290kDaPANTHERPTHR18879FAMILY NOT NAMEDcoord: 59..2357