Acetylcholine receptor subunit alpha-like protein

Overview
NameAcetylcholine receptor subunit alpha-like protein
Smed IDSMED30019527
Length (bp)1697
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Acetylcholine receptor subunit alpha-like protein (SMED30019527) t-SNE clustered cells

Violin plots show distribution of expression levels for Acetylcholine receptor subunit alpha-like protein (SMED30019527) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Acetylcholine receptor subunit alpha-like protein (SMED30019527) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Acetylcholine receptor subunit alpha-like protein (SMED30019527) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019527

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30019527SMESG000015383.1 dd_Smed_v4_7711_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30019527SMESG000015383.1 dd_Smed_v4_7711_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Human
Match: CHRNB3 (cholinergic receptor nicotinic beta 3 subunit [Source:HGNC Symbol;Acc:HGNC:1963])

HSP 1 Score: 194.512 bits (493), Expect = 2.002e-74
Identity = 146/368 (39.67%), Postives = 226/368 (61.41%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMT-HSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPAL 1575
            +LF    G++E  LMTK  V  +GTV WTPPA Y+SSC ++V FFP+D QNC M F SWTY D  MV                  ++IN  VD ++F+ + E++IL     +  R+    S  +P +T++ ++RR  LFYT+ LI+PCL +SFL+VLVFYLP+  GEK+SLS ++L+SLT+F L++ E IPS+S VIPLIG+YLLF +I ++LSII+TV V+NV+ RS+ T H M+PW++ +FL            + K   M +    Y +    KE S   +  +   ++ ++  S  +  +   + +    ++Y+  ++K + + ++V ++W+FVA V+DR+FL LFL   V  TGS+++ +PAL
Sbjct:  116 VLFENADGRFEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTY-DGTMV----------------DLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYS--YPFITYSFVLRRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFL----------QKLPKLLCMKDHVDRYSSPE--KEESQPVVKGKVLEKKKQKQLSDGEKVLVAFLEKAADSIRYISRHVKKEHFISQVVQDWKFVAQVLDRIFLWLFLIVSV--TGSVLIFTPAL 450          

HSP 2 Score: 106.301 bits (264), Expect = 2.002e-74
Identity = 47/102 (46.08%), Postives = 68/102 (66.67%), Query Frame = 3
Query:  189 QTSTGFKSAVQLYQKLLDE--NNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLY 488
              +TGF S  +    LL      Y K +RPV  + D +  YFGLK++QL+D++ ++Q +TTNVW++QEW D  LRWNP+DY G+  + +PS  +WLPDIVL+
Sbjct:   17 SATTGFNSIAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLF 118          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Human
Match: CHRNA6 (cholinergic receptor nicotinic alpha 6 subunit [Source:HGNC Symbol;Acc:HGNC:15963])

HSP 1 Score: 198.364 bits (503), Expect = 3.213e-72
Identity = 139/403 (34.49%), Postives = 243/403 (60.30%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISK--------------------------EKEMSERCFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLDGN 1605
            +L+    G ++V+  TKA + ++G + WTPPA+++SSC +++ FFP+D QNC + F SWTY+  ++ L                 ++I   VD+ +F+ + E++I++ S  +H  ++    E + ++T++  +RR  +FYT+NLI+PCL +SFL+VLVFYLP+  GEK++L I++LLSLT+F L++ ETIPSTSLV+PL+G+YLLFT+I ++LSI++TV VLN+++R+  TH+M  W++ +FLK LP +L +  P+ K                          E    + CF +C+K+     S  +L ++         + ++++    ++   I  ++++ +N+K  +   +V+++W++VA+V+DRVFL +F+  CV  T  + L+         PL GN
Sbjct:  121 VLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDL-----------------LIIGSKVDMNDFWENSEWEIIDASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVVPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHTMPRWVKTVFLKLLPQVLLMRWPLDKTRGTGSDAVPRGLARRPAKGKLASHGEPRHLKECF-HCHKSNELATSKRRLSHQPL------QWVVENSEHSPEVEDVINSVQFIAENMKSHNETKEVEDDWKYVAMVVDRVFLWVFIIVCVFGTAGLFLQ---------PLLGN 490          

HSP 2 Score: 95.1301 bits (235), Expect = 3.213e-72
Identity = 42/101 (41.58%), Postives = 68/101 (67.33%), Query Frame = 3
Query:  189 QTSTGFKSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            +   G  +  +L+ KL   ++YN+ IRPVE   D VT +F + +TQL +++  +Q + TN+W++  W D  LRW+P +Y+G++ L +P++KIW PDIVLYN
Sbjct:   26 KGCVGCATEERLFHKLF--SHYNQFIRPVENVSDPVTVHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDIVLYN 124          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Human
Match: CHRNB4 (cholinergic receptor nicotinic beta 4 subunit [Source:HGNC Symbol;Acc:HGNC:1964])

HSP 1 Score: 183.726 bits (465), Expect = 2.276e-69
Identity = 139/400 (34.75%), Postives = 226/400 (56.50%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSP-----ISKEKEMSERCF--------------MYCNKTMF--KEASASKLIYETFMRRSKRSYSLKDAS-IEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLDGNH 1608
            +L+    G YEV + T   V  +G+V W PPA+Y+S+C I V++FP+D QNC + F SWTY DH  +                  V++     + +F  S E+DI+ L  RR +     +   + +VT++ I++RK LFYT+NLI+PC+  + L++LVFYLP+  GEK++L I++LL+LT F LL+ + +P TSL +PLIGKYL+FT++L++ SI+ +V VLNV+ RS  TH+M+PW++  FL  LP  LF+  P      ++    S+ C                Y N   F    ++ASK    +      R + L+ +    + +   +  + ++  ++K+DD    V E+W++VA+V+DR+FL +F+  CV+ T  + L  P L+      +G +
Sbjct:  116 VLYNNADGTYEVSVYTNLIVRSNGSVLWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTY-DHTEI----------------DMVLMTPTASMDDFTPSGEWDIVALPGRRTVNP---QDPSYVDVTYDFIIKRKPLFYTINLIIPCVLTTLLAILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHTMAPWVKRCFLHKLPTFLFMKRPGPDSSPARAFPPSKSCVTKPEATATSTSPSNFYGNSMYFVNPASAASKSPAGSTPVAIPRDFWLRSSGRFRQDVQEALEGVSFIAQHMKNDDEDQSVVEDWKYVAMVVDRLFLWVFMFVCVLGTVGLFL--PPLFQTHAASEGPY 493          

HSP 2 Score: 100.138 bits (248), Expect = 2.276e-69
Identity = 46/91 (50.55%), Postives = 60/91 (65.93%), Query Frame = 3
Query:  219 QLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            +L   LL++  YN LIRP   +   ++    L L QLI +N R+Q +TTNVW++QEW D  L WN   YEGV +L IP+ +IWLPDIVLYN
Sbjct:   29 KLMDDLLNKTRYNNLIRPATSSSQLISIKLQLSLAQLISVNEREQIMTTNVWLKQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYN 119          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Human
Match: CHRNB2 (cholinergic receptor nicotinic beta 2 subunit [Source:HGNC Symbol;Acc:HGNC:1962])

HSP 1 Score: 184.496 bits (467), Expect = 4.346e-69
Identity = 131/387 (33.85%), Postives = 223/387 (57.62%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSP------------------------ISKEKEMSERCFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILR 1563
            +L+    G YEV   + A V +DG++ W PPA+Y+S+C I V+ FP+D QNC M F SWTY+  ++ L                 V+ +    L +F  S E+DI+ L  RR+      +   + ++T++ I+RRK LFYT+NLI+PC+ ++ L++LVFYLP+  GEK++L I++LL+LT+F LL+ + +P TSL +PL+GKYL+FT++L++ SI+ +V VLNV+ RS  TH+M+PW++ +FL+ LP +LF+  P                          +E   ++ C  + N+   +  + +       +    RS       + E ++     ++++ D+++ +D    V E+W++VA+V+DR+FL +F+  CV  T  + L+
Sbjct:  118 VLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDL-----------------VLKSEVASLDDFTPSGEWDIVALPGRRNENP---DDSTYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQQPRHHCARQRLRLRRRQREREGAGALFFREAPGADSCTCFVNRASVQGLAGAFGAEPAPVAGPGRSGEPCGCGLREAVD----GVRFIADHMRSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQ 480          

HSP 2 Score: 98.5969 bits (244), Expect = 4.346e-69
Identity = 43/91 (47.25%), Postives = 62/91 (68.13%), Query Frame = 3
Query:  219 QLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            +L + LLD + YNKLIRP     + VT    + L QLI ++ R+Q +TTNVW+ QEW+D  L W PE+++ ++ + +PS  IWLPD+VLYN
Sbjct:   31 RLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYN 121          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Human
Match: CHRNB2 (cholinergic receptor nicotinic beta 2 subunit [Source:HGNC Symbol;Acc:HGNC:1962])

HSP 1 Score: 184.496 bits (467), Expect = 4.347e-69
Identity = 131/387 (33.85%), Postives = 223/387 (57.62%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSP------------------------ISKEKEMSERCFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILR 1563
            +L+    G YEV   + A V +DG++ W PPA+Y+S+C I V+ FP+D QNC M F SWTY+  ++ L                 V+ +    L +F  S E+DI+ L  RR+      +   + ++T++ I+RRK LFYT+NLI+PC+ ++ L++LVFYLP+  GEK++L I++LL+LT+F LL+ + +P TSL +PL+GKYL+FT++L++ SI+ +V VLNV+ RS  TH+M+PW++ +FL+ LP +LF+  P                          +E   ++ C  + N+   +  + +       +    RS       + E ++     ++++ D+++ +D    V E+W++VA+V+DR+FL +F+  CV  T  + L+
Sbjct:  118 VLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDL-----------------VLKSEVASLDDFTPSGEWDIVALPGRRNENP---DDSTYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQQPRHHCARQRLRLRRRQREREGAGALFFREAPGADSCTCFVNRASVQGLAGAFGAEPAPVAGPGRSGEPCGCGLREAVD----GVRFIADHMRSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQ 480          

HSP 2 Score: 98.2117 bits (243), Expect = 4.347e-69
Identity = 43/91 (47.25%), Postives = 62/91 (68.13%), Query Frame = 3
Query:  219 QLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            +L + LLD + YNKLIRP     + VT    + L QLI ++ R+Q +TTNVW+ QEW+D  L W PE+++ ++ + +PS  IWLPD+VLYN
Sbjct:   31 RLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYN 121          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Celegans
Match: unc-63 (Acetylcholine receptor subunit alpha-type unc-63 [Source:UniProtKB/Swiss-Prot;Acc:Q9N587])

HSP 1 Score: 239.58 bits (610), Expect = 5.359e-88
Identity = 167/391 (42.71%), Postives = 251/391 (64.19%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKH---YTQKGI-PDSSNTSGTV-----VINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSP------ISKEKEMSERCFMYCNKTMFKEASASKLIYETF-MRRSKRSYSL-KDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPL 1596
            +L+    G Y+V +MTKAK+ ++GTV+W PPA+Y+S C I+VEFFP+D Q C+M F SWTY   ++ L+H   + +K I  D     G       V++  +DL ++Y SVE+DIL +  +RH +++      F ++T+ I +RRKTLFYTVNLI P + +SFL+ LVFYLP+  GEKISL I+IL+SLT+FFLLLVE IPSTSLVIPLIGKYLLFT++L++LS+++TV+ LNV++RS  TH+M  W++ +F+ FLP  L +  P          ++   R   +           S+L+       R + S++L +D S    +   +  + Y+ D+LK+++   +V E+W++++VVMDR+FL+ F  AC   T  II R+P++YD    L
Sbjct:  114 VLYNNADGNYQVTIMTKAKLTYNGTVEWAPPAIYKSMCQIDVEFFPFDRQQCEMKFGSWTYGGLEVDLQHRDKHLEKEIEEDVEGVDGPTKEIVWVVDRGIDLSDYYPSVEWDILNVPGKRHSKRYPCCESPFIDITYEIHLRRKTLFYTVNLIFPSVGISFLTALVFYLPSDGGEKISLCISILISLTVFFLLLVEIIPSTSLVIPLIGKYLLFTMVLVTLSVVVTVVTLNVHYRSPTTHTMPKWMKRLFVDFLPKYLLMTRPQPPGHHSKPNRKFDSRASTFSIGVNHVLGQNSELLSPGLNSNREESSFTLPRDNS---PVRSAVESVAYIADHLKNEEDDKQVIEDWKYISVVMDRIFLITFTFACAFGTVVIIARAPSIYDNTPAL 501          

HSP 2 Score: 105.145 bits (261), Expect = 5.359e-88
Identity = 46/95 (48.42%), Postives = 71/95 (74.74%), Query Frame = 3
Query:  207 KSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            + A +L++ L+   +YNKL+RPV  N + +   F LKL+QL+D++ ++Q +TTNVW+Q  W D  LRW+P +Y GV++L++PS+ IWLPD+VLYN
Sbjct:   25 RDANRLFEDLI--ADYNKLVRPVSENGETLVVTFKLKLSQLLDVHEKNQIMTTNVWLQHSWMDYKLRWDPVEYGGVEVLYVPSDTIWLPDVVLYN 117          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Celegans
Match: unc-38 (Acetylcholine receptor subunit alpha-type unc-38 [Source:UniProtKB/Swiss-Prot;Acc:Q23022])

HSP 1 Score: 203.756 bits (517), Expect = 6.392e-70
Identity = 150/401 (37.41%), Postives = 248/401 (61.85%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLK----------HYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQG--ESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKDASIEEKINR---------TIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLDGNHLP 1614
            +L+      Y + + TKA + + G V W PPA+++S C I+V +FP+D Q C + F SWT++++ + ++             +KGI D+       V    +DL ++Y SVE+DI+   A+R  + +        + +VT+ + +RRK LFYTVNL+ PC+ +SFL++LVFYLP+ SGEK++L I+IL++LT+FFLLL E IP+TS+ +PLIGKYLLFT+++++LS+++TVI LN++FR+  TH M  W++ +FLK+LP +LF+  PI   +E  +      +  +     A         R S    ++++A+I++ I +            ++ ++ + LK  D  +K+ E+W++VA+V+DR+FLL+F  AC + T  I+LR+P LYD R P+D  + P
Sbjct:  114 VLYNNADSNYNITISTKATLHYTGEVTWEPPAIFKSMCQIDVRWFPFDEQQCHLKFGSWTFSENLLSVELNEPSLRYEEEIDEKGIIDN-----VTVAEDGIDLSDYYPSVEWDIMSRVAKRRAKNYPSCCPQSAYIDVTYYLQLRRKPLFYTVNLVFPCVGISFLTILVFYLPSDSGEKVTLCISILVALTIFFLLLTEIIPATSITLPLIGKYLLFTMVMVTLSVVVTVISLNLHFRTPTTHLMPNWVKKVFLKWLPKLLFMRRPIDDYEEKFDDKKKPKDGKIALSVHAH--------RVSNVGNNIRNATIDDTIQKMYYSPPVVKAFENICFIAELLKKKDRDDKIDEDWKYVAMVLDRLFLLIFSIACFVGTVIILLRAPTLYDTRQPIDLQYRP 501          

HSP 2 Score: 80.8777 bits (198), Expect = 6.392e-70
Identity = 41/97 (42.27%), Postives = 61/97 (62.89%), Query Frame = 3
Query:  201 GFKSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            G + A +LY  L+   NYN+  RP       +T    L+L+Q+ID++  DQ +T +VW++Q W D  L W+P +Y GV +L++P   IW+PDIVLYN
Sbjct:   23 GNEDAKRLYDDLM--VNYNRHRRPSTSPNKPLTIKLKLRLSQIIDVHEIDQIMTCSVWLKQTWIDRKLSWDPVNYGGVNVLYVPYEMIWVPDIVLYN 117          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Celegans
Match: acr-12 (AcetylCholine Receptor; Nicotinic acetylcholine receptor-like subunit ACR-12 [Source:UniProtKB/TrEMBL;Acc:G5EDF1])

HSP 1 Score: 175.252 bits (443), Expect = 1.400e-65
Identity = 149/446 (33.41%), Postives = 247/446 (55.38%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTV-VINHAVDLRNFYTSVEFDILELSARRHIRQFQG--ESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSP----ISKEKEMSERCFM--------------YCNKTMFK---------EASASKLIYETFMRRSKRSYSLKDASIEEKI-----------------------NRTIADLKYV---------VDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLDGNHLPNQTL 1626
            +L+    G  ++ ++T A V  +G V W PPA+Y+S C I+V +FPYD Q C+M F +WTY    + LK   Q+ +   +     V  +   +DL  FY S E+D+L L++ RH   +      EK+ ++T+   +RRKTLF+T NLI+PC  +S L+  VFYL   S  KI+ SI+IL++LT+FFL+L++ +P TSLVIP+ G+YL+ T+IL++LS +++VI +N  FRS   H MSPWIR +FLKFLP IL +  P    ++K+  +     +              Y NK   K         + S+  ++  TF  R + +    D+++E ++                       ++++ D+ ++          ++ + ++ + ++ ++W FVA+V+DR+FL++F S   + T  IIL SP+LYD   P++   +PN+ L
Sbjct:  125 VLYNNAAGDPDITILTDALVTFEGNVYWQPPAIYKSFCPIDVTWFPYDSQKCEMKFGTWTYTGRYVDLKQLPQEEVVTITKDDNDVEFMQQGMDLSFFYRSAEWDLLSLTSERHSVLYASCCGPEKYVDITYYFGLRRKTLFFTCNLILPCFLISILTTFVFYL---SDHKITFSISILVTLTVFFLVLIDLMPPTSLVIPMFGRYLITTMILVALSTVVSVITVNFRFRSGSAHKMSPWIRAVFLKFLPKILLMSRPEKGEVTKQPPLVNAASLVGSNYATAAKAANEYRNKAKGKNNDLMSLRGKPSSQAVLNNTFDMRMRNN----DSTVENRLKPYLCAQNNNAPTVAFRKTKRQKSKSVDDVVFMNLLNQVRFIAEHFRHNELEGEISDDWTFVAMVLDRLFLIIF-SVLNVGTVFIILESPSLYDYSKPMNIT-VPNKPL 561          

HSP 2 Score: 94.7449 bits (234), Expect = 1.400e-65
Identity = 44/91 (48.35%), Postives = 64/91 (70.33%), Query Frame = 3
Query:  219 QLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            QLY+ LL +  YNK+ RPV+ + D +T   G  L ++ID++ ++Q LTTN+W++ +W D  L W PE Y G++ LHIPS+ IW PD+VLYN
Sbjct:   40 QLYEDLLFD--YNKVPRPVKNSSDILTVDVGASLIRIIDVDEKNQVLTTNLWLEMKWNDAKLTWTPEKYGGLKTLHIPSDFIWTPDLVLYN 128          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Celegans
Match: acr-8 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:Q23355])

HSP 1 Score: 187.578 bits (475), Expect = 1.497e-65
Identity = 136/379 (35.88%), Postives = 230/379 (60.69%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQG--ESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFMYCNKTMFKEASASKLIYETFMRR--SKRSYSLKDASIEEKINRT-IADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPL 1596
            +L+    G+  + +M+ A V+++G V W PP++Y+S C I++E+FPYD Q C M F  WTYN   + ++    +       T    V  HA  +  F+ S+E+D++EL++ RH + + G    + + ++TF I +RRKTLFYT+NL++PC   + L+ +VFY+P     K++ SI+IL++LT+F+L+L++ +P TSLVIPLIGKYLLFT+ L+S+SI+++VI LN   R   +  M  W++ +F+  LP  + + +  ++E + S+R     +   F ++      + T   R  + R   LK   +   + R  I +++++ +       ++KV E+W +VA V+DR+FL++F    V+ T  I+L SPAL+D RTPL
Sbjct:  112 LLYNNADGEPHITIMSDAIVYYNGLVVWKPPSIYKSFCSIDIEYFPYDTQTCWMKFGGWTYNGFLLDVRQLPVEEWTLVVTTRKLQVCAHASSISFFFRSLEWDLMELNSARHEKIYAGCCGQDFYIDITFKIEIRRKTLFYTINLMIPCTMFAILTSIVFYVPPIE-HKMTFSISILVTLTVFYLILIDLVPPTSLVIPLIGKYLLFTMFLVSISIMLSVISLNFYRRDGSSFPMPHWMKVVFIHTLPRYICIKT--AEEDDGSDRGSSISDIGPFMDSRRPSPFFITVNERQLNGRLSELKKKGMHPDLIRNMIQNVEFIAEYFNSLKKEDKVSEDWSYVANVIDRIFLIIFSIMNVVGTWVILLNSPALFDNRTPL 487          

HSP 2 Score: 82.0333 bits (201), Expect = 1.497e-65
Identity = 38/95 (40.00%), Postives = 64/95 (67.37%), Query Frame = 3
Query:  207 KSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            + A Q+Y+ LL    YNK +RP++   ++V   FG  L ++ID++  +Q LTTN+W++ +W D  L W+P  +  ++ LH+P ++IW+PDI+LYN
Sbjct:   23 RYADQMYEDLL--YYYNKNVRPIKNASESVKVKFGSSLIRIIDVDEVNQVLTTNLWLEMQWFDYRLMWDPGRWGKIRKLHVPVDQIWIPDILLYN 115          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Celegans
Match: acr-8 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:Q23355])

HSP 1 Score: 187.578 bits (475), Expect = 1.497e-65
Identity = 136/379 (35.88%), Postives = 230/379 (60.69%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQG--ESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFMYCNKTMFKEASASKLIYETFMRR--SKRSYSLKDASIEEKINRT-IADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPL 1596
            +L+    G+  + +M+ A V+++G V W PP++Y+S C I++E+FPYD Q C M F  WTYN   + ++    +       T    V  HA  +  F+ S+E+D++EL++ RH + + G    + + ++TF I +RRKTLFYT+NL++PC   + L+ +VFY+P     K++ SI+IL++LT+F+L+L++ +P TSLVIPLIGKYLLFT+ L+S+SI+++VI LN   R   +  M  W++ +F+  LP  + + +  ++E + S+R     +   F ++      + T   R  + R   LK   +   + R  I +++++ +       ++KV E+W +VA V+DR+FL++F    V+ T  I+L SPAL+D RTPL
Sbjct:  112 LLYNNADGEPHITIMSDAIVYYNGLVVWKPPSIYKSFCSIDIEYFPYDTQTCWMKFGGWTYNGFLLDVRQLPVEEWTLVVTTRKLQVCAHASSISFFFRSLEWDLMELNSARHEKIYAGCCGQDFYIDITFKIEIRRKTLFYTINLMIPCTMFAILTSIVFYVPPIE-HKMTFSISILVTLTVFYLILIDLVPPTSLVIPLIGKYLLFTMFLVSISIMLSVISLNFYRRDGSSFPMPHWMKVVFIHTLPRYICIKT--AEEDDGSDRGSSISDIGPFMDSRRPSPFFITVNERQLNGRLSELKKKGMHPDLIRNMIQNVEFIAEYFNSLKKEDKVSEDWSYVANVIDRIFLIIFSIMNVVGTWVILLNSPALFDNRTPL 487          

HSP 2 Score: 82.0333 bits (201), Expect = 1.497e-65
Identity = 38/95 (40.00%), Postives = 64/95 (67.37%), Query Frame = 3
Query:  207 KSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            + A Q+Y+ LL    YNK +RP++   ++V   FG  L ++ID++  +Q LTTN+W++ +W D  L W+P  +  ++ LH+P ++IW+PDI+LYN
Sbjct:   23 RYADQMYEDLL--YYYNKNVRPIKNASESVKVKFGSSLIRIIDVDEVNQVLTTNLWLEMQWFDYRLMWDPGRWGKIRKLHVPVDQIWIPDILLYN 115          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Fly
Match: nAChRbeta2 (gene:FBgn0004118 transcript:FBtr0084681)

HSP 1 Score: 254.218 bits (648), Expect = 8.221e-95
Identity = 171/388 (44.07%), Postives = 251/388 (64.69%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIR-----YXXXXXXXXXXXXHSPISKE--------KEMSERCFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLD 1599
            +L+    G YEV LMTKA + + G V W PPA+Y+SSC +NVE+FPYD Q C M F SWTYN  ++ LKH  Q  IP      G+ ++   +DL  FY SVE+DILE+ A ++   +    E F ++TF + MRRKTLFYTVNLI+PC+A++FL+VLVFYLP+ SGEK++L I+IL+SLT+FFLLL E IP TSL +PL+GKYLLFT+IL+SLS+  TV VLN++FRS  TH+MSP +R     ++    +        P   +         E+  R  +    + FK++      Y+  M+ S  S ++   ++  ++ + +  ++++  ++KD D  N++ E+W+FV++V+DR FL LF  +CV  T +II +SP+LYD R+P+D
Sbjct:  117 VLYNNWDGNYEVTLMTKATLKYTGEVFWEPPAIYKSSCEMNVEYFPYDEQICFMKFGSWTYNGAQVDLKHLDQ--IP------GSNLVQVGIDLTEFYLSVEWDILEVPATKNEEYYPDTLEPFSDITFKLTMRRKTLFYTVNLIVPCVALTFLTVLVFYLPSDSGEKVTLCISILVSLTVFFLLLAEIIPPTSLAVPLLGKYLLFTMILVSLSVWTTVCVLNIHFRSPSTHNMSPLVRKLFLHFMPKLMMMRRTQYTLPDYDDSTPSNGYTNEIDVRDSISDFPSEFKDSQDGA--YDNGMQNSVDSDNVIPRNLTPEVLQALRAVRFIAQHIKDADKDNEIVEDWKFVSMVLDRFFLWLFTLSCVFGTLAIICQSPSLYDTRSPID 494          

HSP 2 Score: 113.62 bits (283), Expect = 8.221e-95
Identity = 52/93 (55.91%), Postives = 73/93 (78.49%), Query Frame = 3
Query:  219 QLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYNTW 497
            +LY  LL  +NYN+LIRPV  N + +T + GLKL+QLI++N+++Q +TTN+WV+Q W D  LRW+PE+Y GV+ L++PS  IW+PDIVLYN W
Sbjct:   32 RLYDDLL--SNYNRLIRPVVNNTETLTVWLGLKLSQLIEVNLKNQVMTTNLWVKQRWFDYKLRWDPEEYGGVEQLYVPSEHIWVPDIVLYNNW 122          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Fly
Match: nAChRalpha4 (gene:FBgn0266347 transcript:FBtr0332872)

HSP 1 Score: 250.366 bits (638), Expect = 6.287e-93
Identity = 167/389 (42.93%), Postives = 253/389 (65.04%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSP-------ISKEKEMSERCFMYCNKTMFKEASASKLIYETFMR---RSKRSYSLKDASIEE-----KINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPL 1596
            +L+    G +EV L TKA ++ +G V+W PPA+Y+SSC I+VE+FP+D Q C + F SWTY+  K+ L+H  ++         G+ V+   VDL  FY SVE+DILE+ A R+ + +    E + ++TFNI MRRKTLFYTVN+I+PC+ +SFL+VL FYLP+ SGEK++LSI+IL+SL +FFLL+VE IP TSLV+PL+GKYL+F +IL+S+SI +TV+VLNV+FRS  TH M+PW++ +F+ FLP  LF+  P       I+        C ++         S+ ++     M       +S  L + +        KI+++   ++++ ++ K  +   KV+E+W++VA+V+DR+FL +F  A V+ T  IIL++P LYD R P+
Sbjct:   99 VLYNNADGNFEVTLATKATIYSEGLVEWKPPAIYKSSCEIDVEYFPFDEQTCVLKFGSWTYDGFKVDLRHMDEQ--------QGSNVVAVGVDLSEFYMSVEWDILEVPAVRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFLTVLTFYLPSDSGEKVTLSISILISLHVFFLLVVEIIPPTSLVVPLLGKYLIFAMILVSISICVTVVVLNVHFRSPQTHKMAPWVKRVFIDFLPAFLFIKRPTYNFETSITANGPFGGSCQVHGPVPPLTHCSSDEIAAVPDMDIGPLGMKSPILNNPAFSHSKCLPKIHKSCFCVRFIAEHTKMQEDSTKVKEDWKYVAMVLDRLFLWIFTLAVVVGTAGIILQAPTLYDDRIPI 479          

HSP 2 Score: 111.309 bits (277), Expect = 6.287e-93
Identity = 52/98 (53.06%), Postives = 69/98 (70.41%), Query Frame = 3
Query:  198 TGFKSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
             G   A +LY  LL  +NYNKL+RPV    D +     LKL+QLID+N+++Q +TTN+WV+Q W D  LRW P++Y GV +LH+PS+ IW PDIVLYN
Sbjct:    7 AGNPDAKRLYDDLL--SNYNKLVRPVVNTTDVLKVCIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYN 102          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Fly
Match: nAChRalpha4 (gene:FBgn0266347 transcript:FBtr0346707)

HSP 1 Score: 214.157 bits (544), Expect = 3.991e-82
Identity = 131/239 (54.81%), Postives = 180/239 (75.31%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIR 1191
            +L+    G YEV LMTKA V+++G V W PPAVY+SSC I+VE+FPYD+Q C +   SWTY+  K+ L+H  ++         G+ V+   VDL  FY SVE+DILE+ A R+ + +    E + ++TFNI MRRKTLFYTVN+I+PC+ +SFL+VL FYLP+ SGEK++LSI+IL+SL +FFLL+VE IP TSLV+PL+GKYL+F +IL+S+SI +TV+VLNV+FRS  TH M+PW++
Sbjct:   99 VLYNNADGHYEVTLMTKAIVYNNGLVIWQPPAVYKSSCSIDVEYFPYDVQTCILKLGSWTYDGFKVDLRHMDEQ--------QGSNVVAVGVDLSEFYMSVEWDILEVPAVRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFLTVLTFYLPSDSGEKVTLSISILISLHVFFLLVVEIIPPTSLVVPLLGKYLIFAMILVSISICVTVVVLNVHFRSPQTHKMAPWVK 329          

HSP 2 Score: 111.694 bits (278), Expect = 3.991e-82
Identity = 52/98 (53.06%), Postives = 69/98 (70.41%), Query Frame = 3
Query:  198 TGFKSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
             G   A +LY  LL  +NYNKL+RPV    D +     LKL+QLID+N+++Q +TTN+WV+Q W D  LRW P++Y GV +LH+PS+ IW PDIVLYN
Sbjct:    7 AGNPDAKRLYDDLL--SNYNKLVRPVVNTTDVLKVCIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYN 102          

HSP 3 Score: 64.6994 bits (156), Expect = 1.196e-10
Identity = 27/69 (39.13%), Postives = 49/69 (71.01%), Query Frame = 1
Query: 1390 KINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPL 1596
            KI+++   ++++ ++ K  +   KV+E+W++VA+V+DR+FL +F  A V+ T  IIL++P LYD R P+
Sbjct:  451 KIHKSCFCVRFIAEHTKMQEDSTKVKEDWKYVAMVLDRLFLWIFTLAVVVGTAGIILQAPTLYDDRIPI 519          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Fly
Match: nAChRalpha2 (gene:FBgn0000039 transcript:FBtr0084639)

HSP 1 Score: 208.379 bits (529), Expect = 4.408e-82
Identity = 138/300 (46.00%), Postives = 197/300 (65.67%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKD 1374
            +L+    G+Y V  MTKA + + G V WTPPA+++SSC I+V +FP+D Q C M F SWTY+  ++ LKH +QK   D+    G       +DLR +Y SVE+DIL + A RH + +   +E +P++ FNI +RRKTLFYTVNLI+PC+ +S+LSVLVFYLP  SGEKI+L I+ILLS T+FFLL+ E IPSTSL +PL+GKYLLFT++L+ LS++IT+I+LN+++R   TH M PWIR  F+                K + +   M   K + ++ +A+K+ Y     ++K   +L D
Sbjct:  132 VLYNNADGEYVVTTMTKAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDKDNKVEIG-------IDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPSTHKMRPWIRSFFI----------------KRLPKLLLMRVPKDLLRDLAANKINYGLKFSKTKFGQALMD 408          

HSP 2 Score: 117.087 bits (292), Expect = 4.408e-82
Identity = 61/117 (52.14%), Postives = 82/117 (70.09%), Query Frame = 3
Query:  141 RFNKPLEXXXXXXXXXQTSTGFKSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            R  KPL +++++ +L +T      A +LY  LL  +NYN+LIRPV  N D V    GL+L+QLIDLN++DQ LTTNVW++ EWQD   +W+P +Y GV  L++PS  IWLPDIVLYN
Sbjct:   21 RHCKPLCLLLVLLLLCETVQANPDAKRLYDDLL--SNYNRLIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYN 135          

HSP 3 Score: 53.5286 bits (127), Expect = 3.700e-7
Identity = 27/83 (32.53%), Postives = 49/83 (59.04%), Query Frame = 1
Query: 1363 SLKDASIEEK----INRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLD 1599
            SL D +  +K    + + I ++ ++  +++  D  N   ++W FVA+VMDR+FL LF+ A ++ T  I+  +P+LYD    +D
Sbjct:  476 SLSDVAARKKYPFELEKAIHNVMFIQHHMQRQDEFNAEDQDWGFVAMVMDRLFLWLFMIASLVGTFVILGEAPSLYDDTKAID 558          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Fly
Match: nAChRalpha2 (gene:FBgn0000039 transcript:FBtr0084640)

HSP 1 Score: 208.379 bits (529), Expect = 4.408e-82
Identity = 138/300 (46.00%), Postives = 197/300 (65.67%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKD 1374
            +L+    G+Y V  MTKA + + G V WTPPA+++SSC I+V +FP+D Q C M F SWTY+  ++ LKH +QK   D+    G       +DLR +Y SVE+DIL + A RH + +   +E +P++ FNI +RRKTLFYTVNLI+PC+ +S+LSVLVFYLP  SGEKI+L I+ILLS T+FFLL+ E IPSTSL +PL+GKYLLFT++L+ LS++IT+I+LN+++R   TH M PWIR  F+                K + +   M   K + ++ +A+K+ Y     ++K   +L D
Sbjct:  132 VLYNNADGEYVVTTMTKAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDKDNKVEIG-------IDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPSTHKMRPWIRSFFI----------------KRLPKLLLMRVPKDLLRDLAANKINYGLKFSKTKFGQALMD 408          

HSP 2 Score: 117.087 bits (292), Expect = 4.408e-82
Identity = 61/117 (52.14%), Postives = 82/117 (70.09%), Query Frame = 3
Query:  141 RFNKPLEXXXXXXXXXQTSTGFKSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            R  KPL +++++ +L +T      A +LY  LL  +NYN+LIRPV  N D V    GL+L+QLIDLN++DQ LTTNVW++ EWQD   +W+P +Y GV  L++PS  IWLPDIVLYN
Sbjct:   21 RHCKPLCLLLVLLLLCETVQANPDAKRLYDDLL--SNYNRLIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYN 135          

HSP 3 Score: 53.5286 bits (127), Expect = 3.700e-7
Identity = 27/83 (32.53%), Postives = 49/83 (59.04%), Query Frame = 1
Query: 1363 SLKDASIEEK----INRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLD 1599
            SL D +  +K    + + I ++ ++  +++  D  N   ++W FVA+VMDR+FL LF+ A ++ T  I+  +P+LYD    +D
Sbjct:  476 SLSDVAARKKYPFELEKAIHNVMFIQHHMQRQDEFNAEDQDWGFVAMVMDRLFLWLFMIASLVGTFVILGEAPSLYDDTKAID 558          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Zebrafish
Match: chrnb3b (cholinergic receptor, nicotinic, beta 3b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-030102-4])

HSP 1 Score: 189.119 bits (479), Expect = 1.273e-69
Identity = 143/375 (38.13%), Postives = 225/375 (60.00%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMT-HSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFMYCNKTMFK----EASASKLIYETFMRRSKRSYSLKDASIEEKIN---RTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPAL 1575
            +L+    G++E  +MTKA V ++G + WTPPA Y+S+C ++V FFP+D QNC M F SWTY+ + + L                 V++NH VD  +F+ + E++I  LSA  H    +     +P +T++ I++R  LFYT+ LI+PCL +SFL+VLVFYLP+  GEK+SLS ++L+SLT+F L++ E IPS+S VIPLIG+YLLF +I ++LSII+TV V+NV+ RS+ T H MSPW+R +FL                + + +   M  N   +     E  +  L       RSK+     +   +  IN   +    ++Y+  ++K + +  +V ++W+FVA V+DR+FL  FL+  V+  G+I++ +PA+
Sbjct:  118 VLYENADGRFEGSIMTKAIVRYNGLITWTPPASYKSACTMDVTFFPFDRQNCSMKFGSWTYDGNMVEL-----------------VLVNHQVDRSDFFDNGEWEI--LSATGHKGSRRDGHYSYPYITYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKVSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSATYHPMSPWVRTLFL----------------QRLPDLLCMRGNTDRYHYPQMEPQSPDL-----KPRSKKGPPGPEGDGQALINMLEQATNSVRYISRHIKKEHFIREVVQDWKFVAQVLDRIFLWAFLTVSVL--GTILIFTPAV 450          

HSP 2 Score: 95.1301 bits (235), Expect = 1.273e-69
Identity = 39/80 (48.75%), Postives = 56/80 (70.00%), Query Frame = 3
Query:  249 NYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLY 488
             Y + +RP+      V   FGLK++QL+D++ ++Q +TTNVW+ +EW D  LRWNPE+Y G+  + +PS  IWLPDIVLY
Sbjct:   41 GYQRWVRPILHANHTVKVRFGLKISQLVDVDEKNQLMTTNVWLYEEWLDYKLRWNPENYGGITFIRVPSESIWLPDIVLY 120          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Zebrafish
Match: chrna4b (cholinergic receptor, nicotinic, alpha 4b [Source:ZFIN;Acc:ZDB-GENE-090505-3])

HSP 1 Score: 176.022 bits (445), Expect = 1.576e-69
Identity = 117/239 (48.95%), Postives = 169/239 (70.71%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIR 1191
            +L+    G + V  +TKA+VF++G +KW PPA+Y+SSC I+V FFP+D QNC+M F SWTY+  K+ L                 + +   VD  +++ S E+ I+      +I++++  +E +P++T++ I+RR  LFYT+NLI+PCL +S L+VLVFYLP++  EKI+L I++LLSLT+F LL+ E IPSTSLVIPLIG+YLLFT+I ++LSIIITV VLNV+ RS+ THSM  W+R
Sbjct:  118 VLYNNADGDFAVTHLTKAQVFYNGRIKWKPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDRAKIDL-----------------ISMASDVDQMDYWESGEWVIINAVGTYNIKKYECCTEIYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECAEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSSRTHSMPHWVR 339          

HSP 2 Score: 107.842 bits (268), Expect = 1.576e-69
Identity = 49/81 (60.49%), Postives = 59/81 (72.84%), Query Frame = 3
Query:  249 NYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            NYNKL RPV    D V  +FGL + QLID++ ++Q +TTNVWV+QEW D  LRWNPE+YE V  + IPS  IW PDIVLYN
Sbjct:   41 NYNKLSRPVANISDVVLVHFGLSIAQLIDVDEKNQMMTTNVWVKQEWNDYKLRWNPEEYENVTSIRIPSEIIWRPDIVLYN 121          

HSP 3 Score: 53.1434 bits (126), Expect = 8.037e-7
Identity = 18/62 (29.03%), Postives = 43/62 (69.35%), Query Frame = 1
Query: 1375 ASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIIL 1560
            +++ + + + +  ++Y+ D+L+ +D    V+E+W++VA+V+DR+FL +F+  C++ T  + L
Sbjct:  558 SNLSQSLLKALEGVQYIADHLRAEDSDFSVREDWKYVAMVIDRIFLWMFVLVCILGTVGLFL 619          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Zebrafish
Match: chrnb3a (cholinergic receptor, nicotinic, beta polypeptide 3a [Source:ZFIN;Acc:ZDB-GENE-040108-1])

HSP 1 Score: 181.03 bits (458), Expect = 4.204e-69
Identity = 140/378 (37.04%), Postives = 226/378 (59.79%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMT-HSMSPWIR--YXXXXXXXXXXXXHSPISKEKEMSERCFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKDASIEEKINRT-IADLK-------YVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPAL 1575
            +L+    G++E  LMTKA V  +GT+ WTPPA Y+S+C ++V FFP+D QNC M F SWTY D  MV                   +++  VD ++F+ + E++IL  + +R  R+    S  +P +T++ I++R  LFYT+ LI+PCL +SFL+VLVFYLP+  GEK+SLS ++L+SLT+F L++ E IPS+S VIPLIG+YLLF +I ++ SII+TV V+NV+ RS+ T H M+PW++  ++        +  H+   +  ++  R               S  +     +  ++S     A ++E  N+  IA L+       Y+  +++ + +  +V ++W+FVA V+DR+FL  FL+  V+  G+I++ +PAL
Sbjct:  119 VLYENADGRFEGSLMTKAIVRFNGTIMWTPPASYKSACTMDVTFFPFDRQNCSMKFGSWTY-DGTMV----------------DLTLVDAYVDRKDFFDNGEWEILNATGQRGSRRDGIYS--YPYLTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTFSIIVTVFVINVHHRSSATYHPMAPWVKSLFLQRLPRLLCMRGHTDRYQYPDIELR---------------SPELKRGMKKGQQKSAGGGRAGVKEDENQAWIALLEKATHSVHYISRHIRKEHFIREVVQDWKFVAQVLDRIFLWAFLTVSVL--GTILIFTPAL 460          

HSP 2 Score: 101.679 bits (252), Expect = 4.204e-69
Identity = 43/81 (53.09%), Postives = 58/81 (71.60%), Query Frame = 3
Query:  246 NNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLY 488
              Y K +RPV    D +T  FGLK++QL+D++ ++Q +TTNVW+ +EW D  LRWNPEDY G+  + +PS  IWLPDIVLY
Sbjct:   41 RGYQKWVRPVLHANDTITVRFGLKISQLVDVDEKNQLMTTNVWLWEEWTDYKLRWNPEDYGGITSIRVPSETIWLPDIVLY 121          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Zebrafish
Match: chrnb3a (cholinergic receptor, nicotinic, beta polypeptide 3a [Source:ZFIN;Acc:ZDB-GENE-040108-1])

HSP 1 Score: 181.03 bits (458), Expect = 5.130e-69
Identity = 140/378 (37.04%), Postives = 226/378 (59.79%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMT-HSMSPWIR--YXXXXXXXXXXXXHSPISKEKEMSERCFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKDASIEEKINRT-IADLK-------YVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPAL 1575
            +L+    G++E  LMTKA V  +GT+ WTPPA Y+S+C ++V FFP+D QNC M F SWTY D  MV                   +++  VD ++F+ + E++IL  + +R  R+    S  +P +T++ I++R  LFYT+ LI+PCL +SFL+VLVFYLP+  GEK+SLS ++L+SLT+F L++ E IPS+S VIPLIG+YLLF +I ++ SII+TV V+NV+ RS+ T H M+PW++  ++        +  H+   +  ++  R               S  +     +  ++S     A ++E  N+  IA L+       Y+  +++ + +  +V ++W+FVA V+DR+FL  FL+  V+  G+I++ +PAL
Sbjct:  111 VLYENADGRFEGSLMTKAIVRFNGTIMWTPPASYKSACTMDVTFFPFDRQNCSMKFGSWTY-DGTMV----------------DLTLVDAYVDRKDFFDNGEWEILNATGQRGSRRDGIYS--YPYLTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTFSIIVTVFVINVHHRSSATYHPMAPWVKSLFLQRLPRLLCMRGHTDRYQYPDIELR---------------SPELKRGMKKGQQKSAGGGRAGVKEDENQAWIALLEKATHSVHYISRHIRKEHFIREVVQDWKFVAQVLDRIFLWAFLTVSVL--GTILIFTPAL 452          

HSP 2 Score: 101.293 bits (251), Expect = 5.130e-69
Identity = 43/81 (53.09%), Postives = 58/81 (71.60%), Query Frame = 3
Query:  246 NNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLY 488
              Y K +RPV    D +T  FGLK++QL+D++ ++Q +TTNVW+ +EW D  LRWNPEDY G+  + +PS  IWLPDIVLY
Sbjct:   33 RGYQKWVRPVLHANDTITVRFGLKISQLVDVDEKNQLMTTNVWLWEEWTDYKLRWNPEDYGGITSIRVPSETIWLPDIVLY 113          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Zebrafish
Match: chrna2b (cholinergic receptor, nicotinic, alpha 2b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-041001-99])

HSP 1 Score: 176.022 bits (445), Expect = 5.587e-68
Identity = 117/238 (49.16%), Postives = 164/238 (68.91%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWI 1188
            +L+    G++ V  MTKA +FH G V+W PPA+Y+SSC I+V FFP+D QNC+M F SWTY+  K+ L+                  I + VDL++++ S E+ I+      + +++    E +P++T+  I+RR  LFYT+NLI+PCL +S L+VLVFYLP+  GEKI+L I++LLSLT+F LL+ E IPSTSLVIPLIG+YLLFT+I ++LSI+ITV VLNV+ RS  TH M  W+
Sbjct:  122 VLYNNADGEFAVTHMTKAHLFHTGKVRWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLER-----------------IENTVDLKDYWESGEWAIINAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPCWV 342          

HSP 2 Score: 102.834 bits (255), Expect = 5.587e-68
Identity = 47/91 (51.65%), Postives = 62/91 (68.13%), Query Frame = 3
Query:  219 QLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            +L++KL D   YNK  RPV    D V   FGL + QLID++ ++Q +TTNVW++QEW D  LRW P DY+ V  + +PS  IW+PDIVLYN
Sbjct:   37 ELFKKLFD--GYNKWSRPVPNTSDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYN 125          

HSP 3 Score: 49.6766 bits (117), Expect = 7.986e-6
Identity = 18/60 (30.00%), Postives = 39/60 (65.00%), Query Frame = 1
Query: 1381 IEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIIL 1560
            +   + + +  + Y+ D+L+ +D    V+E+W++VA+V+DR+FL +F+  C++ T  + L
Sbjct:  483 LSPSVLQALEGVHYIADHLRAEDADFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTIGLFL 542          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Xenopus
Match: usp16 (ubiquitin specific peptidase 16 [Source:Xenbase;Acc:XB-GENE-1007164])

HSP 1 Score: 184.111 bits (466), Expect = 4.903e-71
Identity = 139/400 (34.75%), Postives = 230/400 (57.50%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHA-VDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFM-------YCNKTMFKEASASK------------LIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLDGNHLP 1614
            +L+    G YEV L T A V ++G+V W PPA+Y+S+C I V+ FP+D QNC + F SWTY+        YT+  +          V+N     + +F  S E+DI+EL  RR I         + +VT++ I++RK LFYT+NLI+PC+ ++ L++LVFYLP+  G+K++L I++LL+LT+F LL+ + +P TSL +PLIGKYL+FT++L++ SI+ +V VLNV+ RS  TH+M PW++  FL  LP  LF+  P +       R +        + N   F   + ++            + ++ F  R  R Y+        +++  +  +K++ +++K +D    + E+W++VA+V+DR+FL +F+  C++ T  + ++         PL  NH P
Sbjct:  129 VLYNNADGTYEVSLFTNAIVQNNGSVAWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYD--------YTEIDL----------VLNKGWATMDDFTPSGEWDIIELPGRRTICPLD---PTYVDVTYDFIIKRKPLFYTINLIIPCILITSLAILVFYLPSDCGQKMTLCISVLLALTVFLLLISKIVPPTSLDVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHTMPPWVKNCFLDRLPVFLFMKRPENSSASQKLRSYRRNMQIESFRNSNYFVNMTTARPCDHTVNDPPESVRHQEFRYRYPRKYT-------PEVHEAMDGVKFISEHMKSEDEDQSIIEDWKYVAMVVDRLFLWIFIIVCIVGTVGLFMQ---------PLIQNHTP 491          

HSP 2 Score: 105.531 bits (262), Expect = 4.903e-71
Identity = 54/103 (52.43%), Postives = 67/103 (65.05%), Query Frame = 3
Query:  192 TSTGFKSA---VQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
             S G K+A    +L   LL ++ YNKLIRP   N   V+    L L QLI +N R+Q +TTNVW+ QEW D  L WNP DY+G++ L IPS +IWLPDIVLYN
Sbjct:   30 CSLGCKAADSEERLMNNLLRKDKYNKLIRPAYNNSQLVSIQLQLSLAQLISVNEREQIMTTNVWLNQEWVDYRLTWNPADYDGIKKLRIPSQQIWLPDIVLYN 132          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Xenopus
Match: usp16 (ubiquitin specific peptidase 16 [Source:Xenbase;Acc:XB-GENE-1007164])

HSP 1 Score: 184.111 bits (466), Expect = 1.430e-70
Identity = 139/400 (34.75%), Postives = 230/400 (57.50%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHA-VDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFM-------YCNKTMFKEASASK------------LIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLDGNHLP 1614
            +L+    G YEV L T A V ++G+V W PPA+Y+S+C I V+ FP+D QNC + F SWTY+        YT+  +          V+N     + +F  S E+DI+EL  RR I         + +VT++ I++RK LFYT+NLI+PC+ ++ L++LVFYLP+  G+K++L I++LL+LT+F LL+ + +P TSL +PLIGKYL+FT++L++ SI+ +V VLNV+ RS  TH+M PW++  FL  LP  LF+  P +       R +        + N   F   + ++            + ++ F  R  R Y+        +++  +  +K++ +++K +D    + E+W++VA+V+DR+FL +F+  C++ T  + ++         PL  NH P
Sbjct:   99 VLYNNADGTYEVSLFTNAIVQNNGSVAWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYD--------YTEIDL----------VLNKGWATMDDFTPSGEWDIIELPGRRTICPL---DPTYVDVTYDFIIKRKPLFYTINLIIPCILITSLAILVFYLPSDCGQKMTLCISVLLALTVFLLLISKIVPPTSLDVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHTMPPWVKNCFLDRLPVFLFMKRPENSSASQKLRSYRRNMQIESFRNSNYFVNMTTARPCDHTVNDPPESVRHQEFRYRYPRKYT-------PEVHEAMDGVKFISEHMKSEDEDQSIIEDWKYVAMVVDRLFLWIFIIVCIVGTVGLFMQ---------PLIQNHTP 461          

HSP 2 Score: 103.99 bits (258), Expect = 1.430e-70
Identity = 53/100 (53.00%), Postives = 66/100 (66.00%), Query Frame = 3
Query:  201 GFKSA---VQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            G K+A    +L   LL ++ YNKLIRP   N   V+    L L QLI +N R+Q +TTNVW+ QEW D  L WNP DY+G++ L IPS +IWLPDIVLYN
Sbjct:    3 GCKAADSEERLMNNLLRKDKYNKLIRPAYNNSQLVSIQLQLSLAQLISVNEREQIMTTNVWLNQEWVDYRLTWNPADYDGIKKLRIPSQQIWLPDIVLYN 102          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Xenopus
Match: usp16 (ubiquitin specific peptidase 16 [Source:Xenbase;Acc:XB-GENE-1007164])

HSP 1 Score: 183.726 bits (465), Expect = 1.688e-70
Identity = 139/400 (34.75%), Postives = 230/400 (57.50%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHA-VDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFM-------YCNKTMFKEASASK------------LIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLDGNHLP 1614
            +L+    G YEV L T A V ++G+V W PPA+Y+S+C I V+ FP+D QNC + F SWTY+        YT+  +          V+N     + +F  S E+DI+EL  RR I         + +VT++ I++RK LFYT+NLI+PC+ ++ L++LVFYLP+  G+K++L I++LL+LT+F LL+ + +P TSL +PLIGKYL+FT++L++ SI+ +V VLNV+ RS  TH+M PW++  FL  LP  LF+  P +       R +        + N   F   + ++            + ++ F  R  R Y+        +++  +  +K++ +++K +D    + E+W++VA+V+DR+FL +F+  C++ T  + ++         PL  NH P
Sbjct:  117 VLYNNADGTYEVSLFTNAIVQNNGSVAWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYD--------YTEIDL----------VLNKGWATMDDFTPSGEWDIIELPGRRTICPL---DPTYVDVTYDFIIKRKPLFYTINLIIPCILITSLAILVFYLPSDCGQKMTLCISVLLALTVFLLLISKIVPPTSLDVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHTMPPWVKNCFLDRLPVFLFMKRPENSSASQKLRSYRRNMQIESFRNSNYFVNMTTARPCDHTVNDPPESVRHQEFRYRYPRKYT-------PEVHEAMDGVKFISEHMKSEDEDQSIIEDWKYVAMVVDRLFLWIFIIVCIVGTVGLFMQ---------PLIQNHTP 479          

HSP 2 Score: 103.99 bits (258), Expect = 1.688e-70
Identity = 51/94 (54.26%), Postives = 63/94 (67.02%), Query Frame = 3
Query:  210 SAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            S  +L   LL ++ YNKLIRP   N   V+    L L QLI +N R+Q +TTNVW+ QEW D  L WNP DY+G++ L IPS +IWLPDIVLYN
Sbjct:   27 SEERLMNNLLRKDKYNKLIRPAYNNSQLVSIQLQLSLAQLISVNEREQIMTTNVWLNQEWVDYRLTWNPADYDGIKKLRIPSQQIWLPDIVLYN 120          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Xenopus
Match: usp16 (ubiquitin specific peptidase 16 [Source:Xenbase;Acc:XB-GENE-1007164])

HSP 1 Score: 181.03 bits (458), Expect = 3.389e-70
Identity = 134/384 (34.90%), Postives = 226/384 (58.85%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHA-VDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFM-------YCNKTMFKEASASK------------LIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRS 1566
            +L+    G YEV L T A V ++G+V W PPA+Y+S+C I V+ FP+D QNC + F SWTY+        YT+  +          V+N     + +F  S E+DI+EL  RR I         + +VT++ I++RK LFYT+NLI+PC+ ++ L++LVFYLP+  G+K++L I++LL+LT+F LL+ + +P TSL +PLIGKYL+FT++L++ SI+ +V VLNV+ RS  TH+M PW++  FL  LP  LF+  P +       R +        + N   F   + ++            + ++ F  R  R Y+        +++  +  +K++ +++K +D    + E+W++VA+V+DR+FL +F+  C++ T  + +++
Sbjct:  137 VLYNNADGTYEVSLFTNAIVQNNGSVAWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYD--------YTEIDL----------VLNKGWATMDDFTPSGEWDIIELPGRRTICPL---DPTYVDVTYDFIIKRKPLFYTINLIIPCILITSLAILVFYLPSDCGQKMTLCISVLLALTVFLLLISKIVPPTSLDVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHTMPPWVKNCFLDRLPVFLFMKRPENSSASQKLRSYRRNMQIESFRNSNYFVNMTTARPCDHTVNDPPESVRHQEFRYRYPRKYT-------PEVHEAMDGVKFISEHMKSEDEDQSIIEDWKYVAMVVDRLFLWIFIIVCIVGTVGLFMQA 492          

HSP 2 Score: 105.916 bits (263), Expect = 3.389e-70
Identity = 54/103 (52.43%), Postives = 67/103 (65.05%), Query Frame = 3
Query:  192 TSTGFKSA---VQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
             S G K+A    +L   LL ++ YNKLIRP   N   V+    L L QLI +N R+Q +TTNVW+ QEW D  L WNP DY+G++ L IPS +IWLPDIVLYN
Sbjct:   38 CSLGCKAADSEERLMNNLLRKDKYNKLIRPAYNNSQLVSIQLQLSLAQLISVNEREQIMTTNVWLNQEWVDYRLTWNPADYDGIKKLRIPSQQIWLPDIVLYN 140          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Xenopus
Match: chrnb2 (cholinergic receptor nicotinic beta 2 subunit [Source:NCBI gene;Acc:100101688])

HSP 1 Score: 184.496 bits (467), Expect = 2.351e-68
Identity = 136/386 (35.23%), Postives = 221/386 (57.25%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISK---------------------EKEMSERCFMYCNKTMFKE--ASASKLIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILR 1563
            +L+    G YEV   + A V HDG++ W PPA+Y+S+C I V+ FP+D QNC M F SWTY+  ++ L                 V+ +    L +F  S E+DI+ L  RR+          + ++T++ I+RRK LFYT+NLI+PC+ ++ L++LVFYLP+  GEK++L I++LL+LT+F LL+ + +P TSL +PL+GKYL+FT++L++ SI+ +V VLNV+ RS  TH+M PW++ +FL  LP +LF+  P                         ++ +  C  Y N+   K+  A  S+L       R ++    K       +   +  ++++ D++K +D    V E+W++VA+V+DR+FL +F+  CV  T  + L+
Sbjct:  118 VLYNNADGMYEVSFYSNAVVSHDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTELDL-----------------VLRSDVASLDDFTPSGEWDIIALPGRRNENP---NDSTYVDITYDFIIRRKPLFYTINLIIPCILITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMPPWVKVVFLDKLPTLLFMKQPRQNCARQRLRQQRQSQERAAGSFFLRDGARSCTCYVNQASVKKYGAQLSELPEGVNGFRDRQG---KVRQCLCGLQEAVDGVRFIADHMKSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQ 480          

HSP 2 Score: 96.2857 bits (238), Expect = 2.351e-68
Identity = 43/100 (43.00%), Postives = 65/100 (65.00%), Query Frame = 3
Query:  192 TSTGFKSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            +  G  +  +L + LLD + YNKLIRP     + VT    + L QLI ++ R+Q +TTNVW+ QEW+D  L W+P +++ ++ + +PS  IWLPD+VLYN
Sbjct:   22 SCLGTDTEERLVEHLLDPSRYNKLIRPATNGSEQVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWDPAEFDDMKKVRLPSKHIWLPDVVLYN 121          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Mouse
Match: Chrna6 (cholinergic receptor, nicotinic, alpha polypeptide 6 [Source:MGI Symbol;Acc:MGI:106213])

HSP 1 Score: 204.912 bits (520), Expect = 5.918e-76
Identity = 145/396 (36.62%), Postives = 241/396 (60.86%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISKEKEMS-----ERCFMYCNKTMFKEASASKLIYETF-----------MRRSKRS---YSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLDGN 1605
            +L+    G ++V+  TKA + +DG + WTPPA+++SSC +++ FFP+D QNC + F SWTY+  ++ L                 ++I   VD+ +F+ + E++I++ S  +H  ++    E + ++T++  +RR  +FYT+NLI+PCL +SFL+VLVFYLP+  GEK++L I++LLSLT+F L++ ETIPSTSLVIPL+G+YLLFT+I ++LSI++TV VLN+++R+  TH+M  W++ IFL+  P IL +  P+ K KE       +       K  F     SKL+ E              RRS +    +  +++     +   I  ++++ +N+K  +  N+V+++W+++A+V+DRVFL +F+  CV  T  + L+         PL GN
Sbjct:  121 VLYNNAVGDFQVEGKTKALLKYDGVITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDL-----------------LIIGSKVDMNDFWENSEWEIVDASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPATHTMPKWVKTIFLQAFPSILMMRKPLDKTKEAGGVKDPKSHTKRPAKVKFTHRGESKLLKECHHCQKSSDIAPGKRRSSQQPARWVAENSEHSSDVEDVIESVQFIAENMKSHNETNEVEDDWKYMAMVVDRVFLWVFIIVCVFGTVGLFLQ---------PLLGN 490          

HSP 2 Score: 100.523 bits (249), Expect = 5.918e-76
Identity = 45/101 (44.55%), Postives = 70/101 (69.31%), Query Frame = 3
Query:  189 QTSTGFKSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            + STG +S  QL+ +L    +YN+ IRPVE   D VT +F L +TQL +++  +Q + TN+W++  W+D  LRW+P +Y+G++ L +P++ IW PDIVLYN
Sbjct:   26 KGSTGCESEEQLFHRLF--AHYNRFIRPVENVSDPVTVHFELAITQLANVDEVNQIMETNLWLRHIWKDYRLRWDPTEYDGIETLRVPADNIWKPDIVLYN 124          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Mouse
Match: Chrna2 (cholinergic receptor, nicotinic, alpha polypeptide 2 (neuronal) [Source:MGI Symbol;Acc:MGI:87886])

HSP 1 Score: 203.371 bits (516), Expect = 5.059e-74
Identity = 147/399 (36.84%), Postives = 225/399 (56.39%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISK------------------EKEMSER-------------------CFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIIL 1560
            +L+    G++ V  MTKA +F  GTV W PPA+Y+SSC I+V FFP+D QNC+M F SWTY+  K+ L+                  +   VDL++++ S E+ I+  +   + +++   +E +P+VT+  ++RR  LFYT+NLI+PCL +S L+VLVFYLP++ GEKI+L I++LLSLT+F LL+ E IPSTSLVIPLIG+YLLFT+I ++LSI+ITV VLNV+ RS  TH+M  W+R   L  +P  L ++ P+                    E  M                      C    + +M        L        +K      +  +  +I + +  + Y+ D+L+ +D  + V+E+W++VA+V+DR+FL LF+  C + T  + L
Sbjct:  123 VLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQ-----------------MERTVDLKDYWESGEWAIINATGTYNSKKYDCCAEIYPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMPNWVRVALLGRVPRWLMMNRPLPPMELHGSPGLKLSPTYHWLETNMDAEEREETEEEEEEEEDENICMCAGLPDSSMGVLYGHGSLHLRAMGPEAKTPSQASEILLSPQIQKALEGVHYIADHLRSEDADSSVKEDWKYVAMVVDRIFLWLFIIVCFLGTIGLFL 504          

HSP 2 Score: 95.9005 bits (237), Expect = 5.059e-74
Identity = 42/91 (46.15%), Postives = 60/91 (65.93%), Query Frame = 3
Query:  219 QLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            +L++ L     YN+  RPV    D V   FGL + QLID++ ++Q +TTNVW++QEW D  LRW+P ++  +  L +PS  IW+PDIVLYN
Sbjct:   38 RLFKHLF--GGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNITSLRVPSEMIWIPDIVLYN 126          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Mouse
Match: Chrna2 (cholinergic receptor, nicotinic, alpha polypeptide 2 (neuronal) [Source:MGI Symbol;Acc:MGI:87886])

HSP 1 Score: 203.371 bits (516), Expect = 5.059e-74
Identity = 147/399 (36.84%), Postives = 225/399 (56.39%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISK------------------EKEMSER-------------------CFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIIL 1560
            +L+    G++ V  MTKA +F  GTV W PPA+Y+SSC I+V FFP+D QNC+M F SWTY+  K+ L+                  +   VDL++++ S E+ I+  +   + +++   +E +P+VT+  ++RR  LFYT+NLI+PCL +S L+VLVFYLP++ GEKI+L I++LLSLT+F LL+ E IPSTSLVIPLIG+YLLFT+I ++LSI+ITV VLNV+ RS  TH+M  W+R   L  +P  L ++ P+                    E  M                      C    + +M        L        +K      +  +  +I + +  + Y+ D+L+ +D  + V+E+W++VA+V+DR+FL LF+  C + T  + L
Sbjct:  123 VLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQ-----------------MERTVDLKDYWESGEWAIINATGTYNSKKYDCCAEIYPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMPNWVRVALLGRVPRWLMMNRPLPPMELHGSPGLKLSPTYHWLETNMDAEEREETEEEEEEEEDENICMCAGLPDSSMGVLYGHGSLHLRAMGPEAKTPSQASEILLSPQIQKALEGVHYIADHLRSEDADSSVKEDWKYVAMVVDRIFLWLFIIVCFLGTIGLFL 504          

HSP 2 Score: 95.9005 bits (237), Expect = 5.059e-74
Identity = 42/91 (46.15%), Postives = 60/91 (65.93%), Query Frame = 3
Query:  219 QLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            +L++ L     YN+  RPV    D V   FGL + QLID++ ++Q +TTNVW++QEW D  LRW+P ++  +  L +PS  IW+PDIVLYN
Sbjct:   38 RLFKHLF--GGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNITSLRVPSEMIWIPDIVLYN 126          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Mouse
Match: Chrnb3 (cholinergic receptor, nicotinic, beta polypeptide 3 [Source:MGI Symbol;Acc:MGI:106212])

HSP 1 Score: 193.356 bits (490), Expect = 6.178e-74
Identity = 150/370 (40.54%), Postives = 226/370 (61.08%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMT-HSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKDAS--IEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPAL 1575
            +LF    G++E  LMTKA V   GTV WTPPA Y+SSC ++V FFP+D QNC M F SWTY D  MV                  ++IN  VD ++F+ + E++IL     +  R+    S  +P VT++ ++RR  LFYT+ LI+PCL +SFL+VLVFYLP+  GEK+SLS ++L+SLT+F L++ E IPS+S VIPLIG+YLLF +I ++LSII+TV V+NV+ RS+ T H M+PW++ +FL+ LP  L +  P               ++  F + + SK          K+     D    +   + +    ++Y+  ++K + + ++V ++W+FVA V+DR+FL LFL+A V+  GS+++  PAL
Sbjct:  122 VLFENADGRFEGSLMTKAIVKSSGTVSWTPPASYKSSCTMDVTFFPFDKQNCSMKFGSWTY-DGTMV----------------DLILINENVDRKDFFDNGEWEILNAKGMKGNRREGFYS--YPFVTYSFVLRRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLEKLPRWLCMKDP--------------RDRFSFPDGTESKGTVRGKFPGKKKQTPTSDGERVLVAFLEKASESIRYISRHVKKEHFISQVVQDWKFVAQVLDRIFLWLFLTASVL--GSVLIFIPAL 456          

HSP 2 Score: 105.145 bits (261), Expect = 6.178e-74
Identity = 46/101 (45.54%), Postives = 66/101 (65.35%), Query Frame = 3
Query:  192 TSTGFKSAVQLYQKLLDE--NNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLY 488
             + G  S  +    LL      Y K +RPV  + D +  YFGLK++QL+D++ ++Q +TTNVW++QEW D  LRWNPEDY G+  + +PS  +WLPDIVL+
Sbjct:   24 ATAGLSSVAEHEDALLRHLFQGYQKCVRPVLNSSDIIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDQKLRWNPEDYGGINSIKVPSESLWLPDIVLF 124          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Mouse
Match: Chrnb2 (cholinergic receptor, nicotinic, beta polypeptide 2 (neuronal) [Source:MGI Symbol;Acc:MGI:87891])

HSP 1 Score: 184.496 bits (467), Expect = 1.190e-69
Identity = 134/387 (34.63%), Postives = 222/387 (57.36%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSP------------------------ISKEKEMSERCFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILR 1563
            +L+    G YEV   + A V +DG++ W PPA+Y+S+C I V+ FP+D QNC M F SWTY+  ++ L                 V+ +    L +F  S E+DI+ L  RR+      +   + ++T++ I+RRK LFYT+NLI+PC+ ++ L++LVFYLP+  GEK++L I++LL+LT+F LL+ + +P TSL +PL+GKYL+FT++L++ SI+ +V VLNV+ RS  TH+M+PW++ +FL+ LP +LFL  P                          +E   ++ C  + N     +  A     E       RS       + E ++     ++++ D+++ +D    V+E+W++VA+V+DR+FL +F+  CV  T  + L+
Sbjct:  118 VLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDL-----------------VLKSDVASLDDFTPSGEWDIIALPGRRNENP---DDSTYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPTLLFLQQPRHRCARQRLRLRRRQREREGAGTLFFREGPAADPCTCFVNPASM-QGLAGAFQAEPAAAGLGRSMGPCSCGLREAVD----GVRFIADHMRSEDDDQSVREDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQ 479          

HSP 2 Score: 100.138 bits (248), Expect = 1.190e-69
Identity = 44/91 (48.35%), Postives = 62/91 (68.13%), Query Frame = 3
Query:  219 QLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            +L + LLD + YNKLIRP     + VT    + L QLI ++ R+Q +TTNVW+ QEW+D  L W PED++ ++ + +PS  IWLPD+VLYN
Sbjct:   31 RLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEDFDNMKKVRLPSKHIWLPDVVLYN 121          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. UniProt/SwissProt
Match: sp|P25162|ACH4_DROME (Acetylcholine receptor subunit beta-like 2 OS=Drosophila melanogaster OX=7227 GN=nAChRbeta2 PE=2 SV=3)

HSP 1 Score: 254.218 bits (648), Expect = 6.300e-94
Identity = 171/388 (44.07%), Postives = 251/388 (64.69%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIR-----YXXXXXXXXXXXXHSPISKE--------KEMSERCFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLD 1599
            +L+    G YEV LMTKA + + G V W PPA+Y+SSC +NVE+FPYD Q C M F SWTYN  ++ LKH  Q  IP      G+ ++   +DL  FY SVE+DILE+ A ++   +    E F ++TF + MRRKTLFYTVNLI+PC+A++FL+VLVFYLP+ SGEK++L I+IL+SLT+FFLLL E IP TSL +PL+GKYLLFT+IL+SLS+  TV VLN++FRS  TH+MSP +R     ++    +        P   +         E+  R  +    + FK++      Y+  M+ S  S ++   ++  ++ + +  ++++  ++KD D  N++ E+W+FV++V+DR FL LF  +CV  T +II +SP+LYD R+P+D
Sbjct:  117 VLYNNWDGNYEVTLMTKATLKYTGEVFWEPPAIYKSSCEMNVEYFPYDEQICFMKFGSWTYNGAQVDLKHLDQ--IP------GSNLVQVGIDLTEFYLSVEWDILEVPATKNEEYYPDTLEPFSDITFKLTMRRKTLFYTVNLIVPCVALTFLTVLVFYLPSDSGEKVTLCISILVSLTVFFLLLAEIIPPTSLAVPLLGKYLLFTMILVSLSVWTTVCVLNIHFRSPSTHNMSPLVRKLFLHFMPKLMMMRRTQYTLPDYDDSTPSNGYTNEIDVRDSISDFPSEFKDSQDGA--YDNGMQNSVDSDNVIPRNLTPEVLQALRAVRFIAQHIKDADKDNEIVEDWKFVSMVLDRFFLWLFTLSCVFGTLAIICQSPSLYDTRSPID 494          

HSP 2 Score: 113.62 bits (283), Expect = 6.300e-94
Identity = 52/93 (55.91%), Postives = 73/93 (78.49%), Query Frame = 3
Query:  219 QLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYNTW 497
            +LY  LL  +NYN+LIRPV  N + +T + GLKL+QLI++N+++Q +TTN+WV+Q W D  LRW+PE+Y GV+ L++PS  IW+PDIVLYN W
Sbjct:   32 RLYDDLL--SNYNRLIRPVVNNTETLTVWLGLKLSQLIEVNLKNQVMTTNLWVKQRWFDYKLRWDPEEYGGVEQLYVPSEHIWVPDIVLYNNW 122          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. UniProt/SwissProt
Match: sp|P91766|ACH1_MANSE (Acetylcholine receptor subunit alpha-like OS=Manduca sexta OX=7130 GN=ARA1 PE=2 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 9.841e-92
Identity = 171/394 (43.40%), Postives = 247/394 (62.69%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFMYCNK----TMFKEASASKLIYETFMRRSKRSY---------------SLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLD 1599
            +L+    G +EV L TKA + + G V+W PPA+Y+SSC I+VE+FP+D Q C M F SWTY+  ++ L+H  +          GT V+   VDL  FYTSVE+DILE+ A R+ + +    E + ++TFNI MRRKTLFYTVNLI+PC+ +SFL+VLVFYLP+ SGEK+SLSI+ILLSLT+FFLLL E IP TSLV+PL+GK++LFT+IL + SI +TV+VLNV+FRS  TH+MSPW+R +F+  LP +L +  P  +      R           T++ E S            +                   +L+      ++++ I  + Y+ D  + ++   +V+E+W++VA+V+DR FL +F  A V+ +  IIL++P LYD R P+D
Sbjct:  112 VLYNNADGNFEVTLATKATLNYTGRVEWRPPAIYKSSCEIDVEYFPFDQQTCVMKFGSWTYDGFQVDLRHIDE--------VRGTNVVELGVDLSEFYTSVEWDILEVPAVRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNLIIPCMGISFLTVLVFYLPSDSGEKVSLSISILLSLTVFFLLLAEIIPPTSLVVPLLGKFVLFTMILDTFSICVTVVVLNVHFRSPQTHTMSPWVRRVFIHVLPRLLVMRRPHYRLDPHRSRFAGLVTGAGETTLWDEGSPGVPAPPRPPPCAPPLAPCAACAPAEAPALCDALRRWHRCPELHKAIDGINYIADQTRKEEESTRVKEDWKYVAMVLDRPFLWIFTLAVVVGSAGIILQAPTLYDERAPID 497          

HSP 2 Score: 111.309 bits (277), Expect = 9.841e-92
Identity = 53/99 (53.54%), Postives = 70/99 (70.71%), Query Frame = 3
Query:  195 STGFKSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
              G   A +LY  LL  +NYNKL+RPV    DA+T    LKL+QLID+N+++Q +TTN+WV+Q W D  L W P +Y GV++LH+PS+ IW PDIVLYN
Sbjct:   19 CAGNPDAKRLYDDLL--SNYNKLVRPVLNVSDALTVRIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLSWEPREYGGVEMLHVPSDHIWRPDIVLYN 115          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. UniProt/SwissProt
Match: sp|Q9N587|ACH6_CAEEL (Acetylcholine receptor subunit alpha-type unc-63 OS=Caenorhabditis elegans OX=6239 GN=unc-63 PE=1 SV=2)

HSP 1 Score: 239.58 bits (610), Expect = 5.594e-87
Identity = 167/391 (42.71%), Postives = 251/391 (64.19%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKH---YTQKGI-PDSSNTSGTV-----VINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSP------ISKEKEMSERCFMYCNKTMFKEASASKLIYETF-MRRSKRSYSL-KDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPL 1596
            +L+    G Y+V +MTKAK+ ++GTV+W PPA+Y+S C I+VEFFP+D Q C+M F SWTY   ++ L+H   + +K I  D     G       V++  +DL ++Y SVE+DIL +  +RH +++      F ++T+ I +RRKTLFYTVNLI P + +SFL+ LVFYLP+  GEKISL I+IL+SLT+FFLLLVE IPSTSLVIPLIGKYLLFT++L++LS+++TV+ LNV++RS  TH+M  W++ +F+ FLP  L +  P          ++   R   +           S+L+       R + S++L +D S    +   +  + Y+ D+LK+++   +V E+W++++VVMDR+FL+ F  AC   T  II R+P++YD    L
Sbjct:  114 VLYNNADGNYQVTIMTKAKLTYNGTVEWAPPAIYKSMCQIDVEFFPFDRQQCEMKFGSWTYGGLEVDLQHRDKHLEKEIEEDVEGVDGPTKEIVWVVDRGIDLSDYYPSVEWDILNVPGKRHSKRYPCCESPFIDITYEIHLRRKTLFYTVNLIFPSVGISFLTALVFYLPSDGGEKISLCISILISLTVFFLLLVEIIPSTSLVIPLIGKYLLFTMVLVTLSVVVTVVTLNVHYRSPTTHTMPKWMKRLFVDFLPKYLLMTRPQPPGHHSKPNRKFDSRASTFSIGVNHVLGQNSELLSPGLNSNREESSFTLPRDNS---PVRSAVESVAYIADHLKNEEDDKQVIEDWKYISVVMDRIFLITFTFACAFGTVVIIARAPSIYDNTPAL 501          

HSP 2 Score: 105.145 bits (261), Expect = 5.594e-87
Identity = 46/95 (48.42%), Postives = 71/95 (74.74%), Query Frame = 3
Query:  207 KSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            + A +L++ L+   +YNKL+RPV  N + +   F LKL+QL+D++ ++Q +TTNVW+Q  W D  LRW+P +Y GV++L++PS+ IWLPD+VLYN
Sbjct:   25 RDANRLFEDLI--ADYNKLVRPVSENGETLVVTFKLKLSQLLDVHEKNQIMTTNVWLQHSWMDYKLRWDPVEYGGVEVLYVPSDTIWLPDVVLYN 117          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. UniProt/SwissProt
Match: sp|P17644|ACH2_DROME (Acetylcholine receptor subunit alpha-like 2 OS=Drosophila melanogaster OX=7227 GN=nAChRalpha2 PE=2 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 3.378e-81
Identity = 138/300 (46.00%), Postives = 197/300 (65.67%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKD 1374
            +L+    G+Y V  MTKA + + G V WTPPA+++SSC I+V +FP+D Q C M F SWTY+  ++ LKH +QK   D+    G       +DLR +Y SVE+DIL + A RH + +   +E +P++ FNI +RRKTLFYTVNLI+PC+ +S+LSVLVFYLP  SGEKI+L I+ILLS T+FFLL+ E IPSTSL +PL+GKYLLFT++L+ LS++IT+I+LN+++R   TH M PWIR  F+                K + +   M   K + ++ +A+K+ Y     ++K   +L D
Sbjct:  132 VLYNNADGEYVVTTMTKAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDKDNKVEIG-------IDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPSTHKMRPWIRSFFI----------------KRLPKLLLMRVPKDLLRDLAANKINYGLKFSKTKFGQALMD 408          

HSP 2 Score: 117.087 bits (292), Expect = 3.378e-81
Identity = 61/117 (52.14%), Postives = 82/117 (70.09%), Query Frame = 3
Query:  141 RFNKPLEXXXXXXXXXQTSTGFKSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            R  KPL +++++ +L +T      A +LY  LL  +NYN+LIRPV  N D V    GL+L+QLIDLN++DQ LTTNVW++ EWQD   +W+P +Y GV  L++PS  IWLPDIVLYN
Sbjct:   21 RHCKPLCLLLVLLLLCETVQANPDAKRLYDDLL--SNYNRLIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYN 135          

HSP 3 Score: 53.5286 bits (127), Expect = 3.709e-6
Identity = 27/83 (32.53%), Postives = 49/83 (59.04%), Query Frame = 1
Query: 1363 SLKDASIEEK----INRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLD 1599
            SL D +  +K    + + I ++ ++  +++  D  N   ++W FVA+VMDR+FL LF+ A ++ T  I+  +P+LYD    +D
Sbjct:  476 SLSDVAARKKYPFELEKAIHNVMFIQHHMQRQDEFNAEDQDWGFVAMVMDRLFLWLFMIASLVGTFVILGEAPSLYDDTKAID 558          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. UniProt/SwissProt
Match: sp|P09478|ACH1_DROME (Acetylcholine receptor subunit alpha-like 1 OS=Drosophila melanogaster OX=7227 GN=nAChRalpha1 PE=2 SV=2)

HSP 1 Score: 202.601 bits (514), Expect = 3.701e-81
Identity = 129/239 (53.97%), Postives = 177/239 (74.06%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIR 1191
            +L+    G YEV +MTKA + H G V W PPA+Y+S C I+VE+FP+D Q C M F SWTY+ + + L+H  Q    DS N      I   +DL+++Y SVE+DI+ + A R+ + +    E + ++ FN+ +RRKTLFYTVNLI+PC+ +SFLSVLVFYLP+ SGEKISL I+ILLSLT+FFLLL E IP TSL +PL+GKYLLFT++L++LS+++T+ VLNVNFRS +TH M+PW++
Sbjct:  112 VLYNNADGNYEVTIMTKAILHHTGKVVWKPPAIYKSFCEIDVEYFPFDEQTCFMKFGSWTYDGYMVDLRHLKQTA--DSDN------IEVGIDLQDYYISVEWDIMRVPAVRNEKFYSCCEEPYLDIVFNLTLRRKTLFYTVNLIIPCVGISFLSVLVFYLPSDSGEKISLCISILLSLTVFFLLLAEIIPPTSLTVPLLGKYLLFTMMLVTLSVVVTIAVLNVNFRSPVTHRMAPWVQ 342          

HSP 2 Score: 122.865 bits (307), Expect = 3.701e-81
Identity = 57/93 (61.29%), Postives = 72/93 (77.42%), Query Frame = 3
Query:  213 AVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            A +LY  LL  +NYN+LIRPV  N D +T   GL+L+QLID+N+++Q +TTNVWV+QEW D  L+WNP+DY GV  LH+PS  IWLPDIVLYN
Sbjct:   25 AKRLYDDLL--SNYNRLIRPVGNNSDRLTVKMGLRLSQLIDVNLKNQIMTTNVWVEQEWNDYKLKWNPDDYGGVDTLHVPSEHIWLPDIVLYN 115          

HSP 3 Score: 69.707 bits (169), Expect = 3.103e-11
Identity = 28/70 (40.00%), Postives = 51/70 (72.86%), Query Frame = 1
Query: 1390 KINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLD 1599
            ++ +TI   +++  ++K+ D    V+E+W++VA+V+DR+FL +F  ACV+ T  IIL++P+LYD+  P+D
Sbjct:  476 EMEKTIEGSRFIAQHVKNKDKFESVEEDWKYVAMVLDRMFLWIFAIACVVGTALIILQAPSLYDQSQPID 545          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. TrEMBL
Match: A0A1S3JAF6 (acetylcholine receptor subunit alpha-like 1 OS=Lingula unguis OX=7574 GN=LOC106171192 PE=3 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 5.708e-100
Identity = 179/384 (46.61%), Postives = 262/384 (68.23%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFMYCNKTMFKEA--------SASKLIYET--FMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPL 1596
            +L+    G YEV LMTKA V   G V+W PPA+Y+S+C INVEFFP+D Q C M F SWTY+  ++ LKH  Q   PD  N      I + +DL+++  SVE+D+L + ARR  + +    E +P + FN+ +RRKTLFYTVNLI+PC+A+SFL+VL FYLP+ SGEKI+L I+ILLSLT+FFLLL + IP TS+V+PLIGKYLLFT+IL+S+SII+TV+VLNV+FRS  TH MSPW++ +FL+ LP +L +  P  + ++  +     CN    ++A         A+ + +E    + + +R+  L+       I + +  + ++ D+LK++D ++ V+E+WR+VA+V+DR+FL +F +AC++ T  IIL++P LYD R PL
Sbjct:  115 VLYNNADGNYEVTLMTKATVHPTGKVQWEPPAIYKSACPINVEFFPFDEQTCIMQFGSWTYDGFQVDLKHICQ---PDDYNDDYE--IGYGIDLKDYSRSVEWDLLSVPARRKAKYYTCCPEPYPFIIFNVTLRRKTLFYTVNLIIPCVAISFLTVLTFYLPSDSGEKITLCISILLSLTVFFLLLADLIPPTSIVVPLIGKYLLFTMILVSVSIIVTVVVLNVHFRSPSTHVMSPWVKKVFLQILPRLLMMRRPTPEGEKTPKVMVRACNGMEMRDAFGNSRQNCDANHMGHEEILLLGQEERNPGLRKRKYPVHIQKALEGVTFISDHLKNEDVEDMVKEDWRYVAMVLDRLFLWIFTTACLVGTLGIILQAPTLYDDRMPL 493          

HSP 2 Score: 121.324 bits (303), Expect = 5.708e-100
Identity = 54/101 (53.47%), Postives = 74/101 (73.27%), Query Frame = 3
Query:  189 QTSTGFKSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            +   G   A +LY  LL ++ YNKLIRPV  N D +T   GL+LTQLID++ ++Q +TTNVW+  EW D  LRWNP+DY GV +L++P+++IWLPD+VLYN
Sbjct:   18 KVCEGTADAKRLYDDLLYKSGYNKLIRPVGNNSDKLTVKLGLRLTQLIDVDEKNQIMTTNVWLMHEWDDYKLRWNPKDYGGVNILYVPADRIWLPDVVLYN 118          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. TrEMBL
Match: A0A1D2MEM2 (Acetylcholine receptor subunit beta-like 2 OS=Orchesella cincta OX=48709 GN=Ocin01_15383 PE=3 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 2.034e-98
Identity = 174/399 (43.61%), Postives = 258/399 (64.66%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIR-----YXXXXXXXXXXXXHSPISKEKEMSERCFMYCNKTMFKEASASKLI-----------YETFMRRSKRSYSLKDASIEEKINR--------TIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLD 1599
            +L+    G YEV LMTKA +  +G + W PPA+Y+SSC INVE+FP+D Q+C M F SWTY+  ++ L+H  Q        T+G+ +++  +DL+ FY SVE+DILE+ ARR+   +    E +P++TFN+ MRRKTLFYTVNLI+PC+ +SFL+VLVFYLP+ SGEK++L I+ILLSLT+FFLLL E IP TSL +PL+GKYLLFT++L++LSI++TV VLNV+FRS  TH MSPW++     ++           H   + E + S       N T +  A  +  +            E+ + +S+   S  D S +  +NR         +  ++++  ++KD+D  N+V E+W++VA+V+DR FL +F  AC++ T  I+ ++P+LYD RTP+D
Sbjct:  109 VLYNNADGNYEVTLMTKATLHSNGEIVWKPPAIYKSSCEINVEWFPFDEQSCAMKFGSWTYDGFQVDLQHMEQ--------TAGSNLVSIGIDLKEFYLSVEWDILEVPARRNEEYYPCCQEPYPDITFNLTMRRKTLFYTVNLIIPCVGISFLTVLVFYLPSDSGEKVTLCISILLSLTVFFLLLAEIIPPTSLAVPLLGKYLLFTMVLVTLSIMVTVGVLNVHFRSPSTHKMSPWVKKVFLEFMPRVLCMKRPEYHPRYAFESDFSTPANTATNGTDYGMAFGTGTLRRDSYYDSSPRTESSVDQSRHVKSFSDDSGDLGMNRQYSPEVLAALQSVQFIAQHIKDEDKDNEVIEDWKYVAMVLDRFFLWVFTLACILGTCGILFQAPSLYDTRTPID 499          

HSP 2 Score: 114.39 bits (285), Expect = 2.034e-98
Identity = 54/93 (58.06%), Postives = 71/93 (76.34%), Query Frame = 3
Query:  213 AVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            A +LY  LL  +NYN+LIRPV  N + +T   GLKL+QLID+N++ Q +TTNVWV+Q+W D  L+W PE+Y GV+ L++PS  IWLPDIVLYN
Sbjct:   22 AKRLYDDLL--SNYNRLIRPVSNNSEKLTVKLGLKLSQLIDVNLKSQIMTTNVWVEQKWTDYKLQWIPEEYGGVEQLYVPSEHIWLPDIVLYN 112          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. TrEMBL
Match: V4ABC4 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_212843 PE=3 SV=1)

HSP 1 Score: 276.944 bits (707), Expect = 3.187e-98
Identity = 183/391 (46.80%), Postives = 260/391 (66.50%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFMYCNKTMFKEASASKLIYET---FMRRSKRSYSLKDASIEEKIN-------------RTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLD 1599
            +L+    G YEV LMTKA +  +G V W PPA+Y+SSC I+VEFFP+D+Q C M F SWTY+ +++ L HY       S N    V I   +D+R+FY SVE+D+L + A+R++R +    E +P++TF I MRRKTLFYTVNLI+PC+A+SFL+VLVFYLP+ SGEK++L I+ILLSLT+FFLLL E IP TS+V+PLIGKYLLFT+IL++LSII+TV+VLNV+FRS  TH MSPW+R +FL  LP +L +  P  + ++  +     CN    ++ S     + T     RRS     L  +S +   N               I  + ++ ++LK++D    + E+W++VA+V+DRVFL +F +ACV+ T  IIL++P LYD + P++
Sbjct:  116 VLYNNADGNYEVTLMTKATLHPNGLVVWEPPAIYKSSCTIDVEFFPFDVQTCSMKFGSWTYDGNQVDLVHYC------SINEESGVEIRPGIDIRDFYPSVEWDLLAVWAKRNVRNYPCCIELYPDITFYISMRRKTLFYTVNLIIPCVAISFLTVLVFYLPSDSGEKVTLCISILLSLTVFFLLLAEIIPPTSIVVPLIGKYLLFTMILVTLSIIVTVVVLNVHFRSPSTHVMSPWVRRVFLTILPKLLVMRRPHLEPEKPQKVVIRTCNGMEIRDHSGVSGYHHTTSMGFRRSMHEQELLPSSEDAAANALFRNKYYTREVIEAIESVTFIAEHLKNEDNTAAIIEDWKYVAMVLDRVFLWVFTTACVVGTFGIILQAPTLYDGKQPIN 500          

HSP 2 Score: 113.235 bits (282), Expect = 3.187e-98
Identity = 51/93 (54.84%), Postives = 69/93 (74.19%), Query Frame = 3
Query:  213 AVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            A +LY  LL +  YNKLIRPV  N D +T   G++L+QLID++ +DQ +TTNVW++QEW D  L W+P +Y GV  L++PS +IWLPD+VLYN
Sbjct:   27 AKRLYDDLLRKRGYNKLIRPVGNNSDKLTVKLGIRLSQLIDVHEKDQIMTTNVWLRQEWYDKTLTWSPSEYGGVDKLYVPSREIWLPDVVLYN 119          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. TrEMBL
Match: A0A1S3J8X6 (acetylcholine receptor subunit alpha-like 1 OS=Lingula unguis OX=7574 GN=LOC106171191 PE=3 SV=1)

HSP 1 Score: 276.944 bits (707), Expect = 9.081e-98
Identity = 178/382 (46.60%), Postives = 264/382 (69.11%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFMYCNKTMFKEASASKL--IYETFMR-RSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLDGNHL 1611
            +L+    G YEV L+TKA V+  G V+W PPA+Y+S+C INVEFFP+D Q C M F SWTY+  ++ LKH  +        ++G     + +DL+++  SVE+D+L++ A+R  + +  + E  P +TFN+ +RRKTLFYTVNLI+PC+A+SFL+VL FYLP+ SGEKI+L I+ILLSLT+FFLLL + IP TSLV+PLIGKYLLFT+IL+SLSII+TV+VLNV+FRS  TH MSPW++ +FL+ LP +L +  P  + ++  +     CN    +E    +     E+ +R +  R+  LK+     ++ R +  + ++ D+LK +D ++ V+E+WR+VA+V+DR+FL +F +AC++ T  IIL++P LYD R PL  + L
Sbjct:  124 VLYNNADGNYEVTLLTKATVYPTGRVEWEPPAIYKSACPINVEFFPFDEQTCTMKFGSWTYDGLQVDLKHICELDGHREEFSTG-----YGIDLKDYSRSVEWDLLDVPAKRKAKYYNSKPEPHPFITFNVTLRRKTLFYTVNLIIPCVAISFLTVLTFYLPSDSGEKITLCISILLSLTVFFLLLADLIPPTSLVVPLIGKYLLFTMILVSLSIIVTVVVLNVHFRSPSTHVMSPWVKKVFLQILPRLLMMRRPTPEGEKTPKVMVRTCNGVEVREIFGDRRHSREESLLRGQDDRNSVLKNRKYSSEVRRALEGVAFISDHLKSEDLEDMVKEDWRYVAMVLDRLFLWIFTTACLVGTLGIILQAPTLYDDRMPLQTSKL 500          

HSP 2 Score: 111.694 bits (278), Expect = 9.081e-98
Identity = 48/101 (47.52%), Postives = 75/101 (74.26%), Query Frame = 3
Query:  189 QTSTGFKSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            +   G   A +LY+ LL++  YNKLIRPV  N + +T   GL+LTQLID++ ++Q +TTNVW+  EW+D++LRW+P+DY  + +L++P+ ++W PD+VLYN
Sbjct:   27 RVCEGTVDAKRLYRDLLEKRGYNKLIRPVSDNNNNLTVKLGLRLTQLIDVDEKNQIMTTNVWLTHEWEDLSLRWDPKDYGNIDVLYVPAEQLWKPDVVLYN 127          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. TrEMBL
Match: A0A1L4BJY5 (Nicotinic acetylcholine receptor alpha 8 OS=Cancer borealis OX=39395 PE=2 SV=1)

HSP 1 Score: 263.462 bits (672), Expect = 1.583e-96
Identity = 177/414 (42.75%), Postives = 251/414 (60.63%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIR----YXXXXXXXXXXXXHSPISKE-KEMSERCFM--------------------YCNKTMFKEASASKLIYETFMR--------------RSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLD 1599
            +L+    G YEV LMTKA + + G V W PPA+Y+SSC I+VE+FP+D Q+C M F SWTY+  ++ LKH  QK         G+ ++   +DLR FY SVE+DILE+ ARR+        E +P++TFN+ MRRKTLFYTVNLI+PC+ +SFL+VLVFYLP+ SGEK      ++LSLT+FFLLL E IP TSL +PL+GKYLLFT+IL++LSI +TV VLNV+FRS  TH MSPW++    ++  + L      + P S+  K  SE+ +M                      +     E + S    E F+                S+R+YS        +I + I  ++++  ++KD D  N+V ++W++VA+V+DR+FL +F  ACV  T  II ++P+LYD R P+D
Sbjct:  117 VLYNNADGNYEVTLMTKATLKYTGEVVWRPPAIYKSSCEIDVEWFPFDEQSCNMKFGSWTYDGFQVDLKHTKQK--------RGSNIVEMGIDLREFYASVEWDILEVPARRNQEYIPDLPEPYPDITFNLTMRRKTLFYTVNLIIPCVGISFLTVLVFYLPSDSGEK------VILSLTVFFLLLAEIIPPTSLAVPLLGKYLLFTMILVTLSICVTVGVLNVHFRSPSTHKMSPWVKRVFIHVMPRLLLMRRPQYDPRSRHLKSPSEQEYMDGMADGDLSDPFGGEPYVEYNGDGGSLPEDAPSYKFNEDFLSSHATGKCDLGGCHLHSQRTYS-------PEIQKAIEGVQFIAQHIKDADRDNEVIQDWKYVAMVLDRLFLWVFTIACVAGTCGIIFQAPSLYDTRVPID 509          

HSP 2 Score: 120.939 bits (302), Expect = 1.583e-96
Identity = 56/93 (60.22%), Postives = 73/93 (78.49%), Query Frame = 3
Query:  213 AVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            A +LY  LL  +NYN+LIRPV  N + +    GLKL+QLID+N+++Q +T+NVWV+QEW D  LRWNPEDY GV++L++PS  IWLPDIVLYN
Sbjct:   30 AKRLYDDLL--SNYNRLIRPVGNNSEKLIVKLGLKLSQLIDVNLKNQIMTSNVWVEQEWNDYKLRWNPEDYGGVEMLYVPSEHIWLPDIVLYN 120          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Cavefish
Match: chrna2b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:103031133])

HSP 1 Score: 199.134 bits (505), Expect = 7.806e-74
Identity = 143/362 (39.50%), Postives = 220/362 (60.77%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIIL 1560
            +L+    G++ V  MTKA +F+ G V+W PPA+Y+SSC I+V FFP+D QNC+M F SWTY+  K+ L+                  +   VDL++++ S E+ I+      + +++    E +P++T+  I+RR  LFYT+NLI+PCL +S L+VLVFYLP+  GEKI+L I++LLSLT+F LL+ E IPSTSLVIPLIG+YLLFT+I ++LSIIITV VLNV+ RS  TH M  W+  +FL  +P  LF+  P    +       +         +  S        R ++     + + +   I + +  + Y+ D+L+ +D    V+E+W++VA+V+DR+FL +F+  C++ T  + L
Sbjct:  140 VLYNNADGEFAVTHMTKAHLFYTGKVRWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLER-----------------LETMVDLKDYWESGEWAIINAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSPGTHEMPHWVHAVFLDLIPRWLFMRRPAPDSRRRQRLLLLQQGMACLPNSRHSGARINHTNRPTEED---QRSPLSPSIMQALEGVHYIADHLRAEDADFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTIGLFL 481          

HSP 2 Score: 98.9821 bits (245), Expect = 7.806e-74
Identity = 46/91 (50.55%), Postives = 61/91 (67.03%), Query Frame = 3
Query:  219 QLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            +L++KL     YNK  RPV    D V   FGL + QLID++ ++Q +TTNVW++QEW D  LRW P DY+ V  + +PS  IW+PDIVLYN
Sbjct:   55 ELFKKLFI--GYNKWSRPVPNTSDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYN 143          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Cavefish
Match: chrna6 (neuronal acetylcholine receptor subunit alpha-3 [Source:NCBI gene;Acc:103022127])

HSP 1 Score: 207.608 bits (527), Expect = 1.103e-72
Identity = 145/369 (39.30%), Postives = 237/369 (64.23%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPI------SKEKEMSERCFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILR 1563
            +L+    G + V+  TKA +  DGT+ W PPA+++SSC +++ +FP+D QNC M F SWTY+  K+ L                 V+I   V+L++F+ S E++I++    +H  ++    E +P++T++  +RR  LFYT+NLI+PCL +SFL+VLVFYLP+  GEK++L I++LLSLT+F L++ ETIPSTSLVIPLIG+YLLFT+I ++LSI+ITV VLNV++R+  TH+M  W+R +FL+ LP I+ +  PI      +K KE  E   + C K   ++ S   +        +  ++S+    +  +I + I  +KY+ +N++  +   +V+++W++VA+V+DR+FL +F+  CV+ T  +  +
Sbjct:  104 VLYNNAVGDFLVEDKTKALLKFDGTITWVPPAIFKSSCPMDITYFPFDYQNCSMKFGSWTYDKAKIDL-----------------VLIGSKVNLKDFWESGEWEIIDAPGYKHDIKYNCCEEIYPDITYSFYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPGWVRTVFLRALPRIMLMRRPIDQSESSTKAKEGPE---VDCGKVS-RQLSPQAI-------NTVVAFSV----VSPEIKQAIESVKYIAENMRSRNKAKEVEDDWKYVAMVIDRIFLWVFVLVCVLGTVGLFFQ 440          

HSP 2 Score: 86.6557 bits (213), Expect = 1.103e-72
Identity = 36/80 (45.00%), Postives = 56/80 (70.00%), Query Frame = 3
Query:  252 YNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            YN+ IRPVE   D VT  F + ++QL+ ++  +Q + TN+W++  W D  L+W P +++G++ + +PSNKIW PDIVLYN
Sbjct:   28 YNQFIRPVENVSDPVTVEFEVSISQLVKVDEVNQIMETNLWLRHIWNDYKLKWIPAEFDGIEYIRVPSNKIWRPDIVLYN 107          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Cavefish
Match: chrnb3a (cholinergic receptor, nicotinic, beta polypeptide 3a [Source:ZFIN;Acc:ZDB-GENE-040108-1])

HSP 1 Score: 194.512 bits (493), Expect = 1.269e-72
Identity = 145/375 (38.67%), Postives = 233/375 (62.13%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMT-HSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKDASIEEK-------INRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPAL 1575
            +L+    G++E  LMTKA V +DGT+ WTPPA Y+SSC ++V FFP+D QNC M F SWTY D  MV                   +++  VD ++F+ + E++IL+ + RR  R+    S  +P VT++ I++R  LFYT+ LI+PCL +SFL+VLVFYLP+  GEK+SLS ++L+SLT+F L++ E IPS+S VIPLIG+YLLF +I ++ SII+TV V+NV+ RS+ T H M+PW++ +FL+ LP +L +H               + ++  + +        +  M+R ++  +      EE+       + +  + ++Y+  ++K + +  +V ++W+FVA V+DR+FL  FL+  V+  G+I++ +PAL
Sbjct:  119 VLYENADGRFEGSLMTKAIVKYDGTITWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTY-DGTMV----------------DLALVDQHVDRKDFFDNGEWEILDATGRRGSRRDGIYS--YPFVTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTFSIIVTVFVINVHHRSSATYHPMAPWVKSLFLQRLPRLLCMHG--------------HTDRYRYPDMELHSPELKRGMKRGQQRSACGVGVKEEENQAWMSMLEKATSSVRYISRHIKKEHFIREVVQDWKFVAQVLDRIFLWAFLTVSVL--GTILIFTPAL 458          

HSP 2 Score: 99.7525 bits (247), Expect = 1.269e-72
Identity = 42/81 (51.85%), Postives = 57/81 (70.37%), Query Frame = 3
Query:  246 NNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLY 488
              Y K +RPV    D +   FGLK++QL+D++ ++Q +TTNVW+ QEW D  LRW+PEDY G+  + +PS  IWLPDIVLY
Sbjct:   41 RGYQKWVRPVFHANDTIAVRFGLKISQLVDVDEKNQLMTTNVWLWQEWTDYKLRWDPEDYGGITSIRVPSENIWLPDIVLY 121          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Cavefish
Match: chrnb3a (cholinergic receptor, nicotinic, beta polypeptide 3a [Source:ZFIN;Acc:ZDB-GENE-040108-1])

HSP 1 Score: 194.512 bits (493), Expect = 1.499e-72
Identity = 145/375 (38.67%), Postives = 233/375 (62.13%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMT-HSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKDASIEEK-------INRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPAL 1575
            +L+    G++E  LMTKA V +DGT+ WTPPA Y+SSC ++V FFP+D QNC M F SWTY D  MV                   +++  VD ++F+ + E++IL+ + RR  R+    S  +P VT++ I++R  LFYT+ LI+PCL +SFL+VLVFYLP+  GEK+SLS ++L+SLT+F L++ E IPS+S VIPLIG+YLLF +I ++ SII+TV V+NV+ RS+ T H M+PW++ +FL+ LP +L +H               + ++  + +        +  M+R ++  +      EE+       + +  + ++Y+  ++K + +  +V ++W+FVA V+DR+FL  FL+  V+  G+I++ +PAL
Sbjct:  105 VLYENADGRFEGSLMTKAIVKYDGTITWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTY-DGTMV----------------DLALVDQHVDRKDFFDNGEWEILDATGRRGSRRDGIYS--YPFVTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTFSIIVTVFVINVHHRSSATYHPMAPWVKSLFLQRLPRLLCMHG--------------HTDRYRYPDMELHSPELKRGMKRGQQRSACGVGVKEEENQAWMSMLEKATSSVRYISRHIKKEHFIREVVQDWKFVAQVLDRIFLWAFLTVSVL--GTILIFTPAL 444          

HSP 2 Score: 99.3673 bits (246), Expect = 1.499e-72
Identity = 42/81 (51.85%), Postives = 57/81 (70.37%), Query Frame = 3
Query:  246 NNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLY 488
              Y K +RPV    D +   FGLK++QL+D++ ++Q +TTNVW+ QEW D  LRW+PEDY G+  + +PS  IWLPDIVLY
Sbjct:   27 RGYQKWVRPVFHANDTIAVRFGLKISQLVDVDEKNQLMTTNVWLWQEWTDYKLRWDPEDYGGITSIRVPSENIWLPDIVLY 107          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Cavefish
Match: chrnb3b (neuronal acetylcholine receptor subunit non-alpha-2 [Source:NCBI gene;Acc:103031723])

HSP 1 Score: 191.815 bits (486), Expect = 1.027e-71
Identity = 141/368 (38.32%), Postives = 229/368 (62.23%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMT-HSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPAL 1575
            +L+    G++E  LMTKA + ++G V WTPPA Y+S+C ++V FFP+D QNC M F SWTY D  MV                  V++N+ VD R+F+ + E++IL  +  +  R  +  +  +P VT++ I++R  LFYT+ LI+PCL +SFL+VLVFYLP+  GEK+SLS ++L+SLT+F L++ E IPS+S VIPLIG+YLLF +I ++LSII+TV V+NV+ RS+ T H MSPW+R +FL+ LP +L +                + ++  + E        +  +R++      +  ++   + +    ++Y+  +++ + +  +V ++W+FVA V+DR+FL  FL+  V+  G+I++ +PAL
Sbjct:  121 VLYENADGRFEGSLMTKAIIKYNGAVTWTPPASYKSACTMDVTFFPFDRQNCSMKFGSWTY-DGTMV----------------DMVLMNYQVDRRDFFDNGEWEILSATGMKGNR--RDGTLSYPFVTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKVSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSATYHPMSPWVRSLFLQRLPHLLCMRG--------------HTDRYHYPELEPQSPELKPRIRKAPPGPEGEGQALVNMLEKATCSVRYISRHIRKEHFIREVVQDWKFVAQVLDRIFLWAFLTVSVL--GTILIFTPAL 453          

HSP 2 Score: 98.9821 bits (245), Expect = 1.027e-71
Identity = 41/80 (51.25%), Postives = 58/80 (72.50%), Query Frame = 3
Query:  249 NYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLY 488
             Y + +RP + + + V   FGLK++QL+D++ ++Q +TTNVW+ QEW D  LRWNPEDY G+  + +PS  IWLPDIVLY
Sbjct:   44 GYQRWVRPTQHSNNTVRVRFGLKISQLVDVDEKNQLMTTNVWLWQEWIDYKLRWNPEDYGGITFIRVPSESIWLPDIVLY 123          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Sea Lamprey
Match: chrnb3b (cholinergic receptor, nicotinic, beta 3b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-030102-4])

HSP 1 Score: 187.963 bits (476), Expect = 6.654e-73
Identity = 146/381 (38.32%), Postives = 224/381 (58.79%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKF-PEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMT-HSMSPWIRYXXXXXXXXXXXXHS-------PISKEKEMSERCFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRT 1590
            +L+    G++E  ++TKA V HDG +KWTPPA+Y+SSC I+V FFP+D QNC M F SWTY+   + L                 +++N  VD   ++ + E++ L  +  + +R    +  +F P +T++ ++RR  LFYT+ LI+PCL +SFL+V VFYLP+  GEKISL  ++L+SLT+F L++ E IPS+S VIPLIG+YLLF +I ++LSIIITV V+NV+ RS+ T H M+PW+R +FL  LP IL + S       P   +++   R    C+      +++ +LI                          I  ++Y+  ++K ++   +V E+W+FVA V+DR+ L  FLS  V   GSI++  P +Y  R+
Sbjct:  122 VLYDNADGRFEGSIVTKAVVKHDGRIKWTPPAIYKSSCTIDVTFFPFDQQNCSMKFGSWTYDGTLVDL-----------------IMVNSDVDRGEYFDNGEWEFLNATGNKGVRL---DGHRFYPYITYSFVIRRLPLFYTLFLIVPCLGLSFLTVFVFYLPSDEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIITVFVINVHHRSSSTHHPMAPWVRQLFLHKLPKILCMRSHVDRYTAPDEADRDHPGRAGCACHGGESPPSASERLILT-----------------------AIDSVRYITRHIKKENEVREVVEDWKFVAQVVDRILLWTFLSVSVF--GSILIFLPTIYAWRS 457          

HSP 2 Score: 104.76 bits (260), Expect = 6.654e-73
Identity = 46/96 (47.92%), Postives = 69/96 (71.88%), Query Frame = 3
Query:  210 SAVQLYQKLLDE--NNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            S  +L  +LL     +Y K +RPV++  D V   FGL + QL+D++ ++Q +TTNVW++QEW D+NLRWNP+DY G+  + +P++ IWLPDIVLY+
Sbjct:   30 SLAELEDRLLKRMLKDYQKWVRPVDKLSDTVEVKFGLGIAQLVDVDEKNQLMTTNVWLKQEWVDINLRWNPDDYGGINSIRVPASSIWLPDIVLYD 125          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Sea Lamprey
Match: chrna3 (cholinergic receptor, nicotinic, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070822-1])

HSP 1 Score: 202.601 bits (514), Expect = 6.623e-72
Identity = 147/411 (35.77%), Postives = 238/411 (57.91%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSP------------ISKEKEMSERCF-------------MYCNKTMFKEASASKLIYETFMRRSKRSYSLKDASI-----------------------EEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILR 1563
            +L+    G ++V+  TKA + +DGTV W PPA+++SSC I+V +FP+D QNC M F SWTY+  K+ L                 V++   ++L++F+ S E+ I+++   +H  ++    + +P++T+++ +RR  LFYT+NLI+PCL +SFL+VLVFYLP+  GEK++LSI++LLSLT+F L++ ETIPSTSLVIPLIG+YLLFT+I ++LSI+IT+ VLNV++R+   H+M  W+R +FL  LP I+ L  P            +  E +    C                C       AS+S   + + +R  +    L+ A +                         +I + I  +KY+ +NL+  D   +V ++W++VA+V+DR+FL +F+  C++ T  + L+
Sbjct:   95 VLYNNADGDFQVEGKTKALLKYDGTVMWMPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDL-----------------VLVGTKINLKDFWESGEWVIIDVPGYKHDIKYNCCEQIYPDITYSVYVRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLSISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITIFVLNVHYRTPEAHTMPNWVRRVFLDTLPKIMLLQPPKGSVGTAASPDAVVSEADQQPACLCAGELSAAAASSSSSCQSGGISRASSSMEAHVSSVRLPR----LRAADVMSDELSSSSSTESLDALLALCLLSPEIRQVIDSVKYIAENLRTQDEAKEVCDDWKYVAMVVDRIFLWVFVLVCILGTAGLFLQ 484          

HSP 2 Score: 86.6557 bits (213), Expect = 6.623e-72
Identity = 39/95 (41.05%), Postives = 61/95 (64.21%), Query Frame = 3
Query:  207 KSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            ++A +LY+ L    +YN  IRPV    D V   F + ++QL+ L+  +Q + TN+W++  W D   +WNP  +EG++ + +PS+KIW PDIVLYN
Sbjct:    6 EAASRLYKTLF--TSYNPYIRPVFNVSDPVIVRFEVSMSQLVKLDEVNQIMATNLWLKHTWNDYKFQWNPGQFEGMEYIRVPSDKIWKPDIVLYN 98          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Sea Lamprey
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 174.481 bits (441), Expect = 3.124e-59
Identity = 117/239 (48.95%), Postives = 164/239 (68.62%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIR 1191
            +L+    G + V  MTKA +FH G V+W PPA+Y+SSC I+V FFP+D QNC M F SWTY+  K+ L                 V +   VDL++++ S E+ I+      + +++    + +P++T++ I+RR  LFYT+NLI+PCL +S L+VLVFYLP+  GEKI+L I++LLSLT+F LL+ E IPSTSLVIPLIG+YLLFT+I ++LSI+ITV VLNV+ RS  TH+M  W+R
Sbjct:   61 VLYNNADGDFAVTHMTKAHLFHTGRVRWKPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDL-----------------VSMARDVDLKDYWESGEWAIVHAVGTYNTKKYDCCPQVYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPATHAMPRWVR 282          

HSP 2 Score: 72.4034 bits (176), Expect = 3.124e-59
Identity = 30/57 (52.63%), Postives = 42/57 (73.68%), Query Frame = 3
Query:  321 TQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            T L D + ++Q +TTNVW++QEW D  L+W+P +YE V  + +PS  IW+PDIVLYN
Sbjct:    8 THLCDCDEKNQMMTTNVWLKQEWDDYKLQWDPAEYENVTSIRVPSELIWVPDIVLYN 64          

HSP 3 Score: 48.9062 bits (115), Expect = 2.401e-6
Identity = 17/52 (32.69%), Postives = 37/52 (71.15%), Query Frame = 1
Query: 1405 IADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIIL 1560
            +  ++Y+ ++L+ +D    V+E+W++VA+V+DR+FL +F+  C++ T  + L
Sbjct:  507 VQGVQYIANHLRAEDAHLSVKEDWKYVAMVIDRIFLWVFIVVCLLGTVGLFL 558          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Sea Lamprey
Match: chrnb1l (cholinergic receptor, nicotinic, beta 1 (muscle) like [Source:ZFIN;Acc:ZDB-GENE-060811-1])

HSP 1 Score: 134.806 bits (338), Expect = 2.630e-44
Identity = 116/373 (31.10%), Postives = 209/373 (56.03%), Query Frame = 1
Query:  496 GKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINH-AVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFM------YCNKTMFKEASASK--LIYETFMRRSKRSYSLKDAS-------IEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRS 1566
            G ++  L     V + G V+W PP++YRSSC + V++FP+D QNC M F S+TY+  ++ L++   +   +         I H  +D   F  S E+ I    +R++          + ++TF +IM RK LFY +N+++PC+ ++  +V  FYLP  +GEK+ L I++LL+LT+F LLL + +P TSL +P+I  YL+FT+++++  +I+TVIVLN++FRS  TH M  W+R IF+  LP  L++  P  K++E++ +  +      +C+   F     S+  L+  T        +S + A        +  ++   +  + Y+ +++      ++++E+W++VA+V+DR+F + F     + T  I   +
Sbjct:  120 GNFDFGLYVHVLVDYTGAVRWVPPSIYRSSCGMQVKYFPFDWQNCSMVFQSFTYDTSEINLEYALDEHRQE---------IRHIIIDESTFPVSGEWQIKHKPSRKNT---NPRDPLYQDITFYLIMERKPLFYIINIVVPCILITICAVFTFYLPPDAGEKMGLCISVLLALTVFLLLLADKVPETSLGVPVIVNYLMFTMVIVTACVILTVIVLNLHFRSPATHIMPYWVRRIFIHSLPKYLWIERP--KKEELAPKLPVLTQHQQHCHDEYFIRTPPSQALLLLPTSPSFGMTPFSSELAGPDKLHVVLPPELQSAVDAVHYISEHMLSQKEFDELKEDWQYVAMVVDRIFFITFFLITSLGTFGIFFNA 478          

HSP 2 Score: 62.3882 bits (150), Expect = 2.630e-44
Identity = 29/97 (29.90%), Postives = 48/97 (49.48%), Query Frame = 3
Query:  201 GFKSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            G ++   L + L     Y  L+RP       VT   G+ L+QLI L      +T +  +   W+D  L W+P +Y+ ++ + +   ++WLPDI L N
Sbjct:   20 GLEAEENLLKDLFVVQQYKTLVRPARTATGRVTVRLGMTLSQLISLPACQPDMTLSRLISLSWEDPRLSWDPRNYDNLRSIRLSPKRVWLPDIALSN 116          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008550.1 (pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene:ENSPMAG00000007717.1 transcript:ENSPMAT00000008550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.02 bits (310), Expect = 6.033e-31
Identity = 73/203 (35.96%), Postives = 125/203 (61.58%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKY 1083
            +L+ +   +++    T   V + G  +  PP + +S+C+I+V +FP+D+Q C + F SWT++   + L+          ++TSG            +  + E+D++E+  +R+   +    E +P+VT+ + +RR+TL+Y +NL++PC+ +S LS+LVF LP  SGEKISL I +LLSLT+F LL+ E +P+TS  +PLIG+Y
Sbjct:   22 LLYNSADERFDATFHTNVLVNYTGNCQHLPPGMLKSTCYIDVRWFPFDVQKCDLKFGSWTHDGWLIDLQML-------EADTSG------------YIANGEWDLVEIPGKRNELYYDCCQEPYPDVTYTLTIRRRTLYYGLNLLVPCVLISALSLLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIGQY 205          

HSP 2 Score: 49.6766 bits (117), Expect = 1.196e-6
Identity = 21/65 (32.31%), Postives = 37/65 (56.92%), Query Frame = 1
Query: 1375 ASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSP 1569
            A +  +I + + +L+Y+    +  D    +  EW+F A V+DR+ LL F    +IST SI++ +P
Sbjct:  348 AGMSSEITKILIELRYIAGRFRTQDENEAIASEWKFAAAVVDRLCLLAFTLFTIISTISILMSAP 412          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Nematostella
Match: EDO32053 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW63])

HSP 1 Score: 124.79 bits (312), Expect = 1.799e-48
Identity = 67/196 (34.18%), Postives = 114/196 (58.16%), Query Frame = 1
Query:  496 GKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKY 1083
            G    K+ T   V HDG+  W  PA+ +S C I+V FFP+D+Q+C++TF SWT++  K+ +    + GI                D  NF  + E+ +   S RR ++ +    E +P VT+ II+RR+ +FY  N+++P   ++ LS+  FYLP  SGE++S  I +LL+++++ +++ E IP ++  IPL+ K+
Sbjct:   98 GSLNNKIDTNVIVNHDGSTTWLAPAIIKSECKIDVRFFPFDVQSCELTFGSWTHDGLKIDIHLKQESGI----------------DTENFSDNREWFLKGTSGRRDVKMYICCPEPYPTVTYTIILRRRAMFYVFNMVLPTGVIALLSLFSFYLPPNSGERVSFVITVLLAMSVYLIMVTENIPRST-DIPLVSKF 276          

HSP 2 Score: 87.0409 bits (214), Expect = 1.799e-48
Identity = 39/81 (48.15%), Postives = 57/81 (70.37%), Query Frame = 3
Query:  249 NYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            NY+K  RPV    D V    G+ L Q+IDLN RDQ LT NVW++Q W+D  L+WNP+D+ G++ ++I  +++W PD++LYN
Sbjct:   11 NYSKDARPVLNVNDPVQLKLGIMLRQVIDLNERDQILTINVWIRQYWKDHLLKWNPDDFGGIKSINIAPDRVWKPDVLLYN 91          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Nematostella
Match: EDO42054 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2J7])

HSP 1 Score: 127.487 bits (319), Expect = 4.224e-46
Identity = 103/363 (28.37%), Postives = 183/363 (50.41%), Query Frame = 1
Query:  487 TTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPAL 1575
            T  G  E K  T      DGT +W  PA + S+C+INV +FP+D QNC + F SWTY  +++     T     DS+            DL  +  + E+ +L + A+ +   +      F +VT  + ++RK L+Y  NLI+PC  ++ L+++ F+LP +SGEK+ L I +LL++T+F LL+ ET+PSTS  IPL+G+Y + T+ + ++S++ T ++LN   R+  T  M  W++      +       SP +      +       ++   E               +R  S   + +     R + D+  + ++++      +++EEWR  A+V+DR+F  + L   ++++  I  R P +
Sbjct:  133 TYAGGLE-KYKTSVIASSDGTQEWNSPASFTSTCNINVRYFPFDSQNCSLKFGSWTYVGNRL-----TMTSTSDSA------------DLSKYVNNGEWHLLAMPAKLNRVFYNCCKYPFYDVTLYLEIQRKPLYYVFNLIIPCALIATLTLIKFFLPPESGEKVGLGITVLLAMTVFLLLVAETLPSTSDHIPLLGQYFVATMFVTAISLVATCLILNFFHRNPSTSPMPHWVK-----VIILDYMARSPRNARLMRDDSVIPPSGRSTPCE---------------RRRMSTVSSQLNPFTERLLDDINVLAEDVRARQEDERLREEWRCAALVLDRMFFWIMLVTSLMTSFMIFYRDPVM 457          

HSP 2 Score: 76.2554 bits (186), Expect = 4.224e-46
Identity = 32/81 (39.51%), Postives = 52/81 (64.20%), Query Frame = 3
Query:  249 NYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            NY+  +RPV  + D V   F L L Q+I +N + Q +T +VW++Q+W +  L WN   Y G++ +++   K+W+PDI+LYN
Sbjct:   48 NYDSEVRPVFNDSDKVNVEFSLSLIQIIAVNSKSQLVTVSVWIRQKWTNPMLAWNTSKYGGIESVNLNPAKVWIPDIILYN 128          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Nematostella
Match: EDO46927 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNI2])

HSP 1 Score: 124.02 bits (310), Expect = 6.144e-44
Identity = 77/191 (40.31%), Postives = 113/191 (59.16%), Query Frame = 1
Query:  511 KLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKY 1083
            K  T+A + H+G  +W  P    S C I++ +FP+D Q C+M F SW+Y+  ++ L   T KG  DS+            DL  +  S E+D+L + A R++ ++    + F ++TF + +RRK LFY  NLI PC+ ++ L+V  F LP +SGE+I L I I L LT+F L+  E +P TS VIPLIGKY
Sbjct:  129 KFDTRATIMHNGYTEWFAPTEIHSICAIDITYFPFDEQFCKMKFGSWSYSGRQLNL---TSKG--DSA------------DLSKYTKSGEWDLLGMRAVRNVVKYSCCPDPFIDITFTMHIRRKVLFYLTNLIAPCIVLATLTVFSFQLPLESGERIGLVITIWLGLTVFMLVFTENVPRTSEVIPLIGKY 302          

HSP 2 Score: 72.4034 bits (176), Expect = 6.144e-44
Identity = 36/90 (40.00%), Postives = 55/90 (61.11%), Query Frame = 3
Query:  228 QKLLDE--NNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
             +LL++   +YNK  RPV    +A+   F +   QLI+LN +DQ L + VW +Q W +  L W+P+ Y G+  +++  N IW PDIVLY+
Sbjct:   28 HRLLNDLFKDYNKEARPVLNKSEAIEVQFDMAYAQLINLNSKDQILQSKVWFRQRWVNPFLTWDPKMYGGLTSINVNPNMIWKPDIVLYH 117          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Nematostella
Match: EDO33746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRB3])

HSP 1 Score: 117.857 bits (294), Expect = 4.034e-43
Identity = 70/188 (37.23%), Postives = 109/188 (57.98%), Query Frame = 1
Query:  520 TKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKY 1083
            TK  +  DGT  W  P++ RS C I++ FFP+D Q C + F SWTY+  ++           D +N S       +VDL ++  S EF+++     R I ++    E +P + F + +RRK LFY  NLI+PC  ++  ++L F LP  +GE+++L I  LL++T+F L++ E  P+TS V PLIGK+
Sbjct:  109 TKVILSSDGTNTWYAPSILRSRCSIDITFFPFDDQRCTLHFGSWTYDGLRV-----------DLTNMSA------SVDLSSYMPSGEFEMINAPVDRIIVRYSCCPEPYPNLVFTLHIRRKVLFYFNNLIVPCFLITAFALLTFVLPPNTGERVTLVITTLLAMTVFMLMIAENTPTTSDVTPLIGKF 279          

HSP 2 Score: 75.8702 bits (185), Expect = 4.034e-43
Identity = 35/90 (38.89%), Postives = 56/90 (62.22%), Query Frame = 3
Query:  249 NYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQE---------WQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            N ++ +RPV+  E A+  +FG+  TQL++L+ ++Q L +NVW++Q          W +  LRWN   Y G++ ++I    +WLPDIVLYN
Sbjct:   11 NSSQEVRPVKNKESAIKVFFGIAYTQLVELDAKNQVLVSNVWIRQASNCIGLKCLWNNHLLRWNESHYGGIKSINIDPKLVWLPDIVLYN 100          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Nematostella
Match: EDO42072 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2P1])

HSP 1 Score: 119.013 bits (297), Expect = 8.564e-43
Identity = 69/191 (36.13%), Postives = 114/191 (59.69%), Query Frame = 1
Query:  511 KLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKY 1083
            K  T+ K+  +G   W  P +  SSC I+V +FP+D Q+C + F SWTY+  ++ L   +  G                 D+  +  S ++D++  +A+R+   +    + +P+VTF + +RRKT+FY +NLIMPC  ++ L++L F+LP +SGE+I+L I  LL++T+F LL+ + +P TS V+PLI  Y
Sbjct:  103 KFGTQIKLLFNGINIWLAPVLLTSSCKIDVTYFPFDEQHCSLKFGSWTYDGERLDLVSESPSG-----------------DVSKYVPSGQWDLVSFTAKRNEIFYVCCPQSYPDVTFTLNIRRKTIFYYMNLIMPCFLITGLTLLSFFLPPESGERITLVITNLLAMTVFMLLVADWLPPTSEVVPLISMY 276          

HSP 2 Score: 73.9442 bits (180), Expect = 8.564e-43
Identity = 33/81 (40.74%), Postives = 53/81 (65.43%), Query Frame = 3
Query:  249 NYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            NYNK +RPV     A+T   GL L Q+  L  + Q L T++WV+Q W++  L W+P+++ G+  +++  +K+W+PDI LYN
Sbjct:   11 NYNKHLRPVVNKSRALTVRLGLTLHQIASLVEKSQFLQTSLWVRQMWRNEYLTWDPKEFGGISTINVNVDKVWVPDIYLYN 91          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Medaka
Match: ENSORLT00000017941.2 (neuronal acetylcholine receptor subunit alpha-3-like [Source:NCBI gene;Acc:101168601])

HSP 1 Score: 208.764 bits (530), Expect = 5.830e-75
Identity = 147/385 (38.18%), Postives = 238/385 (61.82%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISKEKEM---SERCFMY--CNKTMFKEASASKLIYETFMRR----SKRSYSLKDASIEEKINRTIA-------------DLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILR 1563
            +L+    G + V+  TKA +  DGT+ W PPA+++SSC +++ +FP+D QNC M F SWTY+  K+ L                 V+I   V+L++F+ S E++I++    +H  ++    E +P++T++  +RR  LFYT+NLI+PCL +SFL+VLVFYLP+  GEK++L I++LLSLT+F L++ ETIPSTSLVIPLIG+YLLFT+I ++LSI+ITV VLNV++R+ MTH+M  W+  +FLK LP I+ +  P  ++ ++   S  C  Y  C  +      A K        R    +  S  +K    ++ IN  +A              +KY+ +N++  +   +V+++W++VA+V+DR+FL +F++ C++ T  + L+
Sbjct:  116 VLYNNAVGDFLVEDKTKALLKFDGTITWVPPAIFKSSCPMDITYFPFDYQNCSMKFGSWTYDKAKIDL-----------------VLIGSKVNLKDFWESGEWEIIDAPGYKHDIKYNCCEEIYPDITYSFYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPMTHTMPGWVHLVFLKVLPRIMLMRRPTDEDGKVGGGSLNCLEYGDCKLSSMDGCGAKKCPCPCQHGRETPETAASVRMKHQLSQQSINTVVAFSVVSPEVKQAIESVKYIAENMRSRNKAKEVEDDWKYVAMVIDRIFLWVFVTVCLLGTMGLFLQ 483          

HSP 2 Score: 93.2041 bits (230), Expect = 5.830e-75
Identity = 41/95 (43.16%), Postives = 64/95 (67.37%), Query Frame = 3
Query:  207 KSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            K+  +L++KL     YN+ IRPVE   D VT  F + ++QL+ ++  +Q + TN+W++  W D  LRW P +++G++ + +PSNKIW PDIVLYN
Sbjct:   27 KAEDRLFRKLF--RRYNQFIRPVENVSDPVTVEFEVSISQLVKVDEVNQIMETNLWLRHIWNDYKLRWTPAEFDGIEFIRVPSNKIWRPDIVLYN 119          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Medaka
Match: chrnb3a (neuronal acetylcholine receptor subunit non-alpha-3 [Source:NCBI gene;Acc:101168098])

HSP 1 Score: 187.963 bits (476), Expect = 1.257e-71
Identity = 132/370 (35.68%), Postives = 221/370 (59.73%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMT-HSMSPWIR--YXXXXXXXXXXXXHSPISKEKEMSERCFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPAL 1575
            +L+    G++E  LMTKA V  DGT+ WTPPA Y+SSC ++V FFP+D QNC M F SWTY+                  N    V+++H VD ++F+ + E++IL  + +R  R  + E   +P +T++ I++R  LFYT+ LI+PCL +SFL+VLVFYLP+  GEK+SLS ++L+SLT+F L++ E IPS+S VIPLIG+YLLF +I ++ SII+TV V+NV+ RS+ T H M+PW++  ++        +  H+      ++  R      +   +  +  + +     + +         +    + +    + Y+  +++ + +  +V ++W+FVA V+DR+FL  FL+  ++  G++++ +PAL
Sbjct:  121 VLYENADGRFEGSLMTKAIVRWDGTITWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYD-----------------GNMVDLVLVDHYVDRKDFFDNGEWEILNATGQRGSR--RDEMYWYPFLTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTFSIIVTVFVINVHHRSSATYHPMAPWVKSLFLQKLPRLLCMRGHTDRYHFPDIEMR----SPELKTRRGAGRRAVPGGQQKGALGGMEDDSQAWLAMLEKATNSVHYISRHIRKEHFIREVVQDWKFVAQVLDRIFLWAFLTVSIL--GTVLIFTPAL 465          

HSP 2 Score: 102.834 bits (255), Expect = 1.257e-71
Identity = 43/81 (53.09%), Postives = 60/81 (74.07%), Query Frame = 3
Query:  246 NNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLY 488
              Y K +RPV+   D +T  FGLK++QL+D++ ++Q +TTNVW+ QEW DV L+WNP+DY G+  + +PS  IWLPDIVLY
Sbjct:   43 KGYQKWVRPVQHANDTITVRFGLKISQLVDVDEKNQLMTTNVWLWQEWIDVKLKWNPDDYGGITSIRVPSETIWLPDIVLY 123          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Medaka
Match: chrna4b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:101158195])

HSP 1 Score: 171.4 bits (433), Expect = 4.479e-68
Identity = 124/276 (44.93%), Postives = 184/276 (66.67%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERC--FMYCNKTM 1296
            +L+    G + V  +TKA +F+DG +KW PPA+Y+SSC I+V FFP+D Q+C+M F SWTY+  K+ L                 + +   VD  +++ S E+ I+    + + ++++  +E + ++T+  I+RR  LFYT+NLI+PCL +S L+VLVFYLP+Q GEKI+L I++LLSLT+F LL+ E IPSTSLVIPLIG+YLLFT++ ++LSIIIT+ VLNV+ RS  TH M  W+R +FL  +P +LF+  P    K+  +R    M+C  T+
Sbjct:  132 VLYNNADGDFAVTHLTKAHLFYDGQIKWMPPAIYKSSCSIDVTFFPFDQQSCKMKFGSWTYDRAKIDL-----------------ISMASDVDQMDYWESGEWVIVNAVGKYNTKKYECCAEIYADITYYFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSQCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMVFVTLSIIITIFVLNVHHRSPQTHGMPHWVRRVFLDLVPRVLFMKRPPGTAKQHCKRLIEMMHCPTTI 390          

HSP 2 Score: 107.457 bits (267), Expect = 4.479e-68
Identity = 48/80 (60.00%), Postives = 59/80 (73.75%), Query Frame = 3
Query:  252 YNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            YNKL RPV+   D V  +FGL + QLID++ ++Q +TTNVW++QEW D  LRWNPEDYE V  + IPS  IW PDIVLYN
Sbjct:   56 YNKLSRPVQNTSDTVLVHFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWNPEDYENVTSIRIPSEIIWRPDIVLYN 135          

HSP 3 Score: 53.1434 bits (126), Expect = 5.530e-7
Identity = 19/60 (31.67%), Postives = 39/60 (65.00%), Query Frame = 1
Query: 1381 IEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIIL 1560
            +   + R I  ++Y+ D+L+  D    V+E+W++VA+V+DR+FL +F+  C++ +  + L
Sbjct:  579 VSPAMQRAIEGVQYIADHLRAGDADFSVKEDWKYVAMVIDRIFLWMFVLVCILGSVGLFL 638          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Medaka
Match: chrna2b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:101155076])

HSP 1 Score: 176.022 bits (445), Expect = 9.186e-67
Identity = 118/238 (49.58%), Postives = 163/238 (68.49%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWI 1188
            +L+    G++ V  MTKA +FH G V+W PPA+Y+SSC I+V FFP+D QNC+M F SWTY+  K+ L+                  I + VDL N++ S E+ I+      + +++    E +P++T+  I+RR  LFYT+NLI+PCL +S L+VLVFYLP+  GEKI+L I++LLSLT+F LL+ E IPSTSLVIPLIG+YLLFT+I ++LSI+ITV VLNV+ RS  TH M  W+
Sbjct:  131 VLYNNADGEFAVTHMTKAHLFHTGKVRWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLER-----------------IENTVDLNNYWESGEWAIINAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPRWV 351          

HSP 2 Score: 98.5969 bits (244), Expect = 9.186e-67
Identity = 46/91 (50.55%), Postives = 60/91 (65.93%), Query Frame = 3
Query:  219 QLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            +L+Q L     YNK  RPV    D V   FGL + QLID++ ++Q +TTNVW++QEW D  LRW P DY+ V  + +PS  IW+PDIVLYN
Sbjct:   46 ELFQTLF--TGYNKWSRPVPNISDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYN 134          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Medaka
Match: chrna2b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:101155076])

HSP 1 Score: 176.022 bits (445), Expect = 9.186e-67
Identity = 118/238 (49.58%), Postives = 163/238 (68.49%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWI 1188
            +L+    G++ V  MTKA +FH G V+W PPA+Y+SSC I+V FFP+D QNC+M F SWTY+  K+ L+                  I + VDL N++ S E+ I+      + +++    E +P++T+  I+RR  LFYT+NLI+PCL +S L+VLVFYLP+  GEKI+L I++LLSLT+F LL+ E IPSTSLVIPLIG+YLLFT+I ++LSI+ITV VLNV+ RS  TH M  W+
Sbjct:  131 VLYNNADGEFAVTHMTKAHLFHTGKVRWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLER-----------------IENTVDLNNYWESGEWAIINAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPRWV 351          

HSP 2 Score: 98.5969 bits (244), Expect = 9.186e-67
Identity = 46/91 (50.55%), Postives = 60/91 (65.93%), Query Frame = 3
Query:  219 QLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            +L+Q L     YNK  RPV    D V   FGL + QLID++ ++Q +TTNVW++QEW D  LRW P DY+ V  + +PS  IW+PDIVLYN
Sbjct:   46 ELFQTLF--TGYNKWSRPVPNISDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYN 134          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Planmine SMEST
Match: SMESG000015383.1 (SMESG000015383.1)

HSP 1 Score: 698.353 bits (1801), Expect = 0.000e+0
Identity = 382/401 (95.26%), Postives = 384/401 (95.76%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLDGNHLPNQTLLTYSTPNGNYSLDVNLN 1677
            ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEK               + L+ETIPSTSLVIPLIGKYLLFTIILISLSIIITVIVLNVNFRSTMTHSMSPWIRYIFLKFLPPILFLHSPISKEKEMSERCFMYCNKTMFKEAS SKLIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLDGNHLPNQTLLTYSTPNGNYSLDVNLN
Sbjct:  101 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEK---------------ISLIETIPSTSLVIPLIGKYLLFTIILISLSIIITVIVLNVNFRSTMTHSMSPWIRYIFLKFLPPILFLHSPISKEKEMSERCFMYCNKTMFKEASVSKLIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLDGNHLPNQTLLTYSTPNGNYSLDVNLN 486          

HSP 2 Score: 191.43 bits (485), Expect = 0.000e+0
Identity = 100/101 (99.01%), Postives = 101/101 (100.00%), Query Frame = 3
Query:  132 MWPRFNKPLEXXXXXXXXXQTSTGFKSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGV 434
            MWPRFNKPLEIIIIIYILIQTSTGFKSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEG+
Sbjct:    1 MWPRFNKPLEIIIIIYILIQTSTGFKSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGI 101          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Planmine SMEST
Match: SMESG000015383.1 (SMESG000015383.1)

HSP 1 Score: 687.567 bits (1773), Expect = 0.000e+0
Identity = 377/401 (94.01%), Postives = 381/401 (95.01%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLDGNHLPNQTLLTYSTPNGNYSLDVNLN 1677
            +L+ T  GKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEK               + L+ETIPSTSLVIPLIGKYLLFTIILISLSIIITVIVLNVNFRSTMTHSMSPWIRYIFLKFLPPILFLHSPISKEKEMSERCFMYCNKTMFKEAS SKLIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLDGNHLPNQTLLTYSTPNGNYSLDVNLN
Sbjct:  117 VLYNTADGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEK---------------ISLIETIPSTSLVIPLIGKYLLFTIILISLSIIITVIVLNVNFRSTMTHSMSPWIRYIFLKFLPPILFLHSPISKEKEMSERCFMYCNKTMFKEASVSKLIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLDGNHLPNQTLLTYSTPNGNYSLDVNLN 502          

HSP 2 Score: 232.646 bits (592), Expect = 1.843e-69
Identity = 125/133 (93.98%), Postives = 125/133 (93.98%), Query Frame = 3
Query:  132 MWPRFNKPLEXXXXXXXXXQTSTGFKSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYNTW*I*S*ADDKSE 530
            MWPRFNKPLEIIIIIYILIQTSTGFKSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYNT      AD K E
Sbjct:    1 MWPRFNKPLEIIIIIYILIQTSTGFKSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYNT------ADGKYE 127          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Planmine SMEST
Match: SMESG000014741.1 (SMESG000014741.1)

HSP 1 Score: 263.462 bits (672), Expect = 8.301e-102
Identity = 164/239 (68.62%), Postives = 192/239 (80.33%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIR 1191
            +LF    GKYE+ + TKA VFHDGTVKW PPA+Y+SSC INVEFFPYDIQ C +TFASWTY   K+ LKH  QK + D  N +G V I+ AVDL NFY SVEFDILELSA R +  +   S   P+VTF I+MRRKTLFYTVNL+MPCLA+ FLSVL FYLP++SGEK+ LSI IL SLTLFFLLLVETIPSTSLVIPLIGKYLLFT+ILISLSII+TV +LNV+FRS+++H M  W++
Sbjct:  161 VLFNNIDGKYEISIKTKATVFHDGTVKWIPPAIYKSSCQINVEFFPYDIQECFLTFASWTYEGSKVNLKHMAQKNVIDIPNATGMVNIDFAVDLTNFYESVEFDILELSAERSLVTYLQPS---PKVTFKILMRRKTLFYTVNLMMPCLAICFLSVLAFYLPSESGEKVYLSITILFSLTLFFLLLVETIPSTSLVIPLIGKYLLFTMILISLSIILTVYILNVHFRSSLSHDMPDWVK 396          

HSP 2 Score: 127.487 bits (319), Expect = 8.301e-102
Identity = 56/97 (57.73%), Postives = 76/97 (78.35%), Query Frame = 3
Query:  201 GFKSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
             +K A++LY+ L+D +NY+  IRPV  N D +T Y GL+L+QL ++NMR + +TTNVW++Q+W DVNLRWNP  Y GV  L+IPS+KIWLPDIVL+N
Sbjct:   68 AYKDAIRLYKVLMDGSNYSNYIRPVNYNNDVLTVYLGLRLSQLSEVNMRKETVTTNVWLEQQWIDVNLRWNPNQYGGVTKLYIPSDKIWLPDIVLFN 164          

HSP 3 Score: 99.3673 bits (246), Expect = 1.131e-21
Identity = 45/97 (46.39%), Postives = 71/97 (73.20%), Query Frame = 1
Query: 1381 IEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLDGNHLPNQTLLTYSTPNGNYSLDVN 1671
            ++ KI+R I ++++V + L+ DD  N ++E+W+FVA+VMDR+FL  F SAC++ST  IIL+SPALYD R P+  N++PN T L Y   +G +++ +N
Sbjct:  503 LDWKIDRAIDEVQFVANQLRADDESNDIKEDWKFVAMVMDRLFLWTFSSACLMSTLGIILQSPALYDTRKPIHSNNVPNCTNLFYQLRSGVHNVKIN 599          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Planmine SMEST
Match: SMESG000014741.1 (SMESG000014741.1)

HSP 1 Score: 263.077 bits (671), Expect = 1.066e-101
Identity = 164/239 (68.62%), Postives = 192/239 (80.33%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIR 1191
            +LF    GKYE+ + TKA VFHDGTVKW PPA+Y+SSC INVEFFPYDIQ C +TFASWTY   K+ LKH  QK + D  N +G V I+ AVDL NFY SVEFDILELSA R +  +   S   P+VTF I+MRRKTLFYTVNL+MPCLA+ FLSVL FYLP++SGEK+ LSI IL SLTLFFLLLVETIPSTSLVIPLIGKYLLFT+ILISLSII+TV +LNV+FRS+++H M  W++
Sbjct:  113 VLFNNIDGKYEISIKTKATVFHDGTVKWIPPAIYKSSCQINVEFFPYDIQECFLTFASWTYEGSKVNLKHMAQKNVIDIPNATGMVNIDFAVDLTNFYESVEFDILELSAERSLVTYLQPS---PKVTFKILMRRKTLFYTVNLMMPCLAICFLSVLAFYLPSESGEKVYLSITILFSLTLFFLLLVETIPSTSLVIPLIGKYLLFTMILISLSIILTVYILNVHFRSSLSHDMPDWVK 348          

HSP 2 Score: 127.872 bits (320), Expect = 1.066e-101
Identity = 56/97 (57.73%), Postives = 76/97 (78.35%), Query Frame = 3
Query:  201 GFKSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
             +K A++LY+ L+D +NY+  IRPV  N D +T Y GL+L+QL ++NMR + +TTNVW++Q+W DVNLRWNP  Y GV  L+IPS+KIWLPDIVL+N
Sbjct:   20 AYKDAIRLYKVLMDGSNYSNYIRPVNYNNDVLTVYLGLRLSQLSEVNMRKETVTTNVWLEQQWIDVNLRWNPNQYGGVTKLYIPSDKIWLPDIVLFN 116          

HSP 3 Score: 99.3673 bits (246), Expect = 9.372e-22
Identity = 45/97 (46.39%), Postives = 71/97 (73.20%), Query Frame = 1
Query: 1381 IEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLDGNHLPNQTLLTYSTPNGNYSLDVN 1671
            ++ KI+R I ++++V + L+ DD  N ++E+W+FVA+VMDR+FL  F SAC++ST  IIL+SPALYD R P+  N++PN T L Y   +G +++ +N
Sbjct:  455 LDWKIDRAIDEVQFVANQLRADDESNDIKEDWKFVAMVMDRLFLWTFSSACLMSTLGIILQSPALYDTRKPIHSNNVPNCTNLFYQLRSGVHNVKIN 551          
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Planmine SMEST
Match: SMESG000020665.1 (SMESG000020665.1)

HSP 1 Score: 207.994 bits (528), Expect = 8.319e-74
Identity = 147/370 (39.73%), Postives = 238/370 (64.32%), Query Frame = 1
Query:  475 ILFFTTHGKYEVKLMTKAKVF--HDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKXXXXXXXXXXXXXXXXXXVETIPSTSLVIPLIGKYXXXXXXXXXXXXXXXXXXXXXXXRSTMTHSMSPWIRYXXXXXXXXXXXXHSPISKEKEMSERCFMYCNKT-----MFKEASASKLIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILR 1563
            +L+    G +++   +  KV   HDG+V W PP +++S C INVEFFP+D Q C +   +WT+N   + L+H  QK    +S  +    I++A+DL  +  +VE+D+LE+SA+R+I  +   +E + +++FN+ +RR+TLFY +NLI PCLA+SFL++LVFYLP  SGEK+SLSI+ILLSLT+FFLL+ +  P TS+V+PLI KYLLFT+IL++LS++ TV+VLN+++RS  TH M+PW+R +F   LP +LF+  P    ++         N+T      F E      I + +   S R  ++   ++  +I   +  ++ +V ++K ++  + ++++W++VAVV+DR+FL LF  A +I     + R
Sbjct:  109 VLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKVSLSISILLSLTVFFLLIFDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRD---------NETDDIPETFHEDETDSNIQDKW---STRRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGYLCR 466          

HSP 2 Score: 89.3521 bits (220), Expect = 8.319e-74
Identity = 42/97 (43.30%), Postives = 59/97 (60.82%), Query Frame = 3
Query:  201 GFKSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYN 491
            G K A +LY  L+    Y+  +RPV+     V  Y  L L Q++D++ ++Q +  N+WV QEW D N  W+P DY  V  L+IPS +IW PD+VLYN
Sbjct:   16 GTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYN 112          
The following BLAST results are available for this feature:
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRNB32.002e-7439.67cholinergic receptor nicotinic beta 3 subunit [Sou... [more]
CHRNA63.213e-7234.49cholinergic receptor nicotinic alpha 6 subunit [So... [more]
CHRNB42.276e-6934.75cholinergic receptor nicotinic beta 4 subunit [Sou... [more]
CHRNB24.346e-6933.85cholinergic receptor nicotinic beta 2 subunit [Sou... [more]
CHRNB24.347e-6933.85cholinergic receptor nicotinic beta 2 subunit [Sou... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-635.359e-8842.71Acetylcholine receptor subunit alpha-type unc-63 ... [more]
unc-386.392e-7037.41Acetylcholine receptor subunit alpha-type unc-38 ... [more]
acr-121.400e-6533.41AcetylCholine Receptor; Nicotinic acetylcholine re... [more]
acr-81.497e-6535.88AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
acr-81.497e-6535.88AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nAChRbeta28.221e-9544.07gene:FBgn0004118 transcript:FBtr0084681[more]
nAChRalpha46.287e-9342.93gene:FBgn0266347 transcript:FBtr0332872[more]
nAChRalpha43.991e-8254.81gene:FBgn0266347 transcript:FBtr0346707[more]
nAChRalpha24.408e-8246.00gene:FBgn0000039 transcript:FBtr0084639[more]
nAChRalpha24.408e-8246.00gene:FBgn0000039 transcript:FBtr0084640[more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrnb3b1.273e-6938.13cholinergic receptor, nicotinic, beta 3b (neuronal... [more]
chrna4b1.576e-6948.95cholinergic receptor, nicotinic, alpha 4b [Source:... [more]
chrnb3a4.204e-6937.04cholinergic receptor, nicotinic, beta polypeptide ... [more]
chrnb3a5.130e-6937.04cholinergic receptor, nicotinic, beta polypeptide ... [more]
chrna2b5.587e-6849.16cholinergic receptor, nicotinic, alpha 2b (neurona... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp164.903e-7134.75ubiquitin specific peptidase 16 [Source:Xenbase;Ac... [more]
usp161.430e-7034.75ubiquitin specific peptidase 16 [Source:Xenbase;Ac... [more]
usp161.688e-7034.75ubiquitin specific peptidase 16 [Source:Xenbase;Ac... [more]
usp163.389e-7034.90ubiquitin specific peptidase 16 [Source:Xenbase;Ac... [more]
chrnb22.351e-6835.23cholinergic receptor nicotinic beta 2 subunit [Sou... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chrna65.918e-7636.62cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna25.059e-7436.84cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna25.059e-7436.84cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrnb36.178e-7440.54cholinergic receptor, nicotinic, beta polypeptide ... [more]
Chrnb21.190e-6934.63cholinergic receptor, nicotinic, beta polypeptide ... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P25162|ACH4_DROME6.300e-9444.07Acetylcholine receptor subunit beta-like 2 OS=Dros... [more]
sp|P91766|ACH1_MANSE9.841e-9243.40Acetylcholine receptor subunit alpha-like OS=Mandu... [more]
sp|Q9N587|ACH6_CAEEL5.594e-8742.71Acetylcholine receptor subunit alpha-type unc-63 O... [more]
sp|P17644|ACH2_DROME3.378e-8146.00Acetylcholine receptor subunit alpha-like 2 OS=Dro... [more]
sp|P09478|ACH1_DROME3.701e-8153.97Acetylcholine receptor subunit alpha-like 1 OS=Dro... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JAF65.708e-10046.61acetylcholine receptor subunit alpha-like 1 OS=Lin... [more]
A0A1D2MEM22.034e-9843.61Acetylcholine receptor subunit beta-like 2 OS=Orch... [more]
V4ABC43.187e-9846.80Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1S3J8X69.081e-9846.60acetylcholine receptor subunit alpha-like 1 OS=Lin... [more]
A0A1L4BJY51.583e-9642.75Nicotinic acetylcholine receptor alpha 8 OS=Cancer... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna2b7.806e-7439.50neuronal acetylcholine receptor subunit alpha-2 [S... [more]
chrna61.103e-7239.30neuronal acetylcholine receptor subunit alpha-3 [S... [more]
chrnb3a1.269e-7238.67cholinergic receptor, nicotinic, beta polypeptide ... [more]
chrnb3a1.499e-7238.67cholinergic receptor, nicotinic, beta polypeptide ... [more]
chrnb3b1.027e-7138.32neuronal acetylcholine receptor subunit non-alpha-... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrnb3b6.654e-7338.32cholinergic receptor, nicotinic, beta 3b (neuronal... [more]
chrna36.623e-7235.77cholinergic receptor, nicotinic, alpha 3 [Source:Z... [more]
chrna2a3.124e-5948.95cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
chrnb1l2.630e-4431.10cholinergic receptor, nicotinic, beta 1 (muscle) l... [more]
ENSPMAT00000008550.16.033e-3135.96pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO320531.799e-4834.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420544.224e-4628.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469276.144e-4440.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337464.034e-4337.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420728.564e-4336.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000017941.25.830e-7538.18neuronal acetylcholine receptor subunit alpha-3-li... [more]
chrnb3a1.257e-7135.68neuronal acetylcholine receptor subunit non-alpha-... [more]
chrna4b4.479e-6844.93neuronal acetylcholine receptor subunit alpha-2 [S... [more]
chrna2b9.186e-6749.58neuronal acetylcholine receptor subunit alpha-2 [S... [more]
chrna2b9.186e-6749.58neuronal acetylcholine receptor subunit alpha-2 [S... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015383.10.000e+095.26SMESG000015383.1[more]
SMESG000015383.11.843e-6994.01SMESG000015383.1[more]
SMESG000014741.18.301e-10268.62SMESG000014741.1[more]
SMESG000014741.11.066e-10168.62SMESG000014741.1[more]
SMESG000020665.18.319e-7439.73SMESG000020665.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019527 ID=SMED30019527|Name=Acetylcholine receptor subunit alpha-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1697bp
TTTTTCACATTTTTATTTTAAACACCAATAAGAAACGAGTGGAAAATTTT
TAAATAAATATGTGCAATCAGTTGTTGGGAATTACAATTGATTTGGGGTT
TTAAAATAAAATAATAATGTATTGATGAAACATGTGGCCTCGATTCAATA
AACCATTGGAAATTATTATTATAATTTATATATTAATTCAAACTTCAACT
GGATTCAAAAGTGCTGTTCAACTCTACCAAAAGCTACTTGATGAAAATAA
TTATAACAAATTAATAAGACCGGTAGAAAGAAACGAGGACGCAGTGACAA
CGTATTTTGGTCTCAAATTGACGCAGTTGATTGATTTAAATATGAGAGAT
CAGAAATTAACAACTAATGTTTGGGTGCAACAAGAATGGCAAGACGTCAA
TCTGAGATGGAATCCGGAAGATTACGAAGGAGTGCAGTTGCTTCACATTC
CTTCCAATAAAATATGGCTTCCAGATATTGTTCTTTACAACACATGGTAA
ATATGAAGTTAAGCTGATGACAAAAGCGAAAGTGTTTCACGATGGTACCG
TGAAATGGACTCCTCCAGCTGTTTATAGAAGTTCATGTCATATAAATGTC
GAATTTTTTCCTTATGATATACAGAATTGCCAAATGACCTTCGCTTCATG
GACTTATAATGATCATAAAATGGTTCTGAAGCATTACACTCAAAAAGGTA
TACCGGATTCAAGTAATACTTCAGGAACGGTTGTTATCAACCACGCGGTA
GACCTGCGAAACTTTTATACATCAGTTGAATTTGATATCCTCGAATTGTC
TGCTCGAAGACACATAAGGCAATTTCAAGGAGAGTCTGAAAAATTTCCGG
AAGTTACTTTCAATATTATTATGCGTCGCAAAACTCTGTTTTATACCGTC
AATCTGATAATGCCTTGTTTAGCAGTGTCTTTCTTATCTGTTTTAGTTTT
CTATCTTCCCACTCAAAGCGGTGAAAAAATATCTTTGAGTATTAATATTC
TTCTTTCTCTAACCTTATTTTTTTTATTACTAGTTGAAACGATTCCTTCA
ACAAGCTTAGTGATTCCACTGATAGGAAAATATCTTTTATTTACAATTAT
TCTGATATCTTTATCTATAATTATAACTGTAATTGTTTTGAACGTTAATT
TTCGATCTACAATGACACATTCGATGTCCCCGTGGATTCGATACATATTC
CTCAAATTTTTACCGCCAATTTTGTTTCTTCACAGTCCAATTAGTAAGGA
AAAAGAAATGTCTGAAAGATGCTTTATGTACTGCAATAAAACCATGTTCA
AGGAAGCATCAGCTTCAAAATTAATTTATGAAACCTTTATGAGAAGATCC
AAACGAAGTTACAGTTTAAAAGATGCTTCAATAGAGGAAAAAATTAACAG
AACTATTGCGGACTTGAAATACGTTGTGGATAATTTAAAAGACGATGATT
ACAAAAATAAAGTTCAAGAAGAATGGAGGTTCGTAGCAGTTGTGATGGAC
CGAGTGTTTCTTTTATTATTTTTAAGTGCTTGTGTGATAAGCACTGGATC
TATAATACTTCGATCCCCAGCACTCTACGATCGAAGAACTCCACTTGATG
GTAATCATCTTCCGAATCAAACCCTTTTAACATACTCAACACCGAATGGG
AATTATTCTCTTGATGTTAATCTGAATTAAATTTAAATTGTACTTTG
back to top

protein sequence of SMED30019527-orf-1

>SMED30019527-orf-1 ID=SMED30019527-orf-1|Name=SMED30019527-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=123bp
MWPRFNKPLEIIIIIYILIQTSTGFKSAVQLYQKLLDENNYNKLIRPVER
NEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEG
VQLLHIPSNKIWLPDIVLYNTW*
back to top

protein sequence of SMED30019527-orf-2

>SMED30019527-orf-2 ID=SMED30019527-orf-2|Name=SMED30019527-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=388bp
MTKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDH
KMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHI
RQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQ
SGEKISLSINILLSLTLFFLLLVETIPSTSLVIPLIGKYLLFTIILISLS
IIITVIVLNVNFRSTMTHSMSPWIRYIFLKFLPPILFLHSPISKEKEMSE
RCFMYCNKTMFKEASASKLIYETFMRRSKRSYSLKDASIEEKINRTIADL
KYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRS
PALYDRRTPLDGNHLPNQTLLTYSTPNGNYSLDVNLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005230extracellular ligand-gated ion channel activity
GO:0005216ion channel activity
GO:0004889acetylcholine-activated cation-selective channel activity
GO:0022848acetylcholine-gated cation-selective channel activity
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR036719Neuro-gated_channel_TM_sf
IPR006201Neur_channel
IPR027361Acetylcholine_rcpt_TM
IPR006029Neurotrans-gated_channel_TM
IPR006202Neur_chan_lig-bd
IPR018000Neurotransmitter_ion_chnl_CS
IPR002394Nicotinic_acetylcholine_rcpt
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0034220ion transmembrane transport
GO:0060078regulation of postsynaptic membrane potential
GO:0060079excitatory postsynaptic potential
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
GO:0045211postsynaptic membrane
GO:0005886plasma membrane
GO:0030054cell junction
GO:0045202synapse
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006201Neurotransmitter-gated ion-channelPRINTSPR00252NRIONCHANNELcoord: 117..129
score: 37.03
coord: 24..38
score: 47.99
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 1..260
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 287..363
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 127..243
e-value: 1.9E-40
score: 139.7
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 273..361
e-value: 1.0E-10
score: 43.6
NoneNo IPR availablePANTHERPTHR18945:SF592ACETYLCHOLINE RECEPTOR SUBUNIT ALPHA-LIKE 1coord: 287..363
NoneNo IPR availablePANTHERPTHR18945:SF592ACETYLCHOLINE RECEPTOR SUBUNIT ALPHA-LIKE 1coord: 1..260
NoneNo IPR availableCDDcd19064LGIC_TM_nAChRcoord: 124..213
e-value: 1.7234E-30
score: 111.066
NoneNo IPR availableCDDcd19031LGIC_ECD_nAChR_proto_alpha-likecoord: 1..125
e-value: 3.92009E-55
score: 179.015
NoneNo IPR availableTMHMMTMhelixcoord: 190..212
NoneNo IPR availableTMHMMTMhelixcoord: 331..353
NoneNo IPR availableTMHMMTMhelixcoord: 222..241
NoneNo IPR availableTMHMMTMhelixcoord: 124..146
NoneNo IPR availableTMHMMTMhelixcoord: 161..183
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 2..123
e-value: 5.5E-28
score: 97.9
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 1..126
e-value: 3.2E-33
score: 116.9
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 2..122
IPR006029Neurotransmitter-gated ion-channel transmembrane domainPFAMPF02932Neur_chan_membcoord: 130..343
e-value: 3.5E-55
score: 187.7
IPR018000Neurotransmitter-gated ion-channel, conserved sitePROSITEPS00236NEUROTR_ION_CHANNELcoord: 24..38
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 123..355