Golgi brefeldin A resistant guanine nucleotide exchange factor 1

Overview
NameGolgi brefeldin A resistant guanine nucleotide exchange factor 1
Smed IDSMED30019511
Length (bp)5320
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 (SMED30019511) t-SNE clustered cells

Violin plots show distribution of expression levels for Golgi brefeldin A resistant guanine nucleotide exchange factor 1 (SMED30019511) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 (SMED30019511) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Golgi brefeldin A resistant guanine nucleotide exchange factor 1 (SMED30019511) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019511

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30019511h1SMcG0003694 dd_Smed_v4_8011_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Human
Match: GBF1 (golgi brefeldin A resistant guanine nucleotide exchange factor 1 [Source:HGNC Symbol;Acc:HGNC:4181])

HSP 1 Score: 655.981 bits (1691), Expect = 0.000e+0
Identity = 414/1137 (36.41%), Postives = 613/1137 (53.91%), Query Frame = 1
Query: 1891 NPEKKIKLTNPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQT---NQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE----AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQR-NQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELY-----------KTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSLNKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDEL----HYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEWN------NTISNDSELNVR-LWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAG---QLLKLTCDRLYTFLPDLVEELFYE 5202
            +P + I++ N    KK+++  GTE+FN   K GI++L+E+G       N E+A   RENPRL+K  IGE++  R N+ + E ++  F+F+GLRLD A+R++L+ FRLPGEA  IQ +LE F + +   N    ++ D+ F L YA++MLN DQHN N +KQ APMT+E+F++NL   N  K +   E+++L  +Y AIK EEIVMP EQ G++++NY+W  LL R  T    ++     ++  +LF + W   + A  YVF+  ++  I      G  +CA I+A+Y L ++ D +II + K+T  SS  E+IE     FG N K  +AAK++F +A +HGDILR+GWKN+++ +L LF+A+LLPK + EV+DF+  +  I L  E+    + E+  +    + +L+  + SS +  + E++  K  AL  I +C    +I E++FL+  SL E + AL+                          +++ D  ++    DE+   FCLE+++R++L N DR+      + DH Y + + +    FL+ER VV  LRLAI+LLR++E   QV   L IL L K SVL  V+  V  GLH+L+  +AANI S  DW  L T++E  G G K     +A           T+   +  +     S+L  Y                     +D S +     RGYTSDSE+Y             T  ++ ++ W++V   +D V  +K                      ++NQY++ +        D  ++ K  E LS++VRD AHITP NFE CV TLR+F E  +      +         DS  +   + +  G+  +       H        D EDE     ++ +S Q     ++++LLDLMHTLH RAA IY  W        T     E + R LW +CWCPLLQG+A LCCD R +VR  A+T+LQR+LL   L  L   +WE CF KVLFPLL+  LENI S +D +    +T     RMRA  +L+KVFLQHL  L  LSTF ALWLTIL++MD YM A ++ D L +A+ ESLKN+LLVM T      I   +++  G    L ++T +R+  FLP L +ELF +
Sbjct:  689 DPRELIEIKN----KKKLLITGTEQFNQKPKKGIQFLQEKGLLTIPMDNTEVAQWLRENPRLDKKMIGEFVSDRKNIDLLESFVSTFSFQGLRLDEALRLYLEAFRLPGEAPVIQRLLEAFTERWMNCNGSPFANSDACFSLAYAVIMLNTDQHNHNVRKQNAPMTLEEFRKNLKGVNGGKDF---EQDILEDMYHAIKNEEIVMPEEQTGLVRENYVWNVLLHRGATPEGIFLRVPTASYDLDLFTMTWGPTIAALSYVFDKSLEETIIQKAISGFRKCAMISAHYGLSDVFDNLIISLCKFTALSS--ESIENLPSVFGSNPKAHIAAKTVFHLAHRHGDILREGWKNIMEAMLQLFRAQLLPKAMIEVEDFVDPNGKISLQREETPSNRGESTVLSFVSWLTLSGPEQSSVRGPSTENQEAKRVALECIKQCDPEKMITESKFLQLESLQELMKALV--------------------------SVTPDEETY----DEEDAAFCLEMLLRIVLENRDRVGCVWQTVRDHLYHLCVQAQDFCFLVERAVVGLLRLAIRLLRREEISAQVLLSLRILLLMKPSVLSRVSHQVAYGLHELLKTNAANIHSGDDWATLFTLLECIGSGVKPPAALQA-----------TARADAPDAGAQSDSELPSY-------------------HQNDVSLD-----RGYTSDSEVYTDHGRPGKIHRSATDADVVNSGWLVV--GKDDVDNSKPGPSRPGPSP------------LINQYSLTVGL-DLGPHDTKSLLKCVESLSFIVRDAAHITPDNFELCVKTLRIFVEASLNGGCKSQEKRGKSHKYDSKGNRFKKKSKEGSMLRRPRTSSQHASRGGQSDDDEDEGVPASYHTVSLQ-----VSQDLLDLMHTLHTRAASIYSSWAEEQRHLETGGQKIEADSRTLWAHCWCPLLQGIACLCCDARRQVRMQALTYLQRALLVHDLQKLDALEWESCFNKVLFPLLTKLLENI-SPAD-VGGMEET-----RMRASTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHAGSS-DLLSEAIPESLKNMLLVMDTA----EIFHSADARGGGPSALWEITWERIDCFLPHLRDELFKQ 1719          

HSP 2 Score: 349.747 bits (896), Expect = 5.832e-97
Identity = 228/604 (37.75%), Postives = 338/604 (55.96%), Query Frame = 1
Query:   85 YVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTRIRKNNLTINMDXXXXXXXXXXXXXIPIPSESHSDTSHPPEDSCSDEIIVTPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNEDISVNNEIEPLADDTDSQVLF--------DLTRIESNCTINFEPSGNPELSSLNI-KSDNIQYRT----------ENGIVFKSDLSGAADNSDN---ENATCKGSKSEKLPLKSKTQSTT-TPYGLACVQKLLSNLILILSPENIFHTN-HVRTGLTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMIN 1824
            Y++Q EI +++ AIKR  + S      EE  DPL  +   LK  L+ I +LSE++P  FL PFL+VI S +  G ITGLALT+V KFLS+  ID +    ++G+    E +A+ VT+ +F+GTD +SDEV+LMKIL++L TL+  P G  +++ +VC+I+ SCFRICFE +LSELLR +AE TL  +V LLFTRLP+ KE+    KN +  NM    + +            +    +  PP         VTP +       + + SN       +D P T   S    + +  + P    TDS + F        DLT +E   +  +  +  P  S L + +  ++Q  T          E+      + +  AD+SD+    +      +  +    S+ + T   PYGL C+++L   LI + +P +  ++   +  GL L+T A ES    +++    LL  I++E+ ++   LL  +RL+ +AAS RVCFL+FESMR HLKFQ+EMY+ +L+ II  +N  +PYE +E+ALE+IVQLWRIPSF+TELY+NYDCD YCS+L  EL  L  K A P      L  T +++LDALL +I+
Sbjct:    7 YIIQGEINIVVGAIKRNARWSTHTPLDEE-RDPLLHSFGHLKEVLNSITELSEIEPNVFLRPFLEVIRSEDTTGPITGLALTSVNKFLSYALIDPTHEGTAEGM----ENMADAVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFTRLPQFKEEP---KNYVGTNMKKLKMRAGGMSDSS---KWKKQKRSPRPPRHMTK----VTPGSELPTPNGTTLSSNLTGGMPFIDVP-TPISSASSEAASAVVSP---STDSGLEFSSQTTSKEDLTDLEQPGSPGYSTATEPGSSELGVPEQPDLQEGTHVEKSQSASVESIPEVLEECTSPADHSDSASVHDMDYVNPRGVRFTQSSQKEGTALVPYGLPCIRELFRFLISLTNPHDRHNSEVMIHMGLHLLTVALESAP--VAQC-QTLLGLIKDEMCRHLFQLLSIERLNLYAASLRVCFLLFESMREHLKFQMEMYIKKLMEIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYCSNLFEELTKLLSKNAFPVSGQ--LYTTHLLSLDALLTVID 586          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Human
Match: GBF1 (golgi brefeldin A resistant guanine nucleotide exchange factor 1 [Source:HGNC Symbol;Acc:HGNC:4181])

HSP 1 Score: 655.21 bits (1689), Expect = 0.000e+0
Identity = 414/1137 (36.41%), Postives = 613/1137 (53.91%), Query Frame = 1
Query: 1891 NPEKKIKLTNPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQT---NQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE----AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQR-NQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELY-----------KTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSLNKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDEL----HYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEWN------NTISNDSELNVR-LWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAG---QLLKLTCDRLYTFLPDLVEELFYE 5202
            +P + I++ N    KK+++  GTE+FN   K GI++L+E+G       N E+A   RENPRL+K  IGE++  R N+ + E ++  F+F+GLRLD A+R++L+ FRLPGEA  IQ +LE F + +   N    ++ D+ F L YA++MLN DQHN N +KQ APMT+E+F++NL   N  K +   E+++L  +Y AIK EEIVMP EQ G++++NY+W  LL R  T    ++     ++  +LF + W   + A  YVF+  ++  I      G  +CA I+A+Y L ++ D +II + K+T  SS  E+IE     FG N K  +AAK++F +A +HGDILR+GWKN+++ +L LF+A+LLPK + EV+DF+  +  I L  E+    + E+  +    + +L+  + SS +  + E++  K  AL  I +C    +I E++FL+  SL E + AL+                          +++ D  ++    DE+   FCLE+++R++L N DR+      + DH Y + + +    FL+ER VV  LRLAI+LLR++E   QV   L IL L K SVL  V+  V  GLH+L+  +AANI S  DW  L T++E  G G K     +A           T+   +  +     S+L  Y                     +D S +     RGYTSDSE+Y             T  ++ ++ W++V   +D V  +K                      ++NQY++ +        D  ++ K  E LS++VRD AHITP NFE CV TLR+F E  +      +         DS  +   + +  G+  +       H        D EDE     ++ +S Q     ++++LLDLMHTLH RAA IY  W        T     E + R LW +CWCPLLQG+A LCCD R +VR  A+T+LQR+LL   L  L   +WE CF KVLFPLL+  LENI S +D +    +T     RMRA  +L+KVFLQHL  L  LSTF ALWLTIL++MD YM A ++ D L +A+ ESLKN+LLVM T      I   +++  G    L ++T +R+  FLP L +ELF +
Sbjct:  722 DPRELIEIKN----KKKLLITGTEQFNQKPKKGIQFLQEKGLLTIPMDNTEVAQWLRENPRLDKKMIGEFVSDRKNIDLLESFVSTFSFQGLRLDEALRLYLEAFRLPGEAPVIQRLLEAFTERWMNCNGSPFANSDACFSLAYAVIMLNTDQHNHNVRKQNAPMTLEEFRKNLKGVNGGKDF---EQDILEDMYHAIKNEEIVMPEEQTGLVRENYVWNVLLHRGATPEGIFLRVPTASYDLDLFTMTWGPTIAALSYVFDKSLEETIIQKAISGFRKCAMISAHYGLSDVFDNLIISLCKFTALSS--ESIENLPSVFGSNPKAHIAAKTVFHLAHRHGDILREGWKNIMEAMLQLFRAQLLPKAMIEVEDFVDPNGKISLQREETPSNRGESTVLSFVSWLTLSGPEQSSVRGPSTENQEAKRVALECIKQCDPEKMITESKFLQLESLQELMKALV--------------------------SVTPDEETY----DEEDAAFCLEMLLRIVLENRDRVGCVWQTVRDHLYHLCVQAQDFCFLVERAVVGLLRLAIRLLRREEISAQVLLSLRILLLMKPSVLSRVSHQVAYGLHELLKTNAANIHSGDDWATLFTLLECIGSGVKPPAALQA-----------TARADAPDAGAQSDSELPSY-------------------HQNDVSLD-----RGYTSDSEVYTDHGRPGKIHRSATDADVVNSGWLVV--GKDDVDNSKPGPSRPGPSP------------LINQYSLTVGL-DLGPHDTKSLLKCVESLSFIVRDAAHITPDNFELCVKTLRIFVEASLNGGCKSQEKRGKSHKYDSKGNRFKKKSKEGSMLRRPRTSSQHASRGGQSDDDEDEGVPASYHTVSLQ-----VSQDLLDLMHTLHTRAASIYSSWAEEQRHLETGGQKIEADSRTLWAHCWCPLLQGIACLCCDARRQVRMQALTYLQRALLVHDLQKLDALEWESCFNKVLFPLLTKLLENI-SPAD-VGGMEET-----RMRASTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHAGSS-DLLSEAIPESLKNMLLVMDTA----EIFHSADARGGGPSALWEITWERIDCFLPHLRDELFKQ 1752          

HSP 2 Score: 189.889 bits (481), Expect = 1.576e-47
Identity = 103/213 (48.36%), Postives = 144/213 (67.61%), Query Frame = 1
Query:   85 YVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTRIRKNNLTINM 723
            Y++Q EI +++ AIKR  + S      EE  DPL  +   LK  L+ I +LSE++P  FL PFL+VI S +  G ITGLALT+V KFLS+  ID +    ++G+    E +A+ VT+ +F+GTD +SDEV+LMKIL++L TL+  P G  +++ +VC+I+ SCFRICFE +LSELLR +AE TL  +V LLFTRLP+ KE+    KN +  NM
Sbjct:    7 YIIQGEINIVVGAIKRNARWSTHTPLDEE-RDPLLHSFGHLKEVLNSITELSEIEPNVFLRPFLEVIRSEDTTGPITGLALTSVNKFLSYALIDPTHEGTAEGM----ENMADAVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFTRLPQFKEEP---KNYVGTNM 211          

HSP 3 Score: 183.726 bits (465), Expect = 1.242e-45
Identity = 94/201 (46.77%), Postives = 134/201 (66.67%), Query Frame = 1
Query: 1225 KTQSTTTPYGLACVQKLLSNLILILSPENIFHTN-HVRTGLTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMIN 1824
            K  +   PYGL C+++L   LI + +P +  ++   +  GL L+T A ES    +++    LL  I++E+ ++   LL  +RL+ +AAS RVCFL+FESMR HLKFQ+EMY+ +L+ II  +N  +PYE +E+ALE+IVQLWRIPSF+TELY+NYDCD YCS+L  EL  L  K A P      L  T +++LDALL +I+
Sbjct:  424 KEGTALVPYGLPCIRELFRFLISLTNPHDRHNSEVMIHMGLHLLTVALESAP--VAQC-QTLLGLIKDEMCRHLFQLLSIERLNLYAASLRVCFLLFESMREHLKFQMEMYIKKLMEIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYCSNLFEELTKLLSKNAFPVSGQ--LYTTHLLSLDALLTVID 619          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Human
Match: GBF1 (golgi brefeldin A resistant guanine nucleotide exchange factor 1 [Source:HGNC Symbol;Acc:HGNC:4181])

HSP 1 Score: 654.825 bits (1688), Expect = 0.000e+0
Identity = 414/1137 (36.41%), Postives = 613/1137 (53.91%), Query Frame = 1
Query: 1891 NPEKKIKLTNPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQT---NQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE----AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQR-NQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELY-----------KTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSLNKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDEL----HYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEWN------NTISNDSELNVR-LWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAG---QLLKLTCDRLYTFLPDLVEELFYE 5202
            +P + I++ N    KK+++  GTE+FN   K GI++L+E+G       N E+A   RENPRL+K  IGE++  R N+ + E ++  F+F+GLRLD A+R++L+ FRLPGEA  IQ +LE F + +   N    ++ D+ F L YA++MLN DQHN N +KQ APMT+E+F++NL   N  K +   E+++L  +Y AIK EEIVMP EQ G++++NY+W  LL R  T    ++     ++  +LF + W   + A  YVF+  ++  I      G  +CA I+A+Y L ++ D +II + K+T  SS  E+IE     FG N K  +AAK++F +A +HGDILR+GWKN+++ +L LF+A+LLPK + EV+DF+  +  I L  E+    + E+  +    + +L+  + SS +  + E++  K  AL  I +C    +I E++FL+  SL E + AL+                          +++ D  ++    DE+   FCLE+++R++L N DR+      + DH Y + + +    FL+ER VV  LRLAI+LLR++E   QV   L IL L K SVL  V+  V  GLH+L+  +AANI S  DW  L T++E  G G K     +A           T+   +  +     S+L  Y                     +D S +     RGYTSDSE+Y             T  ++ ++ W++V   +D V  +K                      ++NQY++ +        D  ++ K  E LS++VRD AHITP NFE CV TLR+F E  +      +         DS  +   + +  G+  +       H        D EDE     ++ +S Q     ++++LLDLMHTLH RAA IY  W        T     E + R LW +CWCPLLQG+A LCCD R +VR  A+T+LQR+LL   L  L   +WE CF KVLFPLL+  LENI S +D +    +T     RMRA  +L+KVFLQHL  L  LSTF ALWLTIL++MD YM A ++ D L +A+ ESLKN+LLVM T      I   +++  G    L ++T +R+  FLP L +ELF +
Sbjct:  714 DPRELIEIKN----KKKLLITGTEQFNQKPKKGIQFLQEKGLLTIPMDNTEVAQWLRENPRLDKKMIGEFVSDRKNIDLLESFVSTFSFQGLRLDEALRLYLEAFRLPGEAPVIQRLLEAFTERWMNCNGSPFANSDACFSLAYAVIMLNTDQHNHNVRKQNAPMTLEEFRKNLKGVNGGKDF---EQDILEDMYHAIKNEEIVMPEEQTGLVRENYVWNVLLHRGATPEGIFLRVPTASYDLDLFTMTWGPTIAALSYVFDKSLEETIIQKAISGFRKCAMISAHYGLSDVFDNLIISLCKFTALSS--ESIENLPSVFGSNPKAHIAAKTVFHLAHRHGDILREGWKNIMEAMLQLFRAQLLPKAMIEVEDFVDPNGKISLQREETPSNRGESTVLSFVSWLTLSGPEQSSVRGPSTENQEAKRVALECIKQCDPEKMITESKFLQLESLQELMKALV--------------------------SVTPDEETY----DEEDAAFCLEMLLRIVLENRDRVGCVWQTVRDHLYHLCVQAQDFCFLVERAVVGLLRLAIRLLRREEISAQVLLSLRILLLMKPSVLSRVSHQVAYGLHELLKTNAANIHSGDDWATLFTLLECIGSGVKPPAALQA-----------TARADAPDAGAQSDSELPSY-------------------HQNDVSLD-----RGYTSDSEVYTDHGRPGKIHRSATDADVVNSGWLVV--GKDDVDNSKPGPSRPGPSP------------LINQYSLTVGL-DLGPHDTKSLLKCVESLSFIVRDAAHITPDNFELCVKTLRIFVEASLNGGCKSQEKRGKSHKYDSKGNRFKKKSKEGSMLRRPRTSSQHASRGGQSDDDEDEGVPASYHTVSLQ-----VSQDLLDLMHTLHTRAASIYSSWAEEQRHLETGGQKIEADSRTLWAHCWCPLLQGIACLCCDARRQVRMQALTYLQRALLVHDLQKLDALEWESCFNKVLFPLLTKLLENI-SPAD-VGGMEET-----RMRASTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHAGSS-DLLSEAIPESLKNMLLVMDTA----EIFHSADARGGGPSALWEITWERIDCFLPHLRDELFKQ 1744          

HSP 2 Score: 343.969 bits (881), Expect = 4.322e-95
Identity = 231/626 (36.90%), Postives = 343/626 (54.79%), Query Frame = 1
Query:   85 YVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTRIRKNNLTINM-------------DXXXXXXXXXXXXXIPIPSESHSDTS---------HPPEDSCSDEIIVTPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNEDISVNNEIEPLADDTDSQVLF--------DLTRIESNCTINFEPSGNPELSSLNI-KSDNIQYRT----------ENGIVFKSDLSGAADNSDN---ENATCKGSKSEKLPLKSKTQSTT-TPYGLACVQKLLSNLILILSPENIFHTN-HVRTGLTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMIN 1824
            Y++Q EI +++ AIKR  + S      EE  DPL  +   LK  L+ I +LSE++P  FL PFL+VI S +  G ITGLALT+V KFLS+  ID +    ++G+    E +A+ VT+ +F+GTD +SDEV+LMKIL++L TL+  P G  +++ +VC+I+ SCFRICFE +LSELLR +AE TL  +V LLFTRLP+ KE+    KN +  NM                  +       ++ + +   SD+S          PP         VTP +       + + SN       +D P T   S    + +  + P    TDS + F        DLT +E   +  +  +  P  S L + +  ++Q  T          E+      + +  AD+SD+    +      +  +    S+ + T   PYGL C+++L   LI + +P +  ++   +  GL L+T A ES    +++    LL  I++E+ ++   LL  +RL+ +AAS RVCFL+FESMR HLKFQ+EMY+ +L+ II  +N  +PYE +E+ALE+IVQLWRIPSF+TELY+NYDCD YCS+L  EL  L  K A P      L  T +++LDALL +I+
Sbjct:    7 YIIQGEINIVVGAIKRNARWSTHTPLDEE-RDPLLHSFGHLKEVLNSITELSEIEPNVFLRPFLEVIRSEDTTGPITGLALTSVNKFLSYALIDPTHEGTAEGM----ENMADAVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFTRLPQFKEEP---KNYVGTNMKKISPCLLNKLELSSGEQTKALNQLERLKMRAGGMSDSSKWKKQKRSPRPPRHMTK----VTPGSELPTPNGTTLSSNLTGGMPFIDVP-TPISSASSEAASAVVSP---STDSGLEFSSQTTSKEDLTDLEQPGSPGYSTATEPGSSELGVPEQPDLQEGTHVEKSQSASVESIPEVLEECTSPADHSDSASVHDMDYVNPRGVRFTQSSQKEGTALVPYGLPCIRELFRFLISLTNPHDRHNSEVMIHMGLHLLTVALESAP--VAQC-QTLLGLIKDEMCRHLFQLLSIERLNLYAASLRVCFLLFESMREHLKFQMEMYIKKLMEIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYCSNLFEELTKLLSKNAFPVSGQ--LYTTHLLSLDALLTVID 611          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Human
Match: ARFGEF1 (ADP ribosylation factor guanine nucleotide exchange factor 1 [Source:HGNC Symbol;Acc:HGNC:15772])

HSP 1 Score: 147.902 bits (372), Expect = 9.408e-35
Identity = 146/591 (24.70%), Postives = 255/591 (43.15%), Query Frame = 1
Query: 1429 LSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLM-NTQVI-----ALDALLFMINCINSRKDD-----------------------------LNR---------------AIYYDSESSETNPEKKIKLTNPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQTNQE-LASLFRENPRLNKTFIGEYICTRN--NVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSN--PEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAI--------KTEEIVMPS----------EQRGIIKDNYL------WRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCA-SIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLL 2961
            LSKN +    S     F  S  +   +  + + HLK Q+E++   +   I+ +     ++++ + ++++ ++      + ++Y+NYDCDL  +++   L +   KIA    S    M N Q +      L+ L+ ++ C+     D                             +NR                 Y    S   NPE+   L      +K II+ G + FN   K GI+YL+EQG   T  E +A    +  RL+ T +GE++   +  N  V   Y+   +F G     A+RMFL+ FRLPGEA  I  ++E FA  Y   N    + +  D+ +VL Y+I+ML  D H+P  K +   MT EQ+ +     N  K   ++ EE L+ IY  I        +T+E+ +P+          +QR ++ +  +       + L+       A + SA +  H   +F L W   + AF    + + D     S+ +   +CA  IA  +++    D  +  ++++T+ + S    E   KN  T    K++  +A   G+ L + W  +L C+  L  A+L+
Sbjct:  489 LSKNGV----SSVPEVFELSLSIFLTLLSNFKTHLKMQIEVFFKEIFLYIL-ETSTSSFDHKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANIFERLVNDLSKIAQGRGSQELGMSNVQELSLRKKGLECLVSILKCMVEWSKDQYVNPNSQTTLGQEKPSEQEMSEIKHPETINRYGSLNSLESTSSSGIGSYSTQMSGTDNPEQFEVLKQ----QKEIIEQGIDLFNKKPKRGIQYLQEQGMLGTTPEDIAQFLHQEERLDSTQVGEFLGDNDKFNKEVMYAYVDQHDFSGKDFVSALRMFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQVKNK---MTKEQYIKMNRGINDSK---DLPEEYLSAIYNEIAGKKISMKETKELTIPTKSSKQNVASEKQRRLLYNLEMEQMAKTAKALMEAVSHVQAPFTSATHLEHVRPMFKLAWTPFLAAFSVGLQ-DCDDTEVASLCLEGIRCAIRIACIFSIQLERDAYVQALARFTLLTVSSGITEMKQKNIDT---IKTLITVAHTDGNYLGNSWHEILKCISQLELAQLI 1060          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Human
Match: ARFGEF2 (ADP ribosylation factor guanine nucleotide exchange factor 2 [Source:HGNC Symbol;Acc:HGNC:15853])

HSP 1 Score: 146.362 bits (368), Expect = 2.812e-34
Identity = 141/581 (24.27%), Postives = 254/581 (43.72%), Query Frame = 1
Query: 1429 LSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQV-------IALDALLFMINCINSRKDDL-----------------------------NRAIYYDSESSETNPEKKIKLTNPMLY-----KKRIIKIGTEKFNNDIKDGIKYLREQGFCQTN-QELASLFRENPRLNKTFIGEYI--CTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSN--PEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVM-----------------PSEQRGIIKDNYLWRQ-------LLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLL 2961
            LSKN +    S     F  S  +   +  + + HLK Q+E++   +   I+ +     +E+R + ++++ ++      + ++Y+NYDCDL  +++   L +   KIA   RS   L  T +         L+ L+ ++ C+     DL                              R      ES+ ++  +     +P  +     +K II+ G E FN   K GI++L+EQG   T+ +++A    +  RL+ T +G+++    R N  V   Y+   +F       A+R FL+ FRLPGEA  I  ++E FA  Y   N    + +  D+ +VL Y+I+ML  D H+P  K +   MT EQ+ +     N  K   ++ EE L+ IYE I+ ++I M                  SE++  +  N    Q       L+     + A + SA + +H   +F LVW   + A+    +   D+ + +    G+     IA  + +    D  +  ++++++ ++S    E   KN  T    K++  +A   G+ L + W  +L C+  L  A+L+
Sbjct:  440 LSKNGV----SSVPDVFELSLAIFLTLLSNFKMHLKMQIEVFFKEIFLNIL-ETSTSSFEHRWMVIQTLTRICADAQCVVDIYVNYDCDLNAANIFERLVNDLSKIAQ-GRSGHELGMTPLQELSLRKKGLECLVSILKCMVEWSKDLYVNPNHQTSLGQERLTDQEIGDGKGLDMARRCSVTSMESTVSSGTQTTVQDDPEQFEVIKQQKEIIEHGIELFNKKPKRGIQFLQEQGMLGTSVEDIAQFLHQEERLDSTQVGDFLGDSARFNKEVMYAYVDQLDFCEKEFVSALRTFLEGFRLPGEAQKIDRLMEKFAARYIECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQVKNK---MTKEQYIKMNRGINDSK---DLPEEYLSSIYEEIEGKKIAMKETKELTIATKSTKQNVASEKQRRLLYNLEMEQMAKTAKALMEAVSHAKAPFTSATHLDHVRPMFKLVWTPLLAAYSIGLQNCDDTEVASLCLEGIRCAIRIACIFGMQLERDAYVQALARFSLLTASSSITEMKQKNIDT---IKTLITVAHTDGNYLGNSWHEILKCISQLELAQLI 1005          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Celegans
Match: gbf-1 (pep chromosome:WBcel235:III:11751320:11773681:-1 gene:WBGene00007703.1 transcript:C24H11.7a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:gbf-1)

HSP 1 Score: 530.791 bits (1366), Expect = 2.875e-157
Identity = 362/1163 (31.13%), Postives = 570/1163 (49.01%), Query Frame = 1
Query: 1933 KKRIIKIGTEKFNNDIKDGIKYLREQG-FCQTNQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFE-VEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIF--------------------------SSSQETIE-AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIE-EDKSLTKAEAPSVISHWF-FSLTSSDYSSGQRNQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIH-DFLLERTVVACLRLAIQ-LLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCR-GYTSDSELYKTTQNNLDSTK-----------WILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSLNKKSSIHNREYCDSGKSP-RGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDELHYKISAQIDKGSINE------------NLLDLMHTLHNRAAKIYFEWNNTIS---NDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAGQLLKLTCDRLYTFLPDLVEELFYEPLLPISDKIEES 5238
            +KR+I  GTE FN   K GI +LRE+G      Q L    R NP+L+K  I +YIC R +  V   ++K F F   RLD A+RMFL+ FRLPGE+A I L+++ F++ +  +N E     D+ F L YAI+MLNVDQHNP +K+ Q PMTV+ F+RNL   N  +   + + E+L  +Y+AIKTEEIVMP+EQ+G +K++Y+W+ LLRR  T+  ++  A    + ++LF + W  AV A  YVF+  E + ++  ++T G  +CA IAAYY + E+ D + I++ K+T                            SSS E +  AFG+N K +LA +++F +  ++G+ILR+GW+NL + LL LF+A+LLP  LTEV+D++ +   + +     K L      S +  WF     +S+    +  QE   +   A  VI++C    ++ ++++L   SL E ++++   +      ++     +Q   S              SG DE + VF LEL++ + L N DR+      +  H   +L         L+ER VV  LR+A + L R     D V   L +L       L   +  +  GL++LI  +AAN+  ++ W +L  ++E  G     D      ++    +KQ  SL    +   D+  +   Y  +                E    + E +E  R GY S+S+L    ++ +DS             WI +   + +    ++   +G  V  + K +         Q+  ++        +P A  K CE L++L+RD  H+TP NFES +  LR   E  +   +     +       SG +  R RSN             + K  H+     + EL   ++   D+    E            +LLDL   LH++   I+ +W    S   +D      +W + W PLLQ + RL CD R  VR  A+T LQR+ L   + +L  A+W+ CF +VLFPLL+  LE   SQ D +         D R+R +QI+ K  L HL AL  L +F  LW+ +L+YM+ Y++  ++C +L++AV ESLKN+LLVM        I   +     +L  +T +RL  F+P+L+++    P  P   + E S
Sbjct:  631 RKRLIAEGTELFNQSPKKGIAFLREKGILGHDEQSLVQWLRTNPQLDKKAIADYICNRKHAEVLNAFVKSFPFENTRLDVALRMFLETFRLPGESAEIALVMQHFSEEWFRANNEPFFHVDAAFTLSYAIIMLNVDQHNPQAKRSQPPMTVDCFRRNLSGTNDSR---DFDPEMLADMYQAIKTEEIVMPAEQKGTVKEDYMWKVLLRRGETAEGSFYHAPTGWNDHDLFAVCWGPAVAALSYVFDKSEHEQILQKALT-GYRKCAKIAAYYGMKEVFDNLCIHLCKFTTLTSMRDGGAGGGADEDVDLSAAALLSHSSSPEAVALAFGENHKAQLATRTLFYLVHENGNILREGWRNLFEALLQLFRARLLPAELTEVEDYVDEKGWVNIQRVHQKELPHTRNDSGLLSWFGLGGGASEADRRKPTQEQLSSMKLASQVISECRPSQIVADSKYLTSTSLAELLSSIAANS----AQIVEQAEPQQKTASL-------------SGEDEDALVFYLELIVAITLENKDRLPLVWPHVRRHLEWLLSPRFGRCPVLVERAVVGLLRVANRNLFRDNTVSDDVLHSLSMLLRLSPKALFIFSRQIAFGLYELIRANAANVHKKEHWAVLFALLEAAGAAVLPDDY----VMMTTTEKQQQSL----RVGGDQQQQRMAYSDV-----EGASGRGGGAHEERAYTSEGEERRRGGYDSNSDL----ESRVDSAGSLLGAQKQPADWIHLDHKDAAKATEEALTALGANVVSSKKNF--------RQFGSLVLRNGLGRHEPAAFLKVCECLAFLLRDAVHVTPDNFESSLQCLRTMVEASLDGGVYAAGPL-------SGDAQNRLRSNVTDEK-------AVKKHHHHHHGHKKKELCTDVTEDADESRNEEQQLIGNYQQMSLHLLDLCSQLHSQTPAIFAKWAQGASPAASDLATVAFIWTDIWRPLLQAIGRLSCDCRRGVRAAALTHLQRAFLPANMATLGAAEWQSCFGEVLFPLLTKLLEPF-SQMDPIGM------EDTRVRTLQIVAKTLLNHLSALSALDSFPDLWMLLLDYMEQYLRV-DSCGNLNEAVPESLKNMLLVM----DSTGIFAATP----RLYDVTVERLNKFMPELIKDTIPNPPRPGQQQSEAS 1717          

HSP 2 Score: 157.532 bits (397), Expect = 4.990e-38
Identity = 90/211 (42.65%), Postives = 130/211 (61.61%), Query Frame = 1
Query:   73 TNAKYVVQLE---ITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHS-SDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTR 693
            TN  Y+V  E   +  L+   +R+ + S + + ++  +DPL  N + LK  L+++ DL+++ P  +LSPFLDVI +    G IT  AL AV KFL++  ID S    ++    A+E++A  V +TKFIG   + SDE +L KIL++L +L+  P G L+S+ AVC ++ SCFRI FE  LS LLR  AE TL  +  L+FTRLP   EDTR
Sbjct:    3 TNGVYIVMGEANCVVALLNKARRQYQLSQVPTLED--TDPLLRNFTDLKEVLNEVADLADMNPQTYLSPFLDVIKAQNTNGPITEAALAAVAKFLNYGLIDASSIKAAN----AVESIAYAVVHTKFIGGKSTGSDECVLFKILQVLRSLLLSPPGILLSNEAVCDMMQSCFRIVFEQNLSLLLRKAAESTLADMTQLIFTRLPTFVEDTR 207          

HSP 3 Score: 155.606 bits (392), Expect = 1.587e-37
Identity = 81/178 (45.51%), Postives = 118/178 (66.29%), Query Frame = 1
Query: 1246 PYGLACVQKLLSNLILILSPENIFHT-NHVRTGLTLITAAFESGADYISKAPN--VLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIIS-----DNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATP 1755
            PYGL C ++LL  LI + +P +  +T + V  GL L+  A E+ AD++   PN  +L+  I+NEL +N + LL ++RL   AA+ R CFL+FESMR H+KFQLE YL +L SI+++     +N     E +E+ALES+VQLWRIP  +TE+YLN+DCDLYC ++  +L  L  + + P
Sbjct:  353 PYGLPCCRELLRFLITMTNPVDRHNTESMVILGLNLLIVALEAIADFL---PNYDILMPLIKNELCRNLLQLLDTNRLPVLAATNRCCFLLFESMRMHMKFQLESYLKKLQSIVLTEEKQHENGGGGTEQKEMALESLVQLWRIPGLVTEMYLNFDCDLYCGNIFEDLTKLLVENSFP 527          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Celegans
Match: gbf-1 (pep chromosome:WBcel235:III:11751628:11756613:-1 gene:WBGene00007703.1 transcript:C24H11.7b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:gbf-1)

HSP 1 Score: 158.303 bits (399), Expect = 1.497e-40
Identity = 89/240 (37.08%), Postives = 133/240 (55.42%), Query Frame = 1
Query: 4528 NLLDLMHTLHNRAAKIYFEWNNTIS---NDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAGQLLKLTCDRLYTFLPDLVEELFYEPLLPISDKIEES 5238
            +LLDL   LH++   I+ +W    S   +D      +W + W PLLQ + RL CD R  VR  A+T LQR+ L   + +L  A+W+ CF +VLFPLL+  LE   SQ D +         D R+R +QI+ K  L HL AL  L +F  LW+ +L+YM+ Y++  ++C +L++AV ESLKN+LLVM        I   +     +L  +T +RL  F+P+L+++    P  P   + E S
Sbjct:    4 HLLDLCSQLHSQTPAIFAKWAQGASPAASDLATVAFIWTDIWRPLLQAIGRLSCDCRRGVRAAALTHLQRAFLPANMATLGAAEWQSCFGEVLFPLLTKLLEPF-SQMDPIG------MEDTRVRTLQIVAKTLLNHLSALSALDSFPDLWMLLLDYMEQYLRV-DSCGNLNEAVPESLKNMLLVM----DSTGIFAATP----RLYDVTVERLNKFMPELIKDTIPNPPRPGQQQSEAS 227          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Celegans
Match: agef-1 (Arf-1 Guanine nucleotide Exchange Factor homolog [Source:UniProtKB/TrEMBL;Acc:G5EFH7])

HSP 1 Score: 147.902 bits (372), Expect = 3.827e-35
Identity = 125/562 (22.24%), Postives = 243/562 (43.24%), Query Frame = 1
Query: 1459 SDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKI--------ATP-----DRSVRCLMNTQVIALDALLFMINC---------INSRKDDLNRAIYYDSESSETNPEKKIKLTNPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQTNQ-ELASLFRENPRLNKTFIGEYICTRN--NVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPE--MVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNY--------------------------LWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMD----SVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNL 2973
            S+ +  F  S  +   + +  + HLK  +E++ + +I  ++ D+    +E + + L +I ++   P  + ++++NYDCD+   +L   + ++  K         A P     +R++R L       L  L  ++ C         +     D++     D+E SE    +  +    +  +K +++ G + F+   K G+K+L+E GF  T+  E+A    +  RLNKT +G+++   +  N  V   YI   +F  + +  A+RMFL++FRLPGEA  I  ++  FA  Y   NP   + +  D+ +VL ++I+ML  D HN   K +          R + E       GN+  E+L  I+E I   EI M +    +++                               R L+     ++A +  A +++H   +F + W   + AF    ++  D    S+      +G+     + A        +  I  ++++T+ ++     E   KN +   A K +  I  + G+ L + W +++ C+  L   +L+   L
Sbjct:  345 SNNIQVFEKSLAIFVELLDKFKTHLKASIEVFFNSVILPML-DSNTCAFEQKWIVLNTIGKILANPQSVVDMFVNYDCDMTSPNLFKSIVEVVSKTTRTTINENAPPAQKEKERAMRLL------GLSCLTDLLQCLVDWWQVCEVQKITSDID-----DAEPSEQQHGETFEAFETLKQQKNLMEQGIQIFSEKPKKGLKFLQEHGFVGTDAVEVAEFMMKEERLNKTQVGDFLGDSDEFNNSVMHAYIDFLDFSSIDILAALRMFLEKFRLPGEAQKIDRLMLKFASRYLDCNPRQGIFASADAAYVLAFSIIMLTTDLHNKTVKNKMTKQGYINMNRGINEG------GNIPVELLEAIFEDISKNEIKMRAGATALLRSRVTPGQGALATDKERRAMAALEMEALSETARALMESASDADAYFTPAQHQHHVKPMFKICWTPCLAAFSVGVQMSDDEEEWSLCLRGFRLGVRAACVLQATLE----RNAFIQALARFTLLTAKNSLGEMRVKNIE---AIKLLLLIGDEDGEYLEENWVDVMKCMSSLELVQLIGTGL 881          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Celegans
Match: bris-1 (BRag/Iqsec/Schizo related Arf GEF family member [Source:UniProtKB/TrEMBL;Acc:U4PLL0])

HSP 1 Score: 97.4413 bits (241), Expect = 2.614e-20
Identity = 74/223 (33.18%), Postives = 117/223 (52.47%), Query Frame = 1
Query: 1861 IYYDSESSETNPEKKIKLTNPML--YKKRIIKIGTEKFNNDIKDGIKYLREQGFCQTNQE-LASLFRENPRLNKTFIGEYICTRNNVG---VREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVS----DPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNK---KKYYGNVEEEVLNKIYEAIKTEEI 2490
            ++  SESS    + ++K    M    +KR  +I    FN   + G++ L   GF + + + LASL      L+K+ IGEYI T ++     V + +  L + RGL +D A+R  +  F LP EA  I  I++ FA  Y  SNP+  S      D+  +L +AI+MLN D H+PN K++   MT   F +NL   +K   +K   +++ + L  IY+ IK +E+
Sbjct:  119 VHERSESSNGRKKSEVKPPRQMTDQERKRQYRIALNFFNKKPERGVQLLTAWGFVKNSPDSLASLLFGRRGLSKSMIGEYIGTLHSPYHSLVLKYFTALIDIRGLEVDVALRKAMQFFILPKEAEKIDRIIQAFALHYSKSNPKRTSHYRGGWDTIHLLSFAIIMLNTDLHSPNVKQR---MTQADFVKNLRGQDKISGEKNGEDIDRKTLEGIYDRIKKDEL 338          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Celegans
Match: bris-1 (BRag/Iqsec/Schizo related Arf GEF family member [Source:UniProtKB/TrEMBL;Acc:U4PLL0])

HSP 1 Score: 97.0561 bits (240), Expect = 2.950e-20
Identity = 74/223 (33.18%), Postives = 117/223 (52.47%), Query Frame = 1
Query: 1861 IYYDSESSETNPEKKIKLTNPML--YKKRIIKIGTEKFNNDIKDGIKYLREQGFCQTNQE-LASLFRENPRLNKTFIGEYICTRN---NVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVS----DPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNK---KKYYGNVEEEVLNKIYEAIKTEEI 2490
            ++  SESS    + ++K    M    +KR  +I    FN   + G++ L   GF + + + LASL      L+K+ IGEYI T +   +  V + +  L + RGL +D A+R  +  F LP EA  I  I++ FA  Y  SNP+  S      D+  +L +AI+MLN D H+PN K++   MT   F +NL   +K   +K   +++ + L  IY+ IK +E+
Sbjct:   60 VHERSESSNGRKKSEVKPPRQMTDQERKRQYRIALNFFNKKPERGVQLLTAWGFVKNSPDSLASLLFGRRGLSKSMIGEYIGTLHSPYHSLVLKYFTALIDIRGLEVDVALRKAMQFFILPKEAEKIDRIIQAFALHYSKSNPKRTSHYRGGWDTIHLLSFAIIMLNTDLHSPNVKQR---MTQADFVKNLRGQDKISGEKNGEDIDRKTLEGIYDRIKKDEL 279          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Fly
Match: garz (gene:FBgn0264560 transcript:FBtr0305075)

HSP 1 Score: 706.057 bits (1821), Expect = 0.000e+0
Identity = 470/1410 (33.33%), Postives = 739/1410 (52.41%), Query Frame = 1
Query: 1234 STTTPYGLACVQKLLSNLILILSPENIFHTNHV-RTGLTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMI-----NCINSRKDDLNR-----------------------AIYYDSESSETNPEK----------------------KIKLTNPML----YKKRIIKIGTEKFNNDIKDGIKYLREQGFCQTN---QELASLFRENPRLNKTFIGEYICTRNNVG--VREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEA------------FGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQRN---QEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVI--HDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELYKTTQ----NNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSLNKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDELHYKISAQIDKGSINE----NLLDLMHTLHNRAAKIYFEWNNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFL-QRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELS-TFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAGQLLKLTCDRLYTFLPDLVEELFYE 5202
            ++ +PYGL  +Q+L   LI++ +P +  +++ +  TGL+L+T AFE  AD I K    LL  ++++L +N I LL S+RLS FAA  ++CFL+FES+R HLKFQLE YL +L  II SDN   PYE RE+AL++++QLWRIP F+TELY+NYDCDLYC+D+   L +L  K      +   + +T +I++D LL +I     NC  S+    NR                        I  DS +S    EK                       + +T+  L     KKR++  GTE+FN   + GI+YL+E G         ++A   RENP L+K  IGEYI  + NV   +   ++  F+F GLR+D A+R++L+ FRLPGEA  I L+LE F+  +H  N +  ++ D+ F L YAI+MLN+DQHN N+K+   PMT+E F +NL   N  +   + ++E+L +++ AIK EEIVMP+EQ G++++NY W+ LLRR  T +  +      ++  E+FN+VW ++++A  ++F+   ++    ++  G  + A+I+A+YNL    D +++ + K+T   SS E  E             FG N K + A +++F +   +GD LR+ WK++LD  L LF+ KLLPK+L EV+DF   +   +LI E K   K E     S  F SL S   S GQR    +E +  K      I +C +  +++E++F++  SL E +  ++                   L   P    S      P   D+   VF +E ++++++HN DR+      + D  Y +L+GS    +D+LL R +VA L+LAI L+R +E    V   L++L + K ++L  ++  +  G+++L+   A NI SE+DW+++  ++E  G G  + P Y           Q+      S  ++  +S   D  ++ +                           RGYTSDSE+ K +     ++  +  WILV+        NK +E    +   +    S  P       N ++     +   P A+ K  + L+++VR  AHITP NFE+CV  +R+F E C    + ++  +   E     KS + RS        +  +  +   +  +   S+++++   + Q D     E     LLDLM+TL+ R A+I+  W        + +  LW   WCPLLQG+ARL  D R EVRT A++ L QR+LL   L +L+G +W  CF +VLFPLL+  L     +S++    +     + R+R   I++KVFLQHL  L EL   F  LWL IL+Y++ +MK  +  D+L + ++E LKN+LLVM++    R    +  S    L +LT  R+  FLP+L EELF++
Sbjct:  358 TSLSPYGLPFIQELFRFLIILCNPLDKQNSDSMMHTGLSLLTVAFEVAADNIGKYEG-LLELVKDDLCRNLISLLSSERLSIFAADLQLCFLLFESLRGHLKFQLEAYLRKLSEIIASDNPKTPYEMRELALDNLLQLWRIPGFVTELYINYDCDLYCTDMFESLTNLLSKYTL--SATNAVYSTHIISMDTLLSVIDSIERNCAASKNSSNNRESLPEAAPATGGSRHSRHNSGLEGIVIDSGNSVAAEEKVENIASFINASSHRLRLQSGGEGVGITSEQLAKVKQKKRLLSQGTERFNQRPEKGIQYLQEHGILNAELDPMQVALFLRENPGLDKKMIGEYISKKKNVDSKILINFVDSFDFTGLRVDQALRLYLETFRLPGEAPLIFLVLEHFSDHWHKQNQDPFANVDAAFRLAYAIIMLNMDQHNSNAKRLNVPMTLEDFTKNLRGLNGGE---DFDQEMLAQVFNAIKNEEIVMPAEQTGLVRENYQWKVLLRRGDTHDGHFHYVHDASYDVEIFNIVWGASLSALSFMFDKSTETGYQRTLA-GFSKSAAISAHYNLHSDFDALVLTLCKFTTLLSSVEQHEPAPANNETQQAVNFGLNGKAQAAMRTVFLLVHDYGDCLRESWKHILDLYLQLFRLKLLPKSLIEVEDFCEANGKAMLILE-KPREKQE-----SGLFSSLYSFISSEGQREPTYEEQDFIK-LGRKCIKECQLDQMLQESKFVQLESLQELLKCVL------------------ALLKAPQGHKSI---GLPYAEDQT--VFWMEFLVKIVVHNRDRMIPLWPAVRDQMYLLLMGSASCGYDYLLNRCIVAVLKLAIYLMRNEELCPIVLQSLKMLLMLKPALLLRISKQISIGIYELLKTSAQNIHSEQDWQIIFNLLECVGAGA-VPPNYD--------DAQLPLPPNGSAKSDGAISGEEDATAVPE---------------------------RGYTSDSEITKASAAPAVSSPSAENWILVN--------NKDSELTTASRPQSPPSLSAPP------VNTLVYNCQLLDHAPFALFKCWDSLAFIVRSVAHITPYNFEACVRCIRIFVEACRDGGIRQRRKL---ESAAKQKSSKKRSERKPGMASSASSSNL---TLLTGDPSDNQINGNAAEQEDLAQRYEQLSIQLLDLMYTLYTRTAQIFRWWAEEGCTVPQ-SAALWSPGWCPLLQGIARLAMDRRREVRTHAISCLQQRALLVHDLQTLSGTEWCSCFHQVLFPLLNELL----PESNAAGQLDAALLEESRIRTATIMSKVFLQHLTTLIELGNAFNELWLDILDYIERFMKVGS--DTLSEQMQEILKNMLLVMHS---VRVFHNQDGSLQQALWELTWRRIGEFLPNLKEELFHD 1664          

HSP 2 Score: 157.918 bits (398), Expect = 3.676e-38
Identity = 86/217 (39.63%), Postives = 137/217 (63.13%), Query Frame = 1
Query:   61 MTSKTNAKYVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKE---DTRIRK 702
            M    N  YVV+ E+  LMTA++R  + +   +Y ++ +D L      LK  L++I DL +++P  FL+PFL+VI + +  G +T LAL +V K LS+  ID +  N +D     +E +A+ VT+ +F+GTD SSD V  M+++ +L TL+  P G  +S+ ++C+++ SCF+I FE +LSELLR +AE +L+ +V L F RLP+  E   DT ++K
Sbjct:    1 MALPGNGIYVVRGEMATLMTAMRRGTRWNAT-AYVDDENDSLLKLFIDLKHELNRIEDLRQIEPQVFLAPFLEVIRTADATGPLTSLALASVNKLLSYGLIDPTSPNLAD----IVERIADAVTHARFMGTDQSSDGVTFMRVIEVLHTLIRSPEGAAVSNVSMCEVMLSCFKISFEPRLSELLRRSAEKSLKDMVLLFFMRLPQFAEERSDTMLQK 212          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Fly
Match: garz (gene:FBgn0264560 transcript:FBtr0087897)

HSP 1 Score: 706.057 bits (1821), Expect = 0.000e+0
Identity = 470/1410 (33.33%), Postives = 739/1410 (52.41%), Query Frame = 1
Query: 1234 STTTPYGLACVQKLLSNLILILSPENIFHTNHV-RTGLTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMI-----NCINSRKDDLNR-----------------------AIYYDSESSETNPEK----------------------KIKLTNPML----YKKRIIKIGTEKFNNDIKDGIKYLREQGFCQTN---QELASLFRENPRLNKTFIGEYICTRNNVGVRE--EYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEA------------FGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQRN---QEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVI--HDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELYKTTQ----NNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSLNKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDELHYKISAQIDKGSINE----NLLDLMHTLHNRAAKIYFEWNNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFL-QRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELS-TFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAGQLLKLTCDRLYTFLPDLVEELFYE 5202
            ++ +PYGL  +Q+L   LI++ +P +  +++ +  TGL+L+T AFE  AD I K    LL  ++++L +N I LL S+RLS FAA  ++CFL+FES+R HLKFQLE YL +L  II SDN   PYE RE+AL++++QLWRIP F+TELY+NYDCDLYC+D+   L +L  K      +   + +T +I++D LL +I     NC  S+    NR                        I  DS +S    EK                       + +T+  L     KKR++  GTE+FN   + GI+YL+E G         ++A   RENP L+K  IGEYI  + NV  +    ++  F+F GLR+D A+R++L+ FRLPGEA  I L+LE F+  +H  N +  ++ D+ F L YAI+MLN+DQHN N+K+   PMT+E F +NL   N  +   + ++E+L +++ AIK EEIVMP+EQ G++++NY W+ LLRR  T +  +      ++  E+FN+VW ++++A  ++F+   ++    ++  G  + A+I+A+YNL    D +++ + K+T   SS E  E             FG N K + A +++F +   +GD LR+ WK++LD  L LF+ KLLPK+L EV+DF   +   +LI E K   K E     S  F SL S   S GQR    +E +  K      I +C +  +++E++F++  SL E +  ++                   L   P    S      P   D+   VF +E ++++++HN DR+      + D  Y +L+GS    +D+LL R +VA L+LAI L+R +E    V   L++L + K ++L  ++  +  G+++L+   A NI SE+DW+++  ++E  G G  + P Y           Q+      S  ++  +S   D  ++ +                           RGYTSDSE+ K +     ++  +  WILV+        NK +E    +   +    S  P       N ++     +   P A+ K  + L+++VR  AHITP NFE+CV  +R+F E C    + ++  +   E     KS + RS        +  +  +   +  +   S+++++   + Q D     E     LLDLM+TL+ R A+I+  W        + +  LW   WCPLLQG+ARL  D R EVRT A++ L QR+LL   L +L+G +W  CF +VLFPLL+  L     +S++    +     + R+R   I++KVFLQHL  L EL   F  LWL IL+Y++ +MK  +  D+L + ++E LKN+LLVM++    R    +  S    L +LT  R+  FLP+L EELF++
Sbjct:  358 TSLSPYGLPFIQELFRFLIILCNPLDKQNSDSMMHTGLSLLTVAFEVAADNIGKYEG-LLELVKDDLCRNLISLLSSERLSIFAADLQLCFLLFESLRGHLKFQLEAYLRKLSEIIASDNPKTPYEMRELALDNLLQLWRIPGFVTELYINYDCDLYCTDMFESLTNLLSKYTL--SATNAVYSTHIISMDTLLSVIDSIERNCAASKNSSNNRESLPEAAPATGGSRHSRHNSGLEGIVIDSGNSVAAEEKVENIASFINASSHRLRLQSGGEGVGITSEQLAKVKQKKRLLSQGTERFNQRPEKGIQYLQEHGILNAELDPMQVALFLRENPGLDKKMIGEYISKKKNVDSKILINFVDSFDFTGLRVDQALRLYLETFRLPGEAPLIFLVLEHFSDHWHKQNQDPFANVDAAFRLAYAIIMLNMDQHNSNAKRLNVPMTLEDFTKNLRGLNGGE---DFDQEMLAQVFNAIKNEEIVMPAEQTGLVRENYQWKVLLRRGDTHDGHFHYVHDASYDVEIFNIVWGASLSALSFMFDKSTETGYQRTLA-GFSKSAAISAHYNLHSDFDALVLTLCKFTTLLSSVEQHEPAPANNETQQAVNFGLNGKAQAAMRTVFLLVHDYGDCLRESWKHILDLYLQLFRLKLLPKSLIEVEDFCEANGKAMLILE-KPREKQE-----SGLFSSLYSFISSEGQREPTYEEQDFIK-LGRKCIKECQLDQMLQESKFVQLESLQELLKCVL------------------ALLKAPQGHKSI---GLPYAEDQT--VFWMEFLVKIVVHNRDRMIPLWPAVRDQMYLLLMGSASCGYDYLLNRCIVAVLKLAIYLMRNEELCPIVLQSLKMLLMLKPALLLRISKQISIGIYELLKTSAQNIHSEQDWQIIFNLLECVGAGA-VPPNYD--------DAQLPLPPNGSAKSDGAISGEEDATAVPE---------------------------RGYTSDSEITKASAAPAVSSPSAENWILVN--------NKDSELTTASRPQSPPSLSAPP------VNTLVYNCQLLDHAPFALFKCWDSLAFIVRSVAHITPYNFEACVRCIRIFVEACRDGGIRQRRKL---ESAAKQKSSKKRSERKPGMASSASSSNL---TLLTGDPSDNQINGNAAEQEDLAQRYEQLSIQLLDLMYTLYTRTAQIFRWWAEEGCTVPQ-SAALWSPGWCPLLQGIARLAMDRRREVRTHAISCLQQRALLVHDLQTLSGTEWCSCFHQVLFPLLNELL----PESNAAGQLDAALLEESRIRTATIMSKVFLQHLTTLIELGNAFNELWLDILDYIERFMKVGS--DTLSEQMQEILKNMLLVMHS---VRVFHNQDGSLQQALWELTWRRIGEFLPNLKEELFHD 1664          

HSP 2 Score: 158.303 bits (399), Expect = 3.149e-38
Identity = 86/217 (39.63%), Postives = 137/217 (63.13%), Query Frame = 1
Query:   61 MTSKTNAKYVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKE---DTRIRK 702
            M    N  YVV+ E+  LMTA++R  + +   +Y ++ +D L      LK  L++I DL +++P  FL+PFL+VI + +  G +T LAL +V K LS+  ID +  N +D     +E +A+ VT+ +F+GTD SSD V  M+++ +L TL+  P G  +S+ ++C+++ SCF+I FE +LSELLR +AE +L+ +V L F RLP+  E   DT ++K
Sbjct:    1 MALPGNGIYVVRGEMATLMTAMRRGTRWNAT-AYVDDENDSLLKLFIDLKHELNRIEDLRQIEPQVFLAPFLEVIRTADATGPLTSLALASVNKLLSYGLIDPTSPNLAD----IVERIADAVTHARFMGTDQSSDGVTFMRVIEVLHTLIRSPEGAAVSNVSMCEVMLSCFKISFEPRLSELLRRSAEKSLKDMVLLFFMRLPQFAEERSDTMLQK 212          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Fly
Match: garz (gene:FBgn0264560 transcript:FBtr0087898)

HSP 1 Score: 706.057 bits (1821), Expect = 0.000e+0
Identity = 470/1410 (33.33%), Postives = 739/1410 (52.41%), Query Frame = 1
Query: 1234 STTTPYGLACVQKLLSNLILILSPENIFHTNHV-RTGLTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMI-----NCINSRKDDLNR-----------------------AIYYDSESSETNPEK----------------------KIKLTNPML----YKKRIIKIGTEKFNNDIKDGIKYLREQGFCQTN---QELASLFRENPRLNKTFIGEYICTRNNVG--VREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEA------------FGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQRN---QEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVI--HDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELYKTTQ----NNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSLNKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDELHYKISAQIDKGSINE----NLLDLMHTLHNRAAKIYFEWNNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFL-QRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELS-TFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAGQLLKLTCDRLYTFLPDLVEELFYE 5202
            ++ +PYGL  +Q+L   LI++ +P +  +++ +  TGL+L+T AFE  AD I K    LL  ++++L +N I LL S+RLS FAA  ++CFL+FES+R HLKFQLE YL +L  II SDN   PYE RE+AL++++QLWRIP F+TELY+NYDCDLYC+D+   L +L  K      +   + +T +I++D LL +I     NC  S+    NR                        I  DS +S    EK                       + +T+  L     KKR++  GTE+FN   + GI+YL+E G         ++A   RENP L+K  IGEYI  + NV   +   ++  F+F GLR+D A+R++L+ FRLPGEA  I L+LE F+  +H  N +  ++ D+ F L YAI+MLN+DQHN N+K+   PMT+E F +NL   N  +   + ++E+L +++ AIK EEIVMP+EQ G++++NY W+ LLRR  T +  +      ++  E+FN+VW ++++A  ++F+   ++    ++  G  + A+I+A+YNL    D +++ + K+T   SS E  E             FG N K + A +++F +   +GD LR+ WK++LD  L LF+ KLLPK+L EV+DF   +   +LI E K   K E     S  F SL S   S GQR    +E +  K      I +C +  +++E++F++  SL E +  ++                   L   P    S      P   D+   VF +E ++++++HN DR+      + D  Y +L+GS    +D+LL R +VA L+LAI L+R +E    V   L++L + K ++L  ++  +  G+++L+   A NI SE+DW+++  ++E  G G  + P Y           Q+      S  ++  +S   D  ++ +                           RGYTSDSE+ K +     ++  +  WILV+        NK +E    +   +    S  P       N ++     +   P A+ K  + L+++VR  AHITP NFE+CV  +R+F E C    + ++  +   E     KS + RS        +  +  +   +  +   S+++++   + Q D     E     LLDLM+TL+ R A+I+  W        + +  LW   WCPLLQG+ARL  D R EVRT A++ L QR+LL   L +L+G +W  CF +VLFPLL+  L     +S++    +     + R+R   I++KVFLQHL  L EL   F  LWL IL+Y++ +MK  +  D+L + ++E LKN+LLVM++    R    +  S    L +LT  R+  FLP+L EELF++
Sbjct:  358 TSLSPYGLPFIQELFRFLIILCNPLDKQNSDSMMHTGLSLLTVAFEVAADNIGKYEG-LLELVKDDLCRNLISLLSSERLSIFAADLQLCFLLFESLRGHLKFQLEAYLRKLSEIIASDNPKTPYEMRELALDNLLQLWRIPGFVTELYINYDCDLYCTDMFESLTNLLSKYTL--SATNAVYSTHIISMDTLLSVIDSIERNCAASKNSSNNRESLPEAAPATGGSRHSRHNSGLEGIVIDSGNSVAAEEKVENIASFINASSHRLRLQSGGEGVGITSEQLAKVKQKKRLLSQGTERFNQRPEKGIQYLQEHGILNAELDPMQVALFLRENPGLDKKMIGEYISKKKNVDSKILINFVDSFDFTGLRVDQALRLYLETFRLPGEAPLIFLVLEHFSDHWHKQNQDPFANVDAAFRLAYAIIMLNMDQHNSNAKRLNVPMTLEDFTKNLRGLNGGE---DFDQEMLAQVFNAIKNEEIVMPAEQTGLVRENYQWKVLLRRGDTHDGHFHYVHDASYDVEIFNIVWGASLSALSFMFDKSTETGYQRTLA-GFSKSAAISAHYNLHSDFDALVLTLCKFTTLLSSVEQHEPAPANNETQQAVNFGLNGKAQAAMRTVFLLVHDYGDCLRESWKHILDLYLQLFRLKLLPKSLIEVEDFCEANGKAMLILE-KPREKQE-----SGLFSSLYSFISSEGQREPTYEEQDFIK-LGRKCIKECQLDQMLQESKFVQLESLQELLKCVL------------------ALLKAPQGHKSI---GLPYAEDQT--VFWMEFLVKIVVHNRDRMIPLWPAVRDQMYLLLMGSASCGYDYLLNRCIVAVLKLAIYLMRNEELCPIVLQSLKMLLMLKPALLLRISKQISIGIYELLKTSAQNIHSEQDWQIIFNLLECVGAGA-VPPNYD--------DAQLPLPPNGSAKSDGAISGEEDATAVPE---------------------------RGYTSDSEITKASAAPAVSSPSAENWILVN--------NKDSELTTASRPQSPPSLSAPP------VNTLVYNCQLLDHAPFALFKCWDSLAFIVRSVAHITPYNFEACVRCIRIFVEACRDGGIRQRRKL---ESAAKQKSSKKRSERKPGMASSASSSNL---TLLTGDPSDNQINGNAAEQEDLAQRYEQLSIQLLDLMYTLYTRTAQIFRWWAEEGCTVPQ-SAALWSPGWCPLLQGIARLAMDRRREVRTHAISCLQQRALLVHDLQTLSGTEWCSCFHQVLFPLLNELL----PESNAAGQLDAALLEESRIRTATIMSKVFLQHLTTLIELGNAFNELWLDILDYIERFMKVGS--DTLSEQMQEILKNMLLVMHSV---RVFHNQDGSLQQALWELTWRRIGEFLPNLKEELFHD 1664          

HSP 2 Score: 157.918 bits (398), Expect = 3.553e-38
Identity = 86/217 (39.63%), Postives = 137/217 (63.13%), Query Frame = 1
Query:   61 MTSKTNAKYVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKE---DTRIRK 702
            M    N  YVV+ E+  LMTA++R  + +   +Y ++ +D L      LK  L++I DL +++P  FL+PFL+VI + +  G +T LAL +V K LS+  ID +  N +D     +E +A+ VT+ +F+GTD SSD V  M+++ +L TL+  P G  +S+ ++C+++ SCF+I FE +LSELLR +AE +L+ +V L F RLP+  E   DT ++K
Sbjct:    1 MALPGNGIYVVRGEMATLMTAMRRGTRWNAT-AYVDDENDSLLKLFIDLKHELNRIEDLRQIEPQVFLAPFLEVIRTADATGPLTSLALASVNKLLSYGLIDPTSPNLAD----IVERIADAVTHARFMGTDQSSDGVTFMRVIEVLHTLIRSPEGAAVSNVSMCEVMLSCFKISFEPRLSELLRRSAEKSLKDMVLLFFMRLPQFAEERSDTMLQK 212          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Fly
Match: Sec71 (gene:FBgn0028538 transcript:FBtr0080537)

HSP 1 Score: 152.14 bits (383), Expect = 2.072e-36
Identity = 138/581 (23.75%), Postives = 258/581 (44.41%), Query Frame = 1
Query: 1477 FAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNT------QVIALDALLFMINCI------------------------NSRKDDLNRAIYY----DSESSETNPEKKIKLTNPM---LYKKRIIKIGTEKFNNDIKDGIKYLRE-QGFCQTNQELASLFRENPRLNKTFIGEYICTRNNVG--VREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNP--EMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQF-KRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVM-----------PSEQRGIIKD---NYLWR-----------QLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTIL 3015
            F  S  +   +  + + HLK Q+E++   +   I+  N +  +E++ + ++++ ++      + ++Y+NYDCD   ++L   L +   KIA   +++    N       ++  L+ L+ ++ C+                        ++ +D  +  I       S S  +N E+   L   +     +K +++ G E FN   + G+++L+E Q    T  ++A    E+ RL+KT IG YI   ++    V   YI  F+FR + +  A+R  L+ FRLPGEA  I  ++E FA  Y   NP  ++    D+ +VL ++I+ML  D H+P  K +   MT EQ+ K N    + K    ++ EE L+ IY+ I   EI M           P+ ++  I +     LW             L++      + + SA +  H   +F + W   + AF    +   D  I T    G+     IA  +++    D  +  ++++T+ +++    E   KN  T    K++  +A   G+ L   W +++ C+  L  A+L+   +     F+S  +T L
Sbjct:  394 FELSLSIFVALLSNFKVHLKRQIEVFFKEIFLNILEANSS-SFEHKWMVIQALTRICADAQSVVDIYVNYDCDFSAANLFERLVNDLSKIAQGRQALELGANPMQEKSMRIRGLECLVSILKCMVEWSKDLYVNPNMPVPPMQVQSPTSTEQDQADTTIQTMHSGSSHSLNSNQEQLQDLPEALEERKMRKEVMETGIELFNRKPQKGVQFLQEKQLLGATCGDIARWLHEDERLDKTVIGNYIGENDDHSKEVMCAYIDAFDFRQMEVVAALRFLLEGFRLPGEAQKIDRLMEKFASRYCECNPKNQLFQSADTVYVLAFSIIMLTTDLHSPQVKHK---MTKEQYIKMNRGISDSK---SDLPEEYLSSIYDEISEHEIKMKNNSGMLQQAKPTGKQAFITEKRRKLLWNMEMEVISLTATNLMQSVSHVKSPFTSAKHLEHVRPMFKMAWTPFLAAFSVGLQDCDDPEIATLCLDGIRCAIRIACIFHMSLERDAYVQALARFTLLNANSPINEMKAKNIDT---IKTLIMVAHTDGNYLGSSWLDIVKCISQLELAQLIGTGVRP--QFLSGAQTTL 962          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Fly
Match: step (gene:FBgn0086779 transcript:FBtr0085910)

HSP 1 Score: 117.857 bits (294), Expect = 1.812e-27
Identity = 77/218 (35.32%), Postives = 120/218 (55.05%), Query Frame = 1
Query: 1933 KKRIIKIGTEKFNNDIKDGIKYLREQGFCQTN-QELASLFRENPRLNKTFIGEYICTRN--NVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGII--------KDNYLWRQLLR 2553
            K + + IG +KFN D K GI+YL E    + + Q++A    +   LNKT IG+Y+  +N  N  V + ++ L +F  L L  A+R FL  FRLPGEA  I  ++E FA+ Y   NP++ ++ D+ +VL +AI+MLN   HNP+ K +    TV+QF       N     G++   +L  +YE+I+TE   +P +    +        K+ +LW+Q  R
Sbjct:   78 KDKQMSIGRKKFNMDPKKGIEYLVENRLLRHDPQDVAHFLYKGEGLNKTAIGDYLGEKNDFNEDVLKAFVALHDFTNLILVQALRQFLWSFRLPGEAQKIDRMMETFAQRYCQLNPDIFTNTDTCYVLSFAIIMLNTSLHNPSVKDKP---TVDQFISMNRGINNG---GDLPRGLLESLYESIRTEPFKIPQDDGNDLMHTFFNPDKEGWLWKQGGR 289          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Zebrafish
Match: gbf1 (golgi brefeldin A resistant guanine nucleotide exchange factor 1 [Source:ZFIN;Acc:ZDB-GENE-081107-54])

HSP 1 Score: 661.759 bits (1706), Expect = 0.000e+0
Identity = 426/1128 (37.77%), Postives = 616/1128 (54.61%), Query Frame = 1
Query: 1933 KKRIIKIGTEKFNNDIKDGIKYLREQGFCQT---NQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGN-VEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE----AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQRN--QEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELY--------KTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCV----KSSLNKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDELHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEW----------NNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAG--QLLKLTCDRLYTFLPDLVEELFYEPLLP 5214
            KK+++  GTE+FN   K GI+ L+E+G   +   N E+A   RENPRL+K  IGE+I  R N  + + ++  F F+GLR+D A+R++L+ FRLPGEA  I  +LE F   +H  N       D+ F L YA++MLN DQHN N +KQ  PMT+EQFK+NL   N     GN  ++++L  IY AIK EEIVMP EQ G++K+NY+W  LL R  ++   ++     ++  +LF++ W   + A  YVF+  +D  I      G  +CA I+A+Y   ++ D +II + K+T  SS  E++E     FG N K ++AAK++F +A +HGDILRDGWKN++D +L LF+A+LLPK + EV+DF+  ++ I L  E+    + E+ +V+S  F S  +    SG R    E++  K  AL  I +C    L  E++FL+  SL E + ALI                          +++ D  ++    DE+   FCLE+++R++L N DR++     + DH Y + + +    FL+ER VV  LRLAI+LLR+++   QV   L +L + K  VL  V+  V  GLH+L+  +AANI S  DW  L +++E  G G K  P    +  N       T+    + + +D  S+LS Y                     S+ S +     RGYTSDSE+Y          +  ++D   W++V   +D +   K+A      V    K  +    P+VNQY++ L        D  ++ K  + LS++VRD AH+TP NFE CV  +RVF E  +    ++   KKS  ++ +     K PR +   +  TK +   P     SH    D E+E     S       ++ +LLDLMHTLH RAA IY  W             I  DS+    LW +CWCPLLQGMA LCCD R +VR  A+T+LQR+LL   L +L   +WE CF KVLFPLL+  LENI S +D +    +T     RMRA  +L+KVFLQHL  L  L TF ALWLTIL++MD YM A ++ D L +A+ ESLKN+LLVM T      I   ++S  G   L ++T +R+  FLP L EELF + ++P
Sbjct:  709 KKKLLITGTEQFNQKPKKGIQTLQEKGLLSSPMDNNEVAQWLRENPRLDKKMIGEFISDRRNTDLLDSFVNTFTFQGLRIDEALRLYLEAFRLPGEAPVIHRLLETFTDNWHKVNGNPFQTNDAGFALAYAVIMLNTDQHNHNVRKQNIPMTLEQFKKNLKGVNG----GNDFDQDMLEDIYNAIKNEEIVMPDEQTGLVKENYVWSVLLHRGASAEGMFLHVPDGSYDRDLFSMTWGPTIAALSYVFDKSLDDTIIEKAIAGFRKCAMISAHYGFSDVFDNLIISLCKFTTLSS--ESVENLPTVFGSNRKAQVAAKTVFSLAHRHGDILRDGWKNIMDSMLQLFRAELLPKTMVEVEDFLDPNEKISLQREETPSNRGES-AVLS--FVSWLTLSEQSGLRGPSTENQEAKQAALLCIKQCDPEKLNTESKFLQLESLQELMKALI--------------------------SVTPDEETY----DEEDAAFCLEMLLRIILENRDRVSCVWQTVRDHLYQLCVHANESCFLVERAVVGLLRLAIRLLRREDIGSQVLLSLRLLLMMKPHVLSRVSREVAYGLHELLKTNAANIHSTDDWYTLFSLLECIGAGIK--PPAALQFAN-------TNPDNDTGAQSD--SELSSY-------------------HQSEVSLD-----RGYTSDSEIYNEHGKSRIPRSATDVD-VGWLVV--GKDDLDGAKAA------VTTPSKPMN---HPLVNQYSLTLGQ-DMGLHDTKSLIKCVDSLSFIVRDAAHVTPENFELCVKAIRVFVEASLNGGYRTHEKKKSHKYDSKSSRLRKKPREKEGASRRTKASSQRP---ARSHS---DDEEEEGVPASYHTVSFQVSLDLLDLMHTLHTRAAGIYSSWAEEQRHLEDAGKKIEADSQT---LWTSCWCPLLQGMAWLCCDARRQVRMQALTYLQRALLVHDLQTLDAVEWESCFNKVLFPLLTKLLENI-SPAD-VGGMEET-----RMRACTLLSKVFLQHLSPLLSLPTFAALWLTILDFMDKYMHAGSS-DLLLEAIPESLKNMLLVMDTA----GIFHSADSRTGYSDLWEITWERIVCFLPRLKEELFKQAVIP 1728          

HSP 2 Score: 340.502 bits (872), Expect = 3.276e-94
Identity = 226/613 (36.87%), Postives = 345/613 (56.28%), Query Frame = 1
Query:   85 YVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTRIRKNNLTINMDXXXXXXXXXXXXXIPIPSESHSDTS---------HPPEDSCSDEIIVTPNTSNSKDEASEIISN--------DIDSEKKLDYP--LTAAESNEDISVNNEIEPLADDTDSQVLFDLTRIESNCTINFEPSGNPELSSLNIKSDNIQYRTENGIV-----------FKSDLSGAADNSDNENATCKGSKSEKLPLKSKTQSTTTPYGLACVQKLLSNLILILSPENIFHTN-HVRTGLTLITAAFESG--ADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMIN 1824
            Y+VQ EI++++ AIKR  + S      EE  D L ++   LK  L+ I DLS+++P  FL PFL+V+ S +  G ITGLALT+V KFLS+  ID     + +G    IE +A+ VT+ +F+GTD +SDEV+LMKIL++L TL+  P G  +++ +VC+I+ SCFRICFE +LSELLR +AE TL  +V LLF+RLP+ KE+    K+ +  NM  +        R ++ + +   S++S          PP       ++ +P+      ++S + +N        +  S     +P   +AA S    + ++ ++  +  T  + L DL +  S  T    PS  P       +   ++ R ++  V             +D S +A   D +    +G +  +     K  +   PYGL C+++L   LI + +P +  +++  +  GL L+  A E+   A Y S     LL  +++EL ++ I LL  DR++ + AS RVCFL+FESMR HLKFQLEMYL +L+ II S+N  +PYE +E+ALE+IVQLWRIPSF+TELY+NYDCD YCS+L  +L  L  K A P      L  T +++L+ALL +I+
Sbjct:    7 YIVQGEISVVVAAIKRNSRWSTHTPLDEE-QDTLLNSFRLLKERLNNIKDLSDVEPNVFLRPFLEVVRSEDTTGPITGLALTSVNKFLSYGLIDA----NHEGAAECIENMADAVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFSRLPQFKEEA---KSYVGTNMKKAYNILWKNKRVQLKMRAGGMSESSKWKKQKRSPRPPR-----HMVRSPSGQMDPAQSSTLTNNLSGGVPFIEQHSGGSSTFPGSDSAASSISSPTTDSGLDTGSKTTSKEDLTDLDQNSSTATTPITPSAEPGRLESQSEGRGVE-RAQSASVESIPEVLEDRDLLADQSDSASVHDMDYVNPRGVRFTQS--TQKEGAALIPYGLPCLRELFRFLISLTNPHDRHNSDVMMHMGLQLLNVALEAAHIAPYQS-----LLGLVKDELCRHLIQLLGVDRMNLYTASIRVCFLLFESMREHLKFQLEMYLKKLMDIITSENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDFYCSNLFEDLTKLLSKNAFPVSGQ--LYTTHLLSLEALLTVID 596          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Zebrafish
Match: gbf1 (golgi brefeldin A resistant guanine nucleotide exchange factor 1 [Source:ZFIN;Acc:ZDB-GENE-081107-54])

HSP 1 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 427/1128 (37.85%), Postives = 618/1128 (54.79%), Query Frame = 1
Query: 1933 KKRIIKIGTEKFNNDIKDGIKYLREQGFCQT---NQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGN-VEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE----AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQRNQ--EDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELY--------KTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCV----KSSLNKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDELHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEW----------NNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAG--QLLKLTCDRLYTFLPDLVEELFYEPLLP 5214
            KK+++  GTE+FN   K GI+ L+E+G   +   N E+A   RENPRL+K  IGE+I  R N  + + ++  F F+GLR+D A+R++L+ FRLPGEA  I  +LE F   +H  N       D+ F L YA++MLN DQHN N +KQ  PMT+EQFK+NL   N     GN  ++++L  IY AIK EEIVMP EQ G++K+NY+W  LL R  ++   ++     ++  +LF++ W   + A  YVF+  +D  I      G  +CA I+A+Y   ++ D +II + K+T  SS  E++E     FG N K ++AAK++F +A +HGDILRDGWKN++D +L LF+A+LLPK + EV+DF+  ++ I L  E+    + E+ +V+S  F S  +    SG R    E++  K  AL  I +C    L  E++FL+  SL E + ALI                          +++ D  ++    DE+   FCLE+++R++L N DR++     + DH Y + + +    FL+ER VV  LRLAI+LLR+++   QV   L +L + K  VL  V+  V  GLH+L+  +AANI S  DW  L +++E  G G K  P    +  N       T+    + + +D  S+LS Y     E+  S+D                    RGYTSDSE+Y          +  ++D   W++V   +D +   K+A      V    K  +    P+VNQY++ L        D  ++ K  + LS++VRD AH+TP NFE CV  +RVF E  +    ++   KKS  ++ +     K PR +   +  TK +   P     SH     S+DE    + A     +++  LLDLMHTLH RAA IY  W             I  DS+    LW +CWCPLLQGMA LCCD R +VR  A+T+LQR+LL   L +L   +WE CF KVLFPLL+  LENI S +D +    +T     RMRA  +L+KVFLQHL  L  L TF ALWLTIL++MD YM A ++ D L +A+ ESLKN+LLVM T      I   ++S  G   L ++T +R+  FLP L EELF + ++P
Sbjct:  586 KKKLLITGTEQFNQKPKKGIQTLQEKGLLSSPMDNNEVAQWLRENPRLDKKMIGEFISDRRNTDLLDSFVNTFTFQGLRIDEALRLYLEAFRLPGEAPVIHRLLETFTDNWHKVNGNPFQTNDAGFALAYAVIMLNTDQHNHNVRKQNIPMTLEQFKKNLKGVNG----GNDFDQDMLEDIYNAIKNEEIVMPDEQTGLVKENYVWSVLLHRGASAEGMFLHVPDGSYDRDLFSMTWGPTIAALSYVFDKSLDDTIIEKAIAGFRKCAMISAHYGFSDVFDNLIISLCKFTTLSS--ESVENLPTVFGSNRKAQVAAKTVFSLAHRHGDILRDGWKNIMDSMLQLFRAELLPKTMVEVEDFLDPNEKISLQREETPSNRGES-AVLS--FVSWLTLSEQSGLRGPSTENQEAKQAALLCIKQCDPEKLNTESKFLQLESLQELMKALI--------------------------SVTPDEETY----DEEDAAFCLEMLLRIILENRDRVSCVWQTVRDHLYQLCVHANESCFLVERAVVGLLRLAIRLLRREDIGSQVLLSLRLLLMMKPHVLSRVSREVAYGLHELLKTNAANIHSTDDWYTLFSLLECIGAGIK--PPAALQFAN-------TNPDNDTGAQSD--SELSSYH--QSEV--SLD--------------------RGYTSDSEIYNEHGKSRIPRSATDVD-VGWLVV--GKDDLDGAKAA------VTTPSKPMN---HPLVNQYSLTLGQ-DMGLHDTKSLIKCVDSLSFIVRDAAHVTPENFELCVKAIRVFVEASLNGGYRTHEKKKSHKYDSKSSRLRKKPREKEGASRRTKASSQRP---ARSH-----SDDEEEEGVPASYH--TVSFQLLDLMHTLHTRAAGIYSSWAEEQRHLEDAGKKIEADSQT---LWTSCWCPLLQGMAWLCCDARRQVRMQALTYLQRALLVHDLQTLDAVEWESCFNKVLFPLLTKLLENI-SPAD-VGGMEET-----RMRACTLLSKVFLQHLSPLLSLPTFAALWLTILDFMDKYMHAGSS-DLLLEAIPESLKNMLLVMDTA----GIFHSADSRTGYSDLWEITWERIVCFLPRLKEELFKQAVIP 1601          

HSP 2 Score: 269.626 bits (688), Expect = 2.631e-72
Identity = 176/494 (35.63%), Postives = 273/494 (55.26%), Query Frame = 1
Query:  415 VANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTRIRKNNLTINMDXXXXXXXXXXXXXIPIPSESHSDTSHPPEDSCSDEIIVTPNTSNSKDEASEIISN--------DIDSEKKLDYP--LTAAESNEDISVNNEIEPLADDTDSQVLFDLTRIESNCTINFEPSGNPELSSLNIKSDNIQYRTENGIV-----------FKSDLSGAADNSDNENATCKGSKSEKLPLKSKTQSTTTPYGLACVQKLLSNLILILSPENIFHTN-HVRTGLTLITAAFESG--ADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMIN 1824
            +A+ VT+ +F+GTD +SDEV+LMKIL++L TL+  P G  +++ +VC+I+ SCFRICFE +LSELLR +AE TL  +V LLF+RLP+ KE+    K+ +  NM    + +            +    +  PP       ++ +P+      ++S + +N        +  S     +P   +AA S    + ++ ++  +  T  + L DL +  S  T    PS  P       +   ++ R ++  V             +D S +A   D +    +G +  +     K  +   PYGL C+++L   LI + +P +  +++  +  GL L+  A E+   A Y S     LL  +++EL ++ I LL  DR++ + AS RVCFL+FESMR HLKFQLEMYL +L+ II S+N  +PYE +E+ALE+IVQLWRIPSF+TELY+NYDCD YCS+L  +L  L  K A P      L  T +++L+ALL +I+
Sbjct:    1 MADAVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFSRLPQFKEEA---KSYVGTNMKKLKMRAGGMSESS---KWKKQKRSPRPPR-----HMVRSPSGQMDPAQSSTLTNNLSGGVPFIEQHSGGSSTFPGSDSAASSISSPTTDSGLDTGSKTTSKEDLTDLDQNSSTATTPITPSAEPGRLESQSEGRGVE-RAQSASVESIPEVLEDRDLLADQSDSASVHDMDYVNPRGVRFTQS--TQKEGAALIPYGLPCLRELFRFLISLTNPHDRHNSDVMMHMGLQLLNVALEAAHIAPYQS-----LLGLVKDELCRHLIQLLGVDRMNLYTASIRVCFLLFESMREHLKFQLEMYLKKLMDIITSENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDFYCSNLFEDLTKLLSKNAFPVSGQ--LYTTHLLSLEALLTVID 473          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Zebrafish
Match: gbf1 (golgi brefeldin A resistant guanine nucleotide exchange factor 1 [Source:ZFIN;Acc:ZDB-GENE-081107-54])

HSP 1 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 427/1128 (37.85%), Postives = 618/1128 (54.79%), Query Frame = 1
Query: 1933 KKRIIKIGTEKFNNDIKDGIKYLREQGFCQT---NQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGN-VEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE----AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQRNQ--EDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELY--------KTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCV----KSSLNKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDELHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEW----------NNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAG--QLLKLTCDRLYTFLPDLVEELFYEPLLP 5214
            KK+++  GTE+FN   K GI+ L+E+G   +   N E+A   RENPRL+K  IGE+I  R N  + + ++  F F+GLR+D A+R++L+ FRLPGEA  I  +LE F   +H  N       D+ F L YA++MLN DQHN N +KQ  PMT+EQFK+NL   N     GN  ++++L  IY AIK EEIVMP EQ G++K+NY+W  LL R  ++   ++     ++  +LF++ W   + A  YVF+  +D  I      G  +CA I+A+Y   ++ D +II + K+T  SS  E++E     FG N K ++AAK++F +A +HGDILRDGWKN++D +L LF+A+LLPK + EV+DF+  ++ I L  E+    + E+ +V+S  F S  +    SG R    E++  K  AL  I +C    L  E++FL+  SL E + ALI                          +++ D  ++    DE+   FCLE+++R++L N DR++     + DH Y + + +    FL+ER VV  LRLAI+LLR+++   QV   L +L + K  VL  V+  V  GLH+L+  +AANI S  DW  L +++E  G G K  P    +  N       T+    + + +D  S+LS Y     E+  S+D                    RGYTSDSE+Y          +  ++D   W++V   +D +   K+A      V    K  +    P+VNQY++ L        D  ++ K  + LS++VRD AH+TP NFE CV  +RVF E  +    ++   KKS  ++ +     K PR +   +  TK +   P     SH     S+DE    + A     +++  LLDLMHTLH RAA IY  W             I  DS+    LW +CWCPLLQGMA LCCD R +VR  A+T+LQR+LL   L +L   +WE CF KVLFPLL+  LENI S +D +    +T     RMRA  +L+KVFLQHL  L  L TF ALWLTIL++MD YM A ++ D L +A+ ESLKN+LLVM T      I   ++S  G   L ++T +R+  FLP L EELF + ++P
Sbjct:  586 KKKLLITGTEQFNQKPKKGIQTLQEKGLLSSPMDNNEVAQWLRENPRLDKKMIGEFISDRRNTDLLDSFVNTFTFQGLRIDEALRLYLEAFRLPGEAPVIHRLLETFTDNWHKVNGNPFQTNDAGFALAYAVIMLNTDQHNHNVRKQNIPMTLEQFKKNLKGVNG----GNDFDQDMLEDIYNAIKNEEIVMPDEQTGLVKENYVWSVLLHRGASAEGMFLHVPDGSYDRDLFSMTWGPTIAALSYVFDKSLDDTIIEKAIAGFRKCAMISAHYGFSDVFDNLIISLCKFTTLSS--ESVENLPTVFGSNRKAQVAAKTVFSLAHRHGDILRDGWKNIMDSMLQLFRAELLPKTMVEVEDFLDPNEKISLQREETPSNRGES-AVLS--FVSWLTLSEQSGLRGPSTENQEAKQAALLCIKQCDPEKLNTESKFLQLESLQELMKALI--------------------------SVTPDEETY----DEEDAAFCLEMLLRIILENRDRVSCVWQTVRDHLYQLCVHANESCFLVERAVVGLLRLAIRLLRREDIGSQVLLSLRLLLMMKPHVLSRVSREVAYGLHELLKTNAANIHSTDDWYTLFSLLECIGAGIK--PPAALQFAN-------TNPDNDTGAQSD--SELSSYH--QSEV--SLD--------------------RGYTSDSEIYNEHGKSRIPRSATDVD-VGWLVV--GKDDLDGAKAA------VTTPSKPMN---HPLVNQYSLTLGQ-DMGLHDTKSLIKCVDSLSFIVRDAAHVTPENFELCVKAIRVFVEASLNGGYRTHEKKKSHKYDSKSSRLRKKPREKEGASRRTKASSQRP---ARSH-----SDDEEEEGVPASYH--TVSFQLLDLMHTLHTRAAGIYSSWAEEQRHLEDAGKKIEADSQT---LWTSCWCPLLQGMAWLCCDARRQVRMQALTYLQRALLVHDLQTLDAVEWESCFNKVLFPLLTKLLENI-SPAD-VGGMEET-----RMRACTLLSKVFLQHLSPLLSLPTFAALWLTILDFMDKYMHAGSS-DLLLEAIPESLKNMLLVMDTA----GIFHSADSRTGYSDLWEITWERIVCFLPRLKEELFKQAVIP 1601          

HSP 2 Score: 269.626 bits (688), Expect = 2.631e-72
Identity = 176/494 (35.63%), Postives = 273/494 (55.26%), Query Frame = 1
Query:  415 VANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTRIRKNNLTINMDXXXXXXXXXXXXXIPIPSESHSDTSHPPEDSCSDEIIVTPNTSNSKDEASEIISN--------DIDSEKKLDYP--LTAAESNEDISVNNEIEPLADDTDSQVLFDLTRIESNCTINFEPSGNPELSSLNIKSDNIQYRTENGIV-----------FKSDLSGAADNSDNENATCKGSKSEKLPLKSKTQSTTTPYGLACVQKLLSNLILILSPENIFHTN-HVRTGLTLITAAFESG--ADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMIN 1824
            +A+ VT+ +F+GTD +SDEV+LMKIL++L TL+  P G  +++ +VC+I+ SCFRICFE +LSELLR +AE TL  +V LLF+RLP+ KE+    K+ +  NM    + +            +    +  PP       ++ +P+      ++S + +N        +  S     +P   +AA S    + ++ ++  +  T  + L DL +  S  T    PS  P       +   ++ R ++  V             +D S +A   D +    +G +  +     K  +   PYGL C+++L   LI + +P +  +++  +  GL L+  A E+   A Y S     LL  +++EL ++ I LL  DR++ + AS RVCFL+FESMR HLKFQLEMYL +L+ II S+N  +PYE +E+ALE+IVQLWRIPSF+TELY+NYDCD YCS+L  +L  L  K A P      L  T +++L+ALL +I+
Sbjct:    1 MADAVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFSRLPQFKEEA---KSYVGTNMKKLKMRAGGMSESS---KWKKQKRSPRPPR-----HMVRSPSGQMDPAQSSTLTNNLSGGVPFIEQHSGGSSTFPGSDSAASSISSPTTDSGLDTGSKTTSKEDLTDLDQNSSTATTPITPSAEPGRLESQSEGRGVE-RAQSASVESIPEVLEDRDLLADQSDSASVHDMDYVNPRGVRFTQS--TQKEGAALIPYGLPCLRELFRFLISLTNPHDRHNSDVMMHMGLQLLNVALEAAHIAPYQS-----LLGLVKDELCRHLIQLLGVDRMNLYTASIRVCFLLFESMREHLKFQLEMYLKKLMDIITSENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDFYCSNLFEDLTKLLSKNAFPVSGQ--LYTTHLLSLEALLTVID 473          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Zebrafish
Match: arfgef2 (ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited) [Source:ZFIN;Acc:ZDB-GENE-090312-50])

HSP 1 Score: 151.754 bits (382), Expect = 4.743e-36
Identity = 148/586 (25.26%), Postives = 263/586 (44.88%), Query Frame = 1
Query: 1429 LSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVI-------ALDALLFMINCINSRKDDL------------NRAIYYDS-------------------ESSETNPEKKIKLTNPMLY-----KKRIIKIGTEKFNNDIKDGIKYLREQGFCQTNQE-LASLFRENPRLNKTFIGEYICTRNNVGVREE----YIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSN--PEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMP------------------SEQRGIIKDNYL------WRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCA-SIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLL 2961
            LSKN +    S     F  S  +   +    + HLK Q+E++  R I + I +  +  +E++ + ++++ ++      + ++Y+NYDCDL  +++   L +   KIA   RS + L  T +         L+ L+ ++ C+     D+             R    DS                   +S+ ++  ++ +  +P  Y     +K II+ G E FN   K G++YL+EQG   T+ E +A   ++  RL+ T +GE++    NV   +E    Y+   +F G     A+R FL+ FRLPGEA  I  ++E FA  Y   N    + +  D+ +VL Y+I+ML  D H+P  K +   MT EQ+ +     N  K   ++ EE L+ IY+ I  ++I M                    +QR ++ +  +       + L+     + A + SA +  H   +F L W   + AF    + + D     S+ +   +CA  IA  +N+    D  I  ++++T+ ++S    E   KN  T    K++  +A   G+ L + W  +L C+  L  A+L+
Sbjct:  496 LSKNGV----SSVPEVFELSLAIFLTLLSHFKVHLKMQIEVFF-REIFLTILETSSSSFEHKWMVIQTLTRICADAQCVVDIYVNYDCDLNAANIFERLVNDLSKIAQ-GRSGQELGMTPLQELSLRKKGLECLVSILKCMVEWSRDMYVNPNLQANLGQERPAEGDSADVKLSEHLSSRRDSVSSLDSTVSSGVQQSQPDHPEQYEVIKQQKEIIEHGIELFNKKPKRGLQYLQEQGMLGTSPEDIAQFLQQEERLDTTQVGEFLG--ENVKFNKEVMYCYVDRLDFCGKDFVSALRAFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQVKNK---MTKEQYIKMNRGINDSK---DLPEEYLSSIYDEIAGKKIAMKESKEYSITPKSSKQNVANEKQRRLLYNMEMEQMAKTAKALMEAVSHAQAPFFSATHLEHVRPMFKLAWTPLLAAFSVGLQ-DCDDQDVASLCLEGIRCAIRIACIFNMQLERDAYIQALARFTLLTASSSITEMKQKNIDT---IKTLIMVAHTDGNYLGNSWHEILRCISQLELAQLI 1063          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Zebrafish
Match: arfgef2 (ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited) [Source:ZFIN;Acc:ZDB-GENE-090312-50])

HSP 1 Score: 151.369 bits (381), Expect = 4.967e-36
Identity = 148/586 (25.26%), Postives = 263/586 (44.88%), Query Frame = 1
Query: 1429 LSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQV-------IALDALLFMINCINSRKDDL------------NRAIYYDS-------------------ESSETNPEKKIKLTNPMLY-----KKRIIKIGTEKFNNDIKDGIKYLREQGFCQTNQE-LASLFRENPRLNKTFIGEYICTRNNVGVREE----YIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSN--PEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMP------------------SEQRGIIKDNYL------WRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCA-SIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLL 2961
            LSKN +    S     F  S  +   +    + HLK Q+E++  R I + I +  +  +E++ + ++++ ++      + ++Y+NYDCDL  +++   L +   KIA   RS + L  T +         L+ L+ ++ C+     D+             R    DS                   +S+ ++  ++ +  +P  Y     +K II+ G E FN   K G++YL+EQG   T+ E +A   ++  RL+ T +GE++    NV   +E    Y+   +F G     A+R FL+ FRLPGEA  I  ++E FA  Y   N    + +  D+ +VL Y+I+ML  D H+P  K +   MT EQ+ +     N  K   ++ EE L+ IY+ I  ++I M                    +QR ++ +  +       + L+     + A + SA +  H   +F L W   + AF    + + D     S+ +   +CA  IA  +N+    D  I  ++++T+ ++S    E   KN  T    K++  +A   G+ L + W  +L C+  L  A+L+
Sbjct:  486 LSKNGV----SSVPEVFELSLAIFLTLLSHFKVHLKMQIEVFF-REIFLTILETSSSSFEHKWMVIQTLTRICADAQCVVDIYVNYDCDLNAANIFERLVNDLSKIAQ-GRSGQELGMTPLQELSLRKKGLECLVSILKCMVEWSRDMYVNPNLQANLGQERPAEGDSADVKLSEHLSSRRDSVSSLDSTVSSGVQQSQPDHPEQYEVIKQQKEIIEHGIELFNKKPKRGLQYLQEQGMLGTSPEDIAQFLQQEERLDTTQVGEFLG--ENVKFNKEVMYCYVDRLDFCGKDFVSALRAFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQVKNK---MTKEQYIKMNRGINDSK---DLPEEYLSSIYDEIAGKKIAMKESKEYSITPKSSKQNVANEKQRRLLYNMEMEQMAKTAKALMEAVSHAQAPFFSATHLEHVRPMFKLAWTPLLAAFSVGLQ-DCDDQDVASLCLEGIRCAIRIACIFNMQLERDAYIQALARFTLLTASSSITEMKQKNIDT---IKTLIMVAHTDGNYLGNSWHEILRCISQLELAQLI 1053          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Xenopus
Match: or11l1.18 (olfactory receptor class II (xb178 gene) [Source:Xenbase;Acc:XB-GENE-5795351])

HSP 1 Score: 1000.35 bits (2585), Expect = 0.000e+0
Identity = 658/1807 (36.41%), Postives = 976/1807 (54.01%), Query Frame = 1
Query:   85 YVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTR--IRKN-----NLTINMDXXXXXXXXXXXXXIPIPSESHSDTSHPPEDSCSDEIIV--TPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNEDISVNNEIEPLADDTDSQVLFDLTRIESNCTINFEPSGNPELSSLNIKSDNIQYRTENGI-------VFKSDLSGAADNSDNENATCKG------SKSEKLPLKSKTQSTTTPYGLACVQKLLSNLILILSPENIFHTN-HVRTGLTLITAAFESGA--DYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINSR-------------------KDDLNRAIYYDSESSETNPEKKIKLTNPMLYKKRIIKI-----------------GTEKFNNDIKDGIKYLREQGFCQT---NQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE----AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQR-NQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKL-SDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELY-----------KTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSL-NKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDE----LHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEW----------NNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAG--QLLKLTCDRLYTFLPDLVEELFYEPLL 5211
            Y+VQ EI++++ AIKR  + S+     EE  DPL  + S LK  L+ I +LSE++P  FL PFL+VI S +  G ITGLALT+V KFLS+  ID S    ++G    IE +A+ VT+ +F+GTD +SDEV+LMKIL++L TL+  P G  +++ +VC+I+ SCFRICFE +LSELLR +AE TL  +V LLF+RLP+ KE+ +  I  N     N+ IN       S    ++K       H   +    +  S + +V  T  T+N   E   I ++  D+    ++P++   S    +V      ++  TDS V               +P+ +P LS  ++   +    +   I       V  +D S +A   D +    +G      S+ E L L         PYGL C+++L   LI + +P +  ++   +  GL LIT A ES    +Y+S     LL  +++EL ++   LL  +RL+ +AAS R CFL+FE MR HLKFQLEMY+ +L+ II  +N  +PYE +E+ALE+IVQLWRIPSF+TELY+NYDCD YCS+L  +L  L  K A P      L  T +++L+ALL +I+   S                      DL+         +  N   K   +  ++  K  + +                 GTE+FN   K G+++L+E+    T   N E+A   RENPRL+K  IGE++  R N+ + E ++  F+F+GLR+D A+R++L+ FRLPGEA  IQ +LE F + +  SN    +  D+ F L YA++MLN DQHN N +KQ  PMT+E+F++NL   N  K +   ++++L  IY AIK EEIVMP EQ G++K+NY W  LL R  T    ++  D  ++ ++LF + W   + A  YVF+  MD  I      G  +CA I+A+Y L ++ D +II + K+T  SS  E +E     FG N K ++AAK++F ++ +HGDILR+GWKN++D +L LF+A+LLPK + EV+DF+  +  I L  E+    + E+  +    + +L+ ++ SS +  + E++  K  AL  I  C    LI E++FL+  SL E + ALI                          +++ D  ++    DE+   FCLE++MR++L N DR+      + DH Y + + +V   FL+ER VV  LRLAI+LLR++E   QV   L IL + K +VL  V+  V  G+H+L+  +AANI S  DW  L  ++E  G G K  P                +L  +++++ND  ++  S+  S H    N +D                    RGYTSDSE+Y             T  ++ ++ W++V   ++ V  +K A  I + V +            VNQY++ +    F   D  ++ KS E LS++VRD AH+TP NFE CV T+RVF E  +     +++  + N +Y       + ++    N+ +        +   +SD D EDE     ++ +S Q     ++ +LLDLMHTLH RAA IY  W             I+ DS+    LW NCWCPLLQG+A LCCD R +VR  A+T+LQR+LL   L +L   +WE CF KVLFPLL+  LENI S +D +    +T     RMR   +L+KVFLQHL  L  LSTF ALWLTIL++MD YM A ++ D L +A+ ESLKN+LLVM T      I   ++S  G   L ++T +R+  FLP L EELF + ++
Sbjct:    7 YIVQGEISIVVGAIKRNARWSMHTPVDEE-QDPLLHSFSVLKEVLNNIKELSEIEPNVFLRPFLEVIRSEDTTGPITGLALTSVNKFLSYALIDPSHEGTAEG----IENMADAVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFSRLPQFKEEAKSYIGTNMKKVYNMIINNSGGMSDSSKWKKQKKSPRQPRHVTKAMAAAEPSSQQPVVNGTTITTNLTGEVPFIDASSPDA----NFPISGVSSEATSAV------VSPTTDSGVDMSSQATSKEDLSELDPA-SPSLSIEDLMERHTYSASVESIPEVLDDNVSLADQSDSASVHDMDYVNPRGVRFTQSSQKEGLLL-------ILPYGLPCIRELFRFLISLTNPHDRHNSEVMIHMGLQLITVALESAPIENYVS-----LLGLVKDELCRHLFQLLSIERLNLYAASLRACFLLFEGMREHLKFQLEMYIKKLMDIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYCSNLFEDLTKLLSKNAFPVSGQ--LYTTHLLSLEALLTVIDSTESHCQAKNLSNVSQDKKETGKPSGDLSEGTKDSGNRNAENNGSKPPTSGHLMADKMTLGVQETEYSTDGGKFNLLITGTEQFNQKPKKGVQFLQEKDLLATPMDNAEVAQWLRENPRLDKKMIGEFVSDRKNLDLLESFVGTFHFQGLRVDEALRLYLEAFRLPGEAPVIQRLLEAFTEHWRKSNGTPFAHSDACFALAYAVIMLNTDQHNHNVRKQNVPMTLEEFRKNLKGVNGGKDF---DQDMLEDIYHAIKNEEIVMPEEQTGLVKENYFWNVLLHRGATPEGMFLHVDPGSYDHDLFTMTWGPTIAALSYVFDKSMDETIIQKAISGFRKCAMISAHYGLSDVFDNLIISLCKFTTLSS--EAVENLPTVFGSNLKAQIAAKTVFHLSHRHGDILREGWKNIMDSMLQLFRAELLPKAMVEVEDFVDPNGKISLQREEIPANRGESTVLSFVSWLTLSGTEQSSLRGPSTENQEAKKLALECIKLCDPEKLITESKFLQLESLQELMKALI--------------------------SVTPDEETY----DEEDAAFCLEMLMRIVLENRDRVGCVWQAVRDHLYRLCVHAVEFCFLVERAVVGLLRLAIRLLRREEISGQVILSLRILLMMKPTVLSKVSRQVAFGVHELLKTNAANIHSSNDWYTLFCLLECIGAGVKPPP----------------ALQVTTRADNDTGAQSDSEVSSYHPSEVN-LD--------------------RGYTSDSEVYAEHSKQSKMHRSVTDVDMMNSGWLMV--GKEDVDSSKVATVINKPVANAP----------VNQYSLTIGL-DFGPHDTKSLMKSVESLSFIVRDAAHVTPENFELCVKTIRVFVEASLNGGYKSQEKRVKNHKYDSKSNRFKKKTKEKENSVRRTRASNQRQYRSHSD-DEEDESVPASYHTVSLQ-----VSHDLLDLMHTLHTRAATIYSSWAEEQRNLETAAEKITADSK---TLWSNCWCPLLQGIAWLCCDARRQVRMQALTYLQRALLVHDLQALDALEWESCFNKVLFPLLTKLLENI-SPAD-VGGMEET-----RMRGSTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHAGSS-DLLPEAIPESLKNMLLVMDTA----GIFHSADSRTGYSDLWEITWERIDCFLPRLREELFKQTVI 1677          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Xenopus
Match: or11l1.18 (olfactory receptor class II (xb178 gene) [Source:Xenbase;Acc:XB-GENE-5795351])

HSP 1 Score: 997.653 bits (2578), Expect = 0.000e+0
Identity = 660/1796 (36.75%), Postives = 985/1796 (54.84%), Query Frame = 1
Query:   85 YVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTR--IRKNNLTINMDXXXXXXXXXXXXXIPIPSES-HSDTSHPPEDSCSDEIIV--TPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNEDISVNNEIEPLADDTDSQVLF--DLTRIESNCTINFEPSGNPE-LSSLNIKSDNIQYRTENGIVFK-----------SDLSGAADNSDNENATCKGSKSEKLPLKSKTQSTTTPYGLACVQKLLSNLILILSPENIFHTN-HVRTGLTLITAAFESGA--DYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINSR------------KDDLNRAIYYDSESSE--TNPEKK--------------IKLTNPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQT---NQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE----AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQR-NQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKL-SDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELY-----------KTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSL-NKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDE----LHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEW----------NNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAG--QLLKLTCDRLYTFLPDLVEELFYEPLL 5211
            Y+VQ EI++++ AIKR  + S+     EE  DPL  + S LK  L+ I +LSE++P  FL PFL+VI S +  G ITGLALT+V KFLS+  ID S    ++G    IE +A+ VT+ +F+GTD +SDEV+LMKIL++L TL+  P G  +++ +VC+I+ SCFRICFE +LSELLR +AE TL  +V LLF+RLP+ KE+ +  I  N   + M    +S  S+ +++   P +  H   +    +  S + +V  T  T+N   E   I ++  D+    ++P++   S    +V +       D  SQ     DL+ ++        PS + E LS L +    ++  T +  V             +D S +A   D +    +G +  +   K  T     PYGL C+++L   LI + +P +  ++   +  GL LIT A ES    +Y+S     LL  +++EL ++   LL  +RL+ +AAS R CFL+FE MR HLKFQLEMY+ +L+ II  +N  +PYE +E+ALE+IVQLWRIPSF+TELY+NYDCD YCS+L  +L  L  K A P      L  T +++L+ALL +I+   S             K +  +     SE ++   N EKK              ++  N +  KK+++  GTE+FN   K G+++L+E+    T   N E+A   RENPRL+K  IGE++  R N+ + E +  +  +  LR+D A+R++L+ FRLPGEA  IQ +LE F + +  SN    +  D+ F L YA++MLN DQHN N +KQ  PMT+E+F++NL   N  K +   ++++L  IY AIK EEIVMP EQ G++K+NY W  LL R  T    ++  D  ++ ++LF + W   + A  YVF+  MD  I      G  +CA I+A+Y L ++ D +II + K+T  SS  E +E     FG N K ++AAK++F ++ +HGDILR+GWKN++D +L LF+A+LLPK + EV+DF+  +  I L  E+    + E+  +    + +L+ ++ SS +  + E++  K  AL  I  C    LI E++FL+  SL E + ALI                          +++ D  ++    DE+   FCLE++MR++L N DR+      + DH Y + + +V   FL+ER VV  LRLAI+LLR++E   QV   L IL + K +VL  V+  V  G+H+L+  +AANI S  DW  L  ++E  G G K  P                +L  +++++ND  ++  S+  S H    N +D                    RGYTSDSE+Y             T  ++ ++ W++V   ++ V  +K A  I + V +            VNQY++ +    F   D  ++ KS E LS++VRD AH+TP NFE CV T+RVF E  +     +++  + N +Y       + ++    N+ +        +   +SD D EDE     ++ +S Q     ++ +LLDLMHTLH RAA IY  W             I+ DS+    LW NCWCPLLQG+A LCCD R +VR  A+T+LQR+LL   L +L   +WE CF KVLFPLL+  LENI S +D +    +T     RMR   +L+KVFLQHL  L  LSTF ALWLTIL++MD YM A ++ D L +A+ ESLKN+LLVM T      I   ++S  G   L ++T +R+  FLP L EELF + ++
Sbjct:    7 YIVQGEISIVVGAIKRNARWSMHTPVDEE-QDPLLHSFSVLKEVLNNIKELSEIEPNVFLRPFLEVIRSEDTTGPITGLALTSVNKFLSYALIDPSHEGTAEG----IENMADAVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFSRLPQFKEEAKSYIGTNMKKLKMRAGGMSDSSKWKKQKKSPRQPRHVTKAMAAAEPSSQQPVVNGTTITTNLTGEVPFIDASSPDA----NFPISGVSSEATSAVVSPTTDSGVDMSSQATSKEDLSELDPAS-----PSLSKEKLSHLGVPKYLMERHTYSASVESIPEVLDDNVSLADQSDSASVHDMDYVNPRGVRFTQSSQKEGT--VLVPYGLPCIRELFRFLISLTNPHDRHNSEVMIHMGLQLITVALESAPIENYVS-----LLGLVKDELCRHLFQLLSIERLNLYAASLRACFLLFEGMREHLKFQLEMYIKKLMDIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYCSNLFEDLTKLLSKNAFPVSGQ--LYTTHLLSLEALLTVIDSTESHCQAKNLSNVSQDKKETGKPSGDLSEGTKDSGNREKKTLKKPQRFSCLLPNVQELNDIKTKKKLLITGTEQFNQKPKKGVQFLQEKDLLATPMDNAEVAQWLRENPRLDKKMIGEFVSDRKNLDLLESFFFVAAY-CLRVDEALRLYLEAFRLPGEAPVIQRLLEAFTEHWRKSNGTPFAHSDACFALAYAVIMLNTDQHNHNVRKQNVPMTLEEFRKNLKGVNGGKDF---DQDMLEDIYHAIKNEEIVMPEEQTGLVKENYFWNVLLHRGATPEGMFLHVDPGSYDHDLFTMTWGPTIAALSYVFDKSMDETIIQKAISGFRKCAMISAHYGLSDVFDNLIISLCKFTTLSS--EAVENLPTVFGSNLKAQIAAKTVFHLSHRHGDILREGWKNIMDSMLQLFRAELLPKAMVEVEDFVDPNGKISLQREEIPANRGESTVLSFVSWLTLSGTEQSSLRGPSTENQEAKKLALECIKLCDPEKLITESKFLQLESLQELMKALI--------------------------SVTPDEETY----DEEDAAFCLEMLMRIVLENRDRVGCVWQAVRDHLYRLCVHAVEFCFLVERAVVGLLRLAIRLLRREEISGQVILSLRILLMMKPTVLSKVSRQVAFGVHELLKTNAANIHSSNDWYTLFCLLECIGAGVKPPP----------------ALQVTTRADNDTGAQSDSEVSSYHPSEVN-LD--------------------RGYTSDSEVYAEHSKQSKMHRSVTDVDMMNSGWLMV--GKEDVDSSKVATVINKPVANAP----------VNQYSLTIGL-DFGPHDTKSLMKSVESLSFIVRDAAHVTPENFELCVKTIRVFVEASLNGGYKSQEKRVKNHKYDSKSNRFKKKTKEKENSVRRTRASNQRQYRSHSD-DEEDESVPASYHTVSLQ-----VSHDLLDLMHTLHTRAATIYSSWAEEQRNLETAAEKITADSK---TLWSNCWCPLLQGIAWLCCDARRQVRMQALTYLQRALLVHDLQALDALEWESCFNKVLFPLLTKLLENI-SPAD-VGGMEET-----RMRGSTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHAGSS-DLLPEAIPESLKNMLLVMDTA----GIFHSADSRTGYSDLWEITWERIDCFLPRLREELFKQTVI 1672          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Xenopus
Match: or11l1.18 (olfactory receptor class II (xb178 gene) [Source:Xenbase;Acc:XB-GENE-5795351])

HSP 1 Score: 997.653 bits (2578), Expect = 0.000e+0
Identity = 658/1790 (36.76%), Postives = 981/1790 (54.80%), Query Frame = 1
Query:   85 YVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTR--IRKNNLTINMDXXXXXXXXXXXXXIPIPSES-HSDTSHPPEDSCSDEIIV--TPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNEDISVNNEIEPLADDTDSQVLF--DLTRIE--SNCTINFEPSGNPELSSLNIKSDNIQYRTENGIVFKSDLSGAADNSDN---ENATCKGSKSEKLPLKSKTQSTT-TPYGLACVQKLLSNLILILSPENIFHTN-HVRTGLTLITAAFESGA--DYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINSR------------KDDLNRAIYYDSESSE--TNPEKK--------------IKLTNPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQT---NQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE----AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQR-NQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKL-SDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELY-----------KTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSL-NKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDE----LHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEW----------NNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAG--QLLKLTCDRLYTFLPDLVEELFYEPLL 5211
            Y+VQ EI++++ AIKR  + S+     EE  DPL  + S LK  L+ I +LSE++P  FL PFL+VI S +  G ITGLALT+V KFLS+  ID S    ++G    IE +A+ VT+ +F+GTD +SDEV+LMKIL++L TL+  P G  +++ +VC+I+ SCFRICFE +LSELLR +AE TL  +V LLF+RLP+ KE+ +  I  N   + M    +S  S+ +++   P +  H   +    +  S + +V  T  T+N   E   I ++  D+    ++P++   S    +V +       D  SQ     DL+ ++  S      + SG+  LS             E+      D    AD SD+    +      +  +    S+ + T   PYGL C+++L   LI + +P +  ++   +  GL LIT A ES    +Y+S     LL  +++EL ++   LL  +RL+ +AAS R CFL+FE MR HLKFQLEMY+ +L+ II  +N  +PYE +E+ALE+IVQLWRIPSF+TELY+NYDCD YCS+L  +L  L  K A P      L  T +++L+ALL +I+   S             K +  +     SE ++   N EKK              ++  N +  KK+++  GTE+FN   K G+++L+E+    T   N E+A   RENPRL+K  IGE++  R N+ + E +  +  +  LR+D A+R++L+ FRLPGEA  IQ +LE F + +  SN    +  D+ F L YA++MLN DQHN N +KQ  PMT+E+F++NL   N  K +   ++++L  IY AIK EEIVMP EQ G++K+NY W  LL R  T    ++  D  ++ ++LF + W   + A  YVF+  MD  I      G  +CA I+A+Y L ++ D +II + K+T  SS  E +E     FG N K ++AAK++F ++ +HGDILR+GWKN++D +L LF+A+LLPK + EV+DF+  +  I L  E+    + E+  +    + +L+ ++ SS +  + E++  K  AL  I  C    LI E++FL+  SL E + ALI                          +++ D  ++    DE+   FCLE++MR++L N DR+      + DH Y + + +V   FL+ER VV  LRLAI+LLR++E   QV   L IL + K +VL  V+  V  G+H+L+  +AANI S  DW  L  ++E  G G K  P                +L  +++++ND  ++  S+  S H    N +D                    RGYTSDSE+Y             T  ++ ++ W++V   ++ V  +K A  I + V +            VNQY++ +    F   D  ++ KS E LS++VRD AH+TP NFE CV T+RVF E  +     +++  + N +Y       + ++    N+ +        +   +SD D EDE     ++ +S Q     ++ +LLDLMHTLH RAA IY  W             I+ DS+    LW NCWCPLLQG+A LCCD R +VR  A+T+LQR+LL   L +L   +WE CF KVLFPLL+  LENI S +D +    +T     RMR   +L+KVFLQHL  L  LSTF ALWLTIL++MD YM A ++ D L +A+ ESLKN+LLVM T      I   ++S  G   L ++T +R+  FLP L EELF + ++
Sbjct:    7 YIVQGEISIVVGAIKRNARWSMHTPVDEE-QDPLLHSFSVLKEVLNNIKELSEIEPNVFLRPFLEVIRSEDTTGPITGLALTSVNKFLSYALIDPSHEGTAEG----IENMADAVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFSRLPQFKEEAKSYIGTNMKKLKMRAGGMSDSSKWKKQKKSPRQPRHVTKAMAAAEPSSQQPVVNGTTITTNLTGEVPFIDASSPDA----NFPISGVSSEATSAVVSPTTDSGVDMSSQATSKEDLSELDPASPSLSAIQQSGDICLSEQEQHQHTYSASVESIPEVLDDNVSLADQSDSASVHDMDYVNPRGVRFTQSSQKEGTVLVPYGLPCIRELFRFLISLTNPHDRHNSEVMIHMGLQLITVALESAPIENYVS-----LLGLVKDELCRHLFQLLSIERLNLYAASLRACFLLFEGMREHLKFQLEMYIKKLMDIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYCSNLFEDLTKLLSKNAFPVSGQ--LYTTHLLSLEALLTVIDSTESHCQAKNLSNVSQDKKETGKPSGDLSEGTKDSGNREKKTLKKPQRFSCLLPNVQELNDIKTKKKLLITGTEQFNQKPKKGVQFLQEKDLLATPMDNAEVAQWLRENPRLDKKMIGEFVSDRKNLDLLESFFFVAAY-CLRVDEALRLYLEAFRLPGEAPVIQRLLEAFTEHWRKSNGTPFAHSDACFALAYAVIMLNTDQHNHNVRKQNVPMTLEEFRKNLKGVNGGKDF---DQDMLEDIYHAIKNEEIVMPEEQTGLVKENYFWNVLLHRGATPEGMFLHVDPGSYDHDLFTMTWGPTIAALSYVFDKSMDETIIQKAISGFRKCAMISAHYGLSDVFDNLIISLCKFTTLSS--EAVENLPTVFGSNLKAQIAAKTVFHLSHRHGDILREGWKNIMDSMLQLFRAELLPKAMVEVEDFVDPNGKISLQREEIPANRGESTVLSFVSWLTLSGTEQSSLRGPSTENQEAKKLALECIKLCDPEKLITESKFLQLESLQELMKALI--------------------------SVTPDEETY----DEEDAAFCLEMLMRIVLENRDRVGCVWQAVRDHLYRLCVHAVEFCFLVERAVVGLLRLAIRLLRREEISGQVILSLRILLMMKPTVLSKVSRQVAFGVHELLKTNAANIHSSNDWYTLFCLLECIGAGVKPPP----------------ALQVTTRADNDTGAQSDSEVSSYHPSEVN-LD--------------------RGYTSDSEVYAEHSKQSKMHRSVTDVDMMNSGWLMV--GKEDVDSSKVATVINKPVANAP----------VNQYSLTIGL-DFGPHDTKSLMKSVESLSFIVRDAAHVTPENFELCVKTIRVFVEASLNGGYKSQEKRVKNHKYDSKSNRFKKKTKEKENSVRRTRASNQRQYRSHSD-DEEDESVPASYHTVSLQ-----VSHDLLDLMHTLHTRAATIYSSWAEEQRNLETAAEKITADSK---TLWSNCWCPLLQGIAWLCCDARRQVRMQALTYLQRALLVHDLQALDALEWESCFNKVLFPLLTKLLENI-SPAD-VGGMEET-----RMRGSTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHAGSS-DLLPEAIPESLKNMLLVMDTA----GIFHSADSRTGYSDLWEITWERIDCFLPRLREELFKQTVI 1673          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Xenopus
Match: or11l1.18 (olfactory receptor class II (xb178 gene) [Source:Xenbase;Acc:XB-GENE-5795351])

HSP 1 Score: 996.882 bits (2576), Expect = 0.000e+0
Identity = 656/1791 (36.63%), Postives = 982/1791 (54.83%), Query Frame = 1
Query:   85 YVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTR--IRKNNLTINMDXXXXXXXXXXXXXIPIPSES-HSDTSHPPEDSCSDEIIV--TPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNEDISVNNEIEPLADDTDSQVLF--DLTRIE-SNCTINFEPSGNPELSSLNIKSDNIQYRTENGI----------VFKSDLSGAADNSDNENATCKGSKSEKLPLKSKTQSTTTPYGLACVQKLLSNLILILSPENIFHTN-HVRTGLTLITAAFESGA--DYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINSR------------KDDLNRAIYYDSESSE--TNPEKK--------------IKLTNPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQT---NQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE----AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQR-NQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKL-SDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELY-----------KTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSL-NKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDELHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEW----------NNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAG--QLLKLTCDRLYTFLPDLVEELFYEPLL 5211
            Y+VQ EI++++ AIKR  + S+     EE  DPL  + S LK  L+ I +LSE++P  FL PFL+VI S +  G ITGLALT+V KFLS+  ID S    ++G    IE +A+ VT+ +F+GTD +SDEV+LMKIL++L TL+  P G  +++ +VC+I+ SCFRICFE +LSELLR +AE TL  +V LLF+RLP+ KE+ +  I  N   + M    +S  S+ +++   P +  H   +    +  S + +V  T  T+N   E   I ++  D+    ++P++   S    +V +       D  SQ     DL+ ++ ++ +++   +  P  S+       IQ+     +          V  +D S +A   D +    +G +  +   K  T     PYGL C+++L   LI + +P +  ++   +  GL LIT A ES    +Y+S     LL  +++EL ++   LL  +RL+ +AAS R CFL+FE MR HLKFQLEMY+ +L+ II  +N  +PYE +E+ALE+IVQLWRIPSF+TELY+NYDCD YCS+L  +L  L  K A P      L  T +++L+ALL +I+   S             K +  +     SE ++   N EKK              ++  N +  KK+++  GTE+FN   K G+++L+E+    T   N E+A   RENPRL+K  IGE++  R N+ + E +  +  +  LR+D A+R++L+ FRLPGEA  IQ +LE F + +  SN    +  D+ F L YA++MLN DQHN N +KQ  PMT+E+F++NL   N  K +   ++++L  IY AIK EEIVMP EQ G++K+NY W  LL R  T    ++  D  ++ ++LF + W   + A  YVF+  MD  I      G  +CA I+A+Y L ++ D +II + K+T  SS  E +E     FG N K ++AAK++F ++ +HGDILR+GWKN++D +L LF+A+LLPK + EV+DF+  +  I L  E+    + E+  +    + +L+ ++ SS +  + E++  K  AL  I  C    LI E++FL+  SL E + ALI                          +++ D  ++    DE+   FCLE++MR++L N DR+      + DH Y + + +V   FL+ER VV  LRLAI+LLR++E   QV   L IL + K +VL  V+  V  G+H+L+  +AANI S  DW  L  ++E  G G K  P                +L  +++++ND  ++  S+  S H    N +D                    RGYTSDSE+Y             T  ++ ++ W++V   ++ V  +K A  I + V +            VNQY++ +    F   D  ++ KS E LS++VRD AH+TP NFE CV T+RVF E  +     +++  + N +Y       + ++    N+ +        +   +SD D EDE     S      +++  LLDLMHTLH RAA IY  W             I+ DS+    LW NCWCPLLQG+A LCCD R +VR  A+T+LQR+LL   L +L   +WE CF KVLFPLL+  LENI S +D +    +T     RMR   +L+KVFLQHL  L  LSTF ALWLTIL++MD YM A ++ D L +A+ ESLKN+LLVM T      I   ++S  G   L ++T +R+  FLP L EELF + ++
Sbjct:    7 YIVQGEISIVVGAIKRNARWSMHTPVDEE-QDPLLHSFSVLKEVLNNIKELSEIEPNVFLRPFLEVIRSEDTTGPITGLALTSVNKFLSYALIDPSHEGTAEG----IENMADAVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFSRLPQFKEEAKSYIGTNMKKLKMRAGGMSDSSKWKKQKKSPRQPRHVTKAMAAAEPSSQQPVVNGTTITTNLTGEVPFIDASSPDA----NFPISGVSSEATSAVVSPTTDSGVDMSSQATSKEDLSELDPASPSLSAIHTLVPSSSAPQYIGAKIQHTYSASVESIPEVLDDNVSLADQSDSASVHDMDYVNPRGVRFTQSSQKEGT--VLVPYGLPCIRELFRFLISLTNPHDRHNSEVMIHMGLQLITVALESAPIENYVS-----LLGLVKDELCRHLFQLLSIERLNLYAASLRACFLLFEGMREHLKFQLEMYIKKLMDIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYCSNLFEDLTKLLSKNAFPVSGQ--LYTTHLLSLEALLTVIDSTESHCQAKNLSNVSQDKKETGKPSGDLSEGTKDSGNREKKTLKKPQRFSCLLPNVQELNDIKTKKKLLITGTEQFNQKPKKGVQFLQEKDLLATPMDNAEVAQWLRENPRLDKKMIGEFVSDRKNLDLLESFFFVAAY-CLRVDEALRLYLEAFRLPGEAPVIQRLLEAFTEHWRKSNGTPFAHSDACFALAYAVIMLNTDQHNHNVRKQNVPMTLEEFRKNLKGVNGGKDF---DQDMLEDIYHAIKNEEIVMPEEQTGLVKENYFWNVLLHRGATPEGMFLHVDPGSYDHDLFTMTWGPTIAALSYVFDKSMDETIIQKAISGFRKCAMISAHYGLSDVFDNLIISLCKFTTLSS--EAVENLPTVFGSNLKAQIAAKTVFHLSHRHGDILREGWKNIMDSMLQLFRAELLPKAMVEVEDFVDPNGKISLQREEIPANRGESTVLSFVSWLTLSGTEQSSLRGPSTENQEAKKLALECIKLCDPEKLITESKFLQLESLQELMKALI--------------------------SVTPDEETY----DEEDAAFCLEMLMRIVLENRDRVGCVWQAVRDHLYRLCVHAVEFCFLVERAVVGLLRLAIRLLRREEISGQVILSLRILLMMKPTVLSKVSRQVAFGVHELLKTNAANIHSSNDWYTLFCLLECIGAGVKPPP----------------ALQVTTRADNDTGAQSDSEVSSYHPSEVN-LD--------------------RGYTSDSEVYAEHSKQSKMHRSVTDVDMMNSGWLMV--GKEDVDSSKVATVINKPVANAP----------VNQYSLTIGL-DFGPHDTKSLMKSVESLSFIVRDAAHVTPENFELCVKTIRVFVEASLNGGYKSQEKRVKNHKYDSKSNRFKKKTKEKENSVRRTRASNQRQYRSHSD-DEEDE-----SVPASYHTVSLQLLDLMHTLHTRAATIYSSWAEEQRNLETAAEKITADSK---TLWSNCWCPLLQGIAWLCCDARRQVRMQALTYLQRALLVHDLQALDALEWESCFNKVLFPLLTKLLENI-SPAD-VGGMEET-----RMRGSTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHAGSS-DLLPEAIPESLKNMLLVMDTA----GIFHSADSRTGYSDLWEITWERIDCFLPRLREELFKQTVI 1672          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Xenopus
Match: or11l1.18 (olfactory receptor class II (xb178 gene) [Source:Xenbase;Acc:XB-GENE-5795351])

HSP 1 Score: 982.63 bits (2539), Expect = 0.000e+0
Identity = 652/1791 (36.40%), Postives = 971/1791 (54.22%), Query Frame = 1
Query:   85 YVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDT---------RIRKNNLTINMDXXXXXXXXXXXXXIPIPSESHSDTSHPPEDSCSDEI--IVTPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNEDISVNNEIEPLADDTDSQVLFDLT---RIESNCTINFEPSGNPELSSLNIKSDNIQYRTENGIVFKSDLSGAADNSDNENATCKGSKSEKLPLKSKTQSTTTPYGLACVQKLLSNLILILSPENIFHTN-HVRTGLTLITAAFESGA--DYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINSR------------KDDLNRAIYYDSESSE--TNPEKK--------------IKLTNPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQT---NQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE----AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQR-NQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKL-SDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELY-----------KTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSL-NKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDE----LHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEW----------NNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAG--QLLKLTCDRLYTFLPDLVEELFYEPLL 5211
            Y+VQ EI++++ AIKR  + S+     EE  DPL  + S LK  L+ I +LSE++P  FL PFL+VI S +  G ITGLALT+V KFLS+  ID S    ++G    IE +A+ VT+ +F+GTD +SDEV+LMKIL++L TL+  P G  +++ +VC+I+ SCFRICFE +LSELLR +AE TL  +V LLF+R   + + +         R  ++   +N      +  + L  ++P    S  D + P     S+    +V+P T +  D +S+                  A S ED+S   E++P +     + L  L     +    T +      PE     +  DN+           +D S +A   D +    +G +  +   K  T     PYGL C+++L   LI + +P +  ++   +  GL LIT A ES    +Y+S     LL  +++EL ++   LL  +RL+ +AAS R CFL+FE MR HLKFQLEMY+ +L+ II  +N  +PYE +E+ALE+IVQLWRIPSF+TELY+NYDCD YCS+L  +L  L  K A P      L  T +++L+ALL +I+   S             K +  +     SE ++   N EKK              ++  N +  KK+++  GTE+FN   K G+++L+E+    T   N E+A   RENPRL+K  IGE++  R N+ + E +  +  +  LR+D A+R++L+ FRLPGEA  IQ +LE F + +  SN    +  D+ F L YA++MLN DQHN N +KQ  PMT+E+F++NL   N  K   + ++++L  IY AIK EEIVMP EQ G++K+NY W  LL R  T    ++  D  ++ ++LF + W   + A  YVF+  MD  I      G  +CA I+A+Y L ++ D +II + K+T  SS  E +E     FG N K ++AAK++F ++ +HGDILR+GWKN++D +L LF+A+LLPK + EV+DF+  +  I L  E+    + E+  +    + +L+ ++ SS +  + E++  K  AL  I  C    LI E++FL+  SL E + ALI                          +++ D  ++    DE+   FCLE++MR++L N DR+      + DH Y + + +V   FL+ER VV  LRLAI+LLR++E   QV   L IL + K +VL  V+  V  G+H+L+  +AANI S  DW  L  ++E  G G K  P                +L  +++++ND  ++  S+  S H    N +D                    RGYTSDSE+Y             T  ++ ++ W++V   ++ V  +K A  I + V +            VNQY++ +    F   D  ++ KS E LS++VRD AH+TP NFE CV T+RVF E  +     +++  + N +Y       + ++    N+ +        +   +SD D EDE     ++ +S Q     ++ +LLDLMHTLH RAA IY  W             I+ DS+    LW NCWCPLLQG+A LCCD R +VR  A+T+LQR+LL   L +L   +WE CF KVLFPLL+  LENI S +D +    +T     RMR   +L+KVFLQHL  L  LSTF ALWLTIL++MD YM A ++ D L +A+ ESLKN+LLVM T      I   ++S  G   L ++T +R+  FLP L EELF + ++
Sbjct:    7 YIVQGEISIVVGAIKRNARWSMHTPVDEE-QDPLLHSFSVLKEVLNNIKELSEIEPNVFLRPFLEVIRSEDTTGPITGLALTSVNKFLSYALIDPSHEGTAEG----IENMADAVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFSRAGGMSDSSKWKKQKKSPRQPRHQPVVN----GTTITTNLTGEVPFIDASSPDANFPISGVSSEATSAVVSPTTDSGVDMSSQ------------------ATSKEDLS---ELDPASPSLSKEKLSHLGVPKYLMERHTYSASVESIPE-----VLDDNVSL---------ADQSDSASVHDMDYVNPRGVRFTQSSQKEGT--VLVPYGLPCIRELFRFLISLTNPHDRHNSEVMIHMGLQLITVALESAPIENYVS-----LLGLVKDELCRHLFQLLSIERLNLYAASLRACFLLFEGMREHLKFQLEMYIKKLMDIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYCSNLFEDLTKLLSKNAFPVSGQ--LYTTHLLSLEALLTVIDSTESHCQAKNLSNVSQDKKETGKPSGDLSEGTKDSGNREKKTLKKPQRFSCLLPNVQELNDIKTKKKLLITGTEQFNQKPKKGVQFLQEKDLLATPMDNAEVAQWLRENPRLDKKMIGEFVSDRKNLDLLESFFFVAAY-CLRVDEALRLYLEAFRLPGEAPVIQRLLEAFTEHWRKSNGTPFAHSDACFALAYAVIMLNTDQHNHNVRKQNVPMTLEEFRKNLKGVNGGK---DFDQDMLEDIYHAIKNEEIVMPEEQTGLVKENYFWNVLLHRGATPEGMFLHVDPGSYDHDLFTMTWGPTIAALSYVFDKSMDETIIQKAISGFRKCAMISAHYGLSDVFDNLIISLCKFTTLSS--EAVENLPTVFGSNLKAQIAAKTVFHLSHRHGDILREGWKNIMDSMLQLFRAELLPKAMVEVEDFVDPNGKISLQREEIPANRGESTVLSFVSWLTLSGTEQSSLRGPSTENQEAKKLALECIKLCDPEKLITESKFLQLESLQELMKALI--------------------------SVTPDEETY----DEEDAAFCLEMLMRIVLENRDRVGCVWQAVRDHLYRLCVHAVEFCFLVERAVVGLLRLAIRLLRREEISGQVILSLRILLMMKPTVLSKVSRQVAFGVHELLKTNAANIHSSNDWYTLFCLLECIGAGVKPPP----------------ALQVTTRADNDTGAQSDSEVSSYHPSEVN-LD--------------------RGYTSDSEVYAEHSKQSKMHRSVTDVDMMNSGWLMV--GKEDVDSSKVATVINKPVANAP----------VNQYSLTIGL-DFGPHDTKSLMKSVESLSFIVRDAAHVTPENFELCVKTIRVFVEASLNGGYKSQEKRVKNHKYDSKSNRFKKKTKEKENSVRRTRASNQRQYRSHSD-DEEDESVPASYHTVSLQ-----VSHDLLDLMHTLHTRAATIYSSWAEEQRNLETAAEKITADSK---TLWSNCWCPLLQGIAWLCCDARRQVRMQALTYLQRALLVHDLQALDALEWESCFNKVLFPLLTKLLENI-SPAD-VGGMEET-----RMRGSTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHAGSS-DLLPEAIPESLKNMLLVMDTA----GIFHSADSRTGYSDLWEITWERIDCFLPRLREELFKQTVI 1637          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Mouse
Match: Gbf1 (golgi-specific brefeldin A-resistance factor 1 [Source:MGI Symbol;Acc:MGI:1861607])

HSP 1 Score: 661.759 bits (1706), Expect = 0.000e+0
Identity = 418/1143 (36.57%), Postives = 623/1143 (54.51%), Query Frame = 1
Query: 1891 NPEKKIKLTNPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQT---NQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE----AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQR-NQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELY-----------KTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKS---SLNKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDEL----HYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEW----------NNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAG---QLLKLTCDRLYTFLPDLVEELFYE 5202
            +P + I++ N    KK+++  GTE+FN   K GI++L+E+G       N E+A   RENPRL+K  IGE++  R N+ + E ++  F+F+GLRLD A+R++L+ FRLPGEA  I  +LE F + + + N    ++ D+ F L YA++MLN DQHN N +KQ APMT+E+F++NL   N  K +   E+++L  +Y AIK EEIVMP EQ G++++NY+W  LL R  +    ++     ++  +LF + W   + A  YVF+  ++  I      G  +CA I+A+Y L ++ D +II + K+T  SS  E+IE     FG N K  +AAK++F +A +HGDILR+GWKN+++ +L LF+A+LLPK + EV+DF+  +  I L  E+    + E+  +    + +L+  + SS +  + E++  K  AL  I +C    +I E++FL+  SL E + AL+                          +++ D  ++    DE+   FCLE+++R++L N DR+      + DH Y + + +    FL+ER VV  LRLAI+LLR++E   QV   L IL L K SVL  V+  V  GLH+L+  +AANI S  DW  L T++E  G G K     +A           T+   +  +     S+L  Y                     +D S +     RGYTSDSE+Y             T  ++ ++ W++V   +D +  +K              L    P P+VNQY++ +        D  ++ K  E LS++VRD AHITP NFE CV TLR+F E  +     S +K+S  H  +Y   G   + +       ++   + +      +SD + EDE     ++ +S Q     ++++LLDLMHTLH RAA IY  W             I  DS     LW +CWCPLLQG+A LCCD R +VR  A+T+LQR+LL   L  L   +WE CF KVLFPLL+  LENI S +D +    +T     RMRA  +L+KVFLQHL  L  LSTF ALWLTIL++MD YM A ++ D L +A+ ESLKN+LLVM T      I   +++  G    L ++T +R+  FLP L +ELF +
Sbjct:  689 DPRELIEIKN----KKKLLITGTEQFNQKPKKGIQFLQEKGLLTIPMDNTEVAQWLRENPRLDKKMIGEFVSDRKNMDLLESFVSTFSFQGLRLDEALRLYLEAFRLPGEAPVIHRLLEVFTEHWRSCNGSPFANSDACFALAYAVIMLNTDQHNHNVRKQNAPMTLEEFRKNLKGVNGGKDF---EQDILEDMYHAIKNEEIVMPEEQTGLVRENYVWSVLLHRGASPEGVFLRVPPGSYDLDLFTMTWGPTIAALSYVFDKSLEETIIQKAISGFRKCAMISAHYGLSDVFDNLIISLCKFTALSS--ESIENLPSVFGSNPKAHIAAKTVFHLAHRHGDILREGWKNIMEAMLQLFRAQLLPKAMVEVEDFVDPNGKISLQREETPSNRGESTVLSFVSWLTLSGPEQSSVRGPSTENQEAKRVALDCIKQCDPEKMITESKFLQLESLQELMKALV--------------------------SVTPDEETY----DEEDAAFCLEMLLRIVLENRDRVGCVWQTVRDHLYHLCVQAQDFCFLVERAVVGLLRLAIRLLRREEISGQVLLSLRILLLMKPSVLSRVSHQVAYGLHELLKTNAANIHSGDDWATLFTLLECIGSGVKPPDALQA-----------TARADAPDAGAQSDSELPSY-------------------HQNDVSLD-----RGYTSDSEVYTDHGRPGKIHRSATDADMVNSGWLVV--GKDDIDNSKPG----------AGLSRPGPSPLVNQYSLTVGL-DLGPHDTKSLLKCVESLSFIVRDAAHITPDNFELCVKTLRIFVEASLNGGCKSQDKRSKSH--KYDSKGNRFKKKPKEGSMLRRPRGSNQHATRGGHSD-EEEDEGVPASYHTVSLQ-----VSQDLLDLMHTLHTRAASIYSSWAEEQRHLEGGGQKIEADSR---TLWAHCWCPLLQGIACLCCDARRQVRMQALTYLQRALLVHDLQKLDALEWESCFNKVLFPLLTKLLENI-SPAD-VGGMEET-----RMRASTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHAGSS-DLLSEAIPESLKNMLLVMDTA----EIFHSADARGGGPSALWEITWERIDCFLPHLRDELFKQ 1721          

HSP 2 Score: 347.821 bits (891), Expect = 1.872e-96
Identity = 227/610 (37.21%), Postives = 341/610 (55.90%), Query Frame = 1
Query:   85 YVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTRIRKNNLTINMDXXXXXXXXXXXXXIPIPSESHSDTSHPPEDSCSDEIIVTPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNEDISVNNEIEPLADD--------TDSQVLFDLTRIESNCTINFEPSGNPELSSLNIKSDNIQYRTENGIVFKS-------------DLSGAADNSDN---ENATCKGSKSEKLPLKSKTQSTT-TPYGLACVQKLLSNLILILSPENIFHTN-HVRTGLTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINS 1836
            Y++Q EI +++ AIKR  + S      EE  DPL  + S+LK  L+ + +LSE++P  FL PFL+VI S +  G ITGLALT+V KFLS+  ID +    ++G+    E +A+ VT+ +F+GTD +SDEV+LMKIL++L TL+  P G  +++ +VC+I+ SCFRICFE +LSELLR +AE TL  +V LLFTRLP+ KE+    K+ +  NM    + +            +    +  PP  +      VTP +       + + SN       +D P T+  S    + +  + P  D         T  + L DL +  S   I     G+ E+ +    SD +  + E   V K+             + +  AD+SD+    +      +  +    S+ + T   PYGL C+++L   LI + +P +  ++   +  GL L+T A ES    +++    LL  I++E+ ++   LL  +RL+ +AAS RVCFL+FESMR HLKFQLEMY+ +L+ II  +N  +PYE +E+ALE++VQLWRIPSF+TELY+NYDCD YCS+L  +L  L  K A P      L  T +++LDALL +I+   S
Sbjct:    7 YIIQGEINIVVGAIKRNARWSTHIPLDEE-RDPLLHSFSNLKEVLNSVTELSEIEPNVFLRPFLEVIRSEDTTGPITGLALTSVNKFLSYALIDPTHEGTAEGM----ENMADAVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGTHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFTRLPQFKEEP---KSYVGTNMKKLKMRAGGMSDSS---KWKKQKRSPRPPRHTTK----VTPGSELPTPNGATLPSNLTGGVPFIDAP-TSISSASSEAASTVVSPCTDSGLELSSQTTSKEDLTDLEQAGSPREITTSEPGSSEMGA----SDQLDPQ-EGAHVEKAQSASVESIPEVLEECTSPADHSDSASVHDMDYVNPRGVRFTQSSQKEGTALVPYGLPCIRELFRFLISLTNPHDRHNSEVMIHMGLHLLTVALESAP--VAQC-QTLLGLIKDEMCRHLFQLLSVERLNLYAASLRVCFLLFESMREHLKFQLEMYIKKLMEIITVENPKMPYEMKEMALEAVVQLWRIPSFVTELYINYDCDYYCSNLFEDLTKLLSKNAFPVSGQ--LYTTHLLSLDALLTVIDSTES 590          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Mouse
Match: Arfgef1 (ADP-ribosylation factor guanine nucleotide-exchange factor 1(brefeldin A-inhibited) [Source:MGI Symbol;Acc:MGI:2442988])

HSP 1 Score: 146.362 bits (368), Expect = 1.808e-34
Identity = 145/591 (24.53%), Postives = 255/591 (43.15%), Query Frame = 1
Query: 1429 LSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLM-NTQVI-----ALDALLFMINCINSRKDD-----------------------------LNR---------------AIYYDSESSETNPEKKIKLTNPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQTNQE-LASLFRENPRLNKTFIGEYICTRN--NVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSN--PEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAI--------KTEEIVMPS----------EQRGIIKDNYL------WRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCA-SIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLL 2961
            LSKN +    S     F  S  +   +  + + HLK Q+E++   +   I+ +     ++++ + ++++ ++      + ++Y+NYDCDL  +++   L +   KIA    S    M N Q +      L+ L+ ++ C+     D                             +NR                 Y    S   NPE+   L      +K II+ G + FN   K GI+YL+EQG   T  E +A    +  RL+ T +GE++   +  N  V   Y+   +F G     A+R+FL+ FRLPGEA  I  ++E FA  Y   N    + +  D+ +VL Y+I+ML  D H+P  K +   MT EQ+ +     N  K   ++ EE L+ IY  I        +T+E+ +P+          +QR ++ +  +       + L+       A + SA +  H   +F L W   + AF    + + D     S+ +   +CA  IA  +++    D  +  ++++T+ + S    E   KN  T    K++  +A   G+ L + W  +L C+  L  A+L+
Sbjct:  486 LSKNGV----SSVPEVFELSLSIFLTLLSNFKTHLKMQIEVFFKEIFLYIL-ETSTSSFDHKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANIFERLVNDLSKIAQGRGSQELGMSNVQELSLRKKGLECLVSILKCMVEWSKDQYVNPNSQTTLGQEKPSEQEISEVKHPETINRYGSLNSLESTSSSGIGSYSTQMSGTDNPEQFEVLKQ----QKEIIEQGIDLFNKKPKRGIQYLQEQGMLGTTPEDIAQFLHQEERLDSTQVGEFLGDNDKFNKEVMYAYVDQHDFSGKDFVSALRLFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQVKNK---MTKEQYIKMNRGINDSK---DLPEEYLSAIYNEIAGKKISMKETKELTIPTKSTKQNVASEKQRRLLYNLEMEQMAKTAKALMEAVSHVQAPFTSATHLEHVRPMFKLAWTPFLAAFSVGLQ-DCDDTEVASLCLEGIRCAIRIACIFSIQLERDAYVQALARFTLLTVSSGITEMKQKNIDT---IKTLITVAHTDGNYLGNSWHEILKCISQLELAQLI 1057          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Mouse
Match: Arfgef2 (ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited) [Source:MGI Symbol;Acc:MGI:2139354])

HSP 1 Score: 146.362 bits (368), Expect = 2.070e-34
Identity = 139/581 (23.92%), Postives = 254/581 (43.72%), Query Frame = 1
Query: 1429 LSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQV-------IALDALLFMINCINSRKDDL-----------------------------NRAIYYDSESSETNPEKKIKLTNPMLY-----KKRIIKIGTEKFNNDIKDGIKYLREQGFCQTN-QELASLFRENPRLNKTFIGEYI--CTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSN--PEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVM------------------PSEQRGIIKDNYL------WRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLL 2961
            LSKN +    S     F  S  +   +  + + HLK Q+E++   +   I+ +     +E+R + ++++ ++      + ++Y+NYDCDL  +++   L +   KIA   RS   L  T +         L+ L+ ++ C+     DL                              R      ES+ ++  +     +P  +     +K II+ G E FN   K GI++L+EQG      +++A    +  RL+ T +GE++   TR N  V   Y+   +F       A+R FL+ FRLPGEA  I  ++E FA  Y   N    + +  D+ +VL Y+I+ML  D H+P  K +   MT EQ+ +     N  K   ++ EE L+ IY+ I+ ++I M                    +QR ++ +  +       + L+     + A + SA + +H   +F LVW   + A+    +   D+ + +    G+     IA  + +    D  +  ++++++ ++S    E   KN  T    K++  +A   G+ L + W  +L C+  L  A+L+
Sbjct:  447 LSKNGV----SSVPDVFELSLAIFLTLLSNFKMHLKMQIEVFFKEIFLNIL-ETSTSSFEHRWMVIQTLTRICADAQCVVDIYVNYDCDLNAANIFERLVNDLSKIAQ-GRSGHELGMTPLQELSLRKKGLECLVSILKCMVEWSKDLYVNPNHQATLGQERLPDQEMGDGKGLDMARRCSVTSVESTVSSGTQTAIQDDPEQFEVIKQQKEIIEHGIELFNKKPKRGIQFLQEQGMLGAAVEDIAQFLHQEERLDSTQVGEFLGDSTRFNKEVMYAYVDQLDFCEKEFVSALRTFLEGFRLPGEAQKIDRLMEKFAARYIECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQVKNK---MTKEQYIKMNRGINDSK---DLPEEYLSSIYDEIEGKKIAMKETKEHTIATKSTKQSVASEKQRRLLYNVEMEQMAKTAKALMEAVSHAKAPFTSATHLDHVRPMFKLVWTPLLAAYSIGLQNCDDTEVASLCLEGIRCAVRIACIFGMQLERDAYVQALARFSLLTASSSITEMKQKNIDT---IKTLITVAHTDGNYLGNSWHEILKCISQLELAQLI 1012          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Mouse
Match: Arfgef1 (ADP-ribosylation factor guanine nucleotide-exchange factor 1(brefeldin A-inhibited) [Source:MGI Symbol;Acc:MGI:2442988])

HSP 1 Score: 141.354 bits (355), Expect = 3.705e-33
Identity = 144/585 (24.62%), Postives = 254/585 (43.42%), Query Frame = 1
Query: 1429 LSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLM-NTQVI-----ALDALLFMINCI-----------NSR------------------KDDLNR---------------AIYYDSESSETNPEKKIKLTNPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQTNQE-LASLFRENPRLNKTFIGEYICTRN--NVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSN--PEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAI--------KTEEIVMPS----------EQRGIIKDNYL------WRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCA-SIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCL 2943
            LSKN +    S     F  S  +   +  + + HLK Q+E++   +   I+ +     ++++ + ++++ ++      + ++Y+NYDCDL  +++   L +   KIA    S    M N Q +      L+ L+ ++ C+           NS+                   + +NR                 Y    S   NPE+   L      +K II+ G + FN   K GI+YL+EQG   T  E +A    +  RL+ T +GE++   +  N  V   Y+   +F G     A+R+FL+ FRLPGEA  I  ++E FA  Y   N    + +  D+ +VL Y+I+ML  D H+P  K +   MT EQ+ +     N  K   ++ EE L+ IY  I        +T+E+ +P+          +QR ++ +  +       + L+       A + SA +  H   +F L W   + AF    + + D     S+ +   +CA  IA  +++    D  +  ++++T+ + S    E   KN  T    K++  +A   G+ L + W   ++ LL L
Sbjct:  486 LSKNGV----SSVPEVFELSLSIFLTLLSNFKTHLKMQIEVFFKEIFLYIL-ETSTSSFDHKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANIFERLVNDLSKIAQGRGSQELGMSNVQELSLRKKGLECLVSILKCMVEWSKDQYVNPNSQTTLGQEKPSEQEISEVKHPETINRYGSLNSLESTSSSGIGSYSTQMSGTDNPEQFEVLKQ----QKEIIEQGIDLFNKKPKRGIQYLQEQGMLGTTPEDIAQFLHQEERLDSTQVGEFLGDNDKFNKEVMYAYVDQHDFSGKDFVSALRLFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQVKNK---MTKEQYIKMNRGINDSK---DLPEEYLSAIYNEIAGKKISMKETKELTIPTKSTKQNVASEKQRRLLYNLEMEQMAKTAKALMEAVSHVQAPFTSATHLEHVRPMFKLAWTPFLAAFSVGLQ-DCDDTEVASLCLEGIRCAIRIACIFSIQLERDAYVQALARFTLLTVSSGITEMKQKNIDT---IKTLITVAHTDGNYLGNSWHE-VETLLTL 1050          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Mouse
Match: Cyth2 (cytohesin 2 [Source:MGI Symbol;Acc:MGI:1334255])

HSP 1 Score: 113.62 bits (283), Expect = 8.495e-27
Identity = 68/196 (34.69%), Postives = 105/196 (53.57%), Query Frame = 1
Query: 1927 LYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQ-TNQELASLFRENPRLNKTFIGEYICTRN--NVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSE 2505
            L + R + +G +KFN D K GI++L E    Q T +E+A    +   LNKT IG+Y+  R   N+ V   ++ L  F  L L  A+R FL  FRLPGEA  I  ++E FA+ Y   NP +    D+ +VL +A++MLN   HNPN + +          R + E       G++ E++L  +Y++I+ E   +P +
Sbjct:   59 LQRNRKMAMGRKKFNMDPKKGIQFLVEHELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLSVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINE------GGDLPEDLLRNLYDSIRNEPFKIPED 248          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. UniProt/SwissProt
Match: sp|Q9R1D7|GBF1_CRIGR (Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Cricetulus griseus OX=10029 GN=GBF1 PE=1 SV=1)

HSP 1 Score: 661.374 bits (1705), Expect = 0.000e+0
Identity = 425/1160 (36.64%), Postives = 630/1160 (54.31%), Query Frame = 1
Query: 1891 NPEKKIKLTNPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQT---NQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE----AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVIS--HWFFSLTSSDYSSGQR-NQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELY-----------KTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSLNKKSSIHNREYCDSGKSPRGRSNYNGNTKKN-----IPNPKIHKESHYSDIDSEDELHYKISAQIDKGS--INENLLDLMHTLHNRAAKIYFEW----------NNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAGQ---LLKLTCDRLYTFLPDLVEELFYEPLLPISDKIEESNEN 5247
            +P + I++ N    KK+++  GTE+FN   K GI++L+E+G       N E+A   RENPRL+K  IGE++  R N+ + E ++  F+F+GLRLD A+R++L+ FRLPGEA  I  +LE F + + + N    ++ D+ F L YA++MLN DQHN N +KQ  PMT+E+F++NL   N  K +   E+++L  +Y AIK EEIVMP EQ G++++NY+W  LL R  T    ++     ++  +LF + W   + A  YVF+  ++  I      G  +CA I+A+Y L ++ D +II + K+T  SS  E+IE     FG N K  +AAK++F +A +HGDILR+GWKN+++ +L LF+A+LLP+ + EV+DF+  +  I L  E+    + E+ SV+S   W  +L+  + SS +  + E++  K  AL  I +C    +I E++FL+  SL E + AL+                          +++ D  ++    DE+   FCLE+++R++L N DR+      + DH Y + + +    FL+ER VV  LRLAI+LLR++E   QV   L IL L K SVL  V+  V  GLH+L+  +AANI S  DW  L T++E  G G K     +A           T+   +  +     S+L  Y                     +D S +     RGYTSDSE+Y             T  ++ ++ W++V   +D +  +K+             L    P P+VNQY++ +        D  ++ K  E LS++VRD AHITP NFE CV TLR+F    V++SLN      ++     GKS +  S  N   KK      +  P+   +       S++E    + A     S  ++++LLDLMHTLH RAA IY  W             I  DS     LW +CWCPLLQG+A LCCD R +VR  A+T+LQR+LL   L  L   +WE CF KVLFPLL+  LENI S +D +    +T     RMRA  +L+KVFLQHL  L  LSTF ALWLTIL++MD YM A ++ D L +A+ ESLKN+LLVM T      I   +++  G    L ++T +R+  FLP L +ELF + ++      E  ++N
Sbjct:  687 DPRELIEIKN----KKKLLITGTEQFNQKPKKGIQFLQEKGLLTIPMDNTEVAQWLRENPRLDKKMIGEFVSDRKNIDLLESFVSTFSFQGLRLDEALRLYLEAFRLPGEAPVIHRLLEAFTEHWRSCNGSPFANSDACFALAYAVIMLNTDQHNHNVRKQNVPMTLEEFRKNLKGVNGGKDF---EQDILEDMYHAIKNEEIVMPEEQTGLVRENYVWSVLLHRGATPEGIFLRVPPGSYDLDLFTMTWGPTIAALSYVFDKSIEETIIQKAISGFRKCAMISAHYGLSDVFDNLIISLCKFTALSS--ESIENLPTVFGSNPKAHIAAKTVFHLAHRHGDILREGWKNIMEAVLQLFRAQLLPQAMVEVEDFVDPNGKISLQREEMPSNRGES-SVLSFVSWL-TLSGPEQSSVRGPSTENQEAKRVALDCIKQCDPEKMITESKFLQLESLQELMKALV--------------------------SVTADEETY----DEEDAAFCLEMLLRIVLENRDRVGCVWQTVRDHLYHLCVQAQDFCFLVERAVVGLLRLAIRLLRREEISGQVLLSLRILLLMKPSVLSRVSHQVAYGLHELLKTNAANIHSGDDWATLFTLLECIGSGVKPPDALQA-----------TARADAPDAGAQSDSELPSY-------------------HQNDVSLD-----RGYTSDSEVYTDHGRPGKIHRSATDADMVNSGWLVV--GKDDIDNSKAG----------AGLSRPSPSPLVNQYSLTVGL-DLGPHDTKSLLKCVESLSFIVRDAAHITPDNFELCVKTLRIF----VEASLNGGCKSQDKR----GKSHKYDSKGNRFKKKPKEGSVLRRPRTSSQHGTRGGHSDEEEDEGVPASYHTVSLQVSQDLLDLMHTLHTRAASIYSSWAEEQRHLESGGRKIEADSR---TLWAHCWCPLLQGIACLCCDARRQVRMQALTYLQRALLVHDLQKLDALEWESCFNKVLFPLLTKLLENI-SPAD-VGGMEET-----RMRASTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHAGSS-DLLSEAIPESLKNMLLVMDTA----EIFHSADARGGSPSALWEITWERIDCFLPHLRDELFKQTVIQDPMPTEPHSQN 1734          

HSP 2 Score: 188.348 bits (477), Expect = 1.922e-46
Identity = 99/203 (48.77%), Postives = 141/203 (69.46%), Query Frame = 1
Query:   85 YVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTR 693
            Y++Q EI +++ AIKR  + S      EE  DPL  + S LK  L+ + +LSE++P  FL PFL+VI S +  G ITGLALT+V KFLS+  ID +    ++G+    E +A+ VT+ +F+GTD +SDEV+LMKIL++L TL+  P G  +++ +VC+I+ SCFRICFE +LSELLR +AE TL  +V LLFTRLP+ KE+ +
Sbjct:    7 YIIQGEINIVVGAIKRNARWSTHIPLDEE-RDPLLHSFSHLKEVLNSVTELSEIEPNVFLRPFLEVIRSEDTTGPITGLALTSVNKFLSYALIDPTHEGTAEGM----ENMADAVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGTHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFTRLPQFKEEPK 204          

HSP 3 Score: 183.341 bits (464), Expect = 8.311e-45
Identity = 93/201 (46.27%), Postives = 134/201 (66.67%), Query Frame = 1
Query: 1225 KTQSTTTPYGLACVQKLLSNLILILSPENIFHT-NHVRTGLTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMIN 1824
            K  +   PYGL C+++L   LI + +P +  ++   +  GL L+T A ES    +++    LL  I++E+ ++   LL  +RL+ +AAS RVCFL+FESMR HLKFQLEMY+ +L+ II  +N  +PYE +E+ALE+IVQLWRIPSF+TELY+NYDCD YC++L  +L  L  K A P      L  T +++LDALL +I+
Sbjct:  389 KEGTALVPYGLPCIRELFRFLISLTNPHDRHNSEGMIHMGLHLLTVALESAP--VAQC-QTLLGLIKDEMCRHLFQLLSVERLNLYAASLRVCFLLFESMREHLKFQLEMYMKKLMEIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYCANLFEDLTKLLSKNAFPVSGQ--LYTTHLLSLDALLTVID 584          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. UniProt/SwissProt
Match: sp|Q92538|GBF1_HUMAN (Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1 PE=1 SV=2)

HSP 1 Score: 655.981 bits (1691), Expect = 0.000e+0
Identity = 414/1137 (36.41%), Postives = 613/1137 (53.91%), Query Frame = 1
Query: 1891 NPEKKIKLTNPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQT---NQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE----AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQR-NQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELY-----------KTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSLNKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDEL----HYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEWN------NTISNDSELNVR-LWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAG---QLLKLTCDRLYTFLPDLVEELFYE 5202
            +P + I++ N    KK+++  GTE+FN   K GI++L+E+G       N E+A   RENPRL+K  IGE++  R N+ + E ++  F+F+GLRLD A+R++L+ FRLPGEA  IQ +LE F + +   N    ++ D+ F L YA++MLN DQHN N +KQ APMT+E+F++NL   N  K +   E+++L  +Y AIK EEIVMP EQ G++++NY+W  LL R  T    ++     ++  +LF + W   + A  YVF+  ++  I      G  +CA I+A+Y L ++ D +II + K+T  SS  E+IE     FG N K  +AAK++F +A +HGDILR+GWKN+++ +L LF+A+LLPK + EV+DF+  +  I L  E+    + E+  +    + +L+  + SS +  + E++  K  AL  I +C    +I E++FL+  SL E + AL+                          +++ D  ++    DE+   FCLE+++R++L N DR+      + DH Y + + +    FL+ER VV  LRLAI+LLR++E   QV   L IL L K SVL  V+  V  GLH+L+  +AANI S  DW  L T++E  G G K     +A           T+   +  +     S+L  Y                     +D S +     RGYTSDSE+Y             T  ++ ++ W++V   +D V  +K                      ++NQY++ +        D  ++ K  E LS++VRD AHITP NFE CV TLR+F E  +      +         DS  +   + +  G+  +       H        D EDE     ++ +S Q     ++++LLDLMHTLH RAA IY  W        T     E + R LW +CWCPLLQG+A LCCD R +VR  A+T+LQR+LL   L  L   +WE CF KVLFPLL+  LENI S +D +    +T     RMRA  +L+KVFLQHL  L  LSTF ALWLTIL++MD YM A ++ D L +A+ ESLKN+LLVM T      I   +++  G    L ++T +R+  FLP L +ELF +
Sbjct:  689 DPRELIEIKN----KKKLLITGTEQFNQKPKKGIQFLQEKGLLTIPMDNTEVAQWLRENPRLDKKMIGEFVSDRKNIDLLESFVSTFSFQGLRLDEALRLYLEAFRLPGEAPVIQRLLEAFTERWMNCNGSPFANSDACFSLAYAVIMLNTDQHNHNVRKQNAPMTLEEFRKNLKGVNGGKDF---EQDILEDMYHAIKNEEIVMPEEQTGLVRENYVWNVLLHRGATPEGIFLRVPTASYDLDLFTMTWGPTIAALSYVFDKSLEETIIQKAISGFRKCAMISAHYGLSDVFDNLIISLCKFTALSS--ESIENLPSVFGSNPKAHIAAKTVFHLAHRHGDILREGWKNIMEAMLQLFRAQLLPKAMIEVEDFVDPNGKISLQREETPSNRGESTVLSFVSWLTLSGPEQSSVRGPSTENQEAKRVALECIKQCDPEKMITESKFLQLESLQELMKALV--------------------------SVTPDEETY----DEEDAAFCLEMLLRIVLENRDRVGCVWQTVRDHLYHLCVQAQDFCFLVERAVVGLLRLAIRLLRREEISAQVLLSLRILLLMKPSVLSRVSHQVAYGLHELLKTNAANIHSGDDWATLFTLLECIGSGVKPPAALQA-----------TARADAPDAGAQSDSELPSY-------------------HQNDVSLD-----RGYTSDSEVYTDHGRPGKIHRSATDADVVNSGWLVV--GKDDVDNSKPGPSRPGPSP------------LINQYSLTVGL-DLGPHDTKSLLKCVESLSFIVRDAAHITPDNFELCVKTLRIFVEASLNGGCKSQEKRGKSHKYDSKGNRFKKKSKEGSMLRRPRTSSQHASRGGQSDDDEDEGVPASYHTVSLQ-----VSQDLLDLMHTLHTRAASIYSSWAEEQRHLETGGQKIEADSRTLWAHCWCPLLQGIACLCCDARRQVRMQALTYLQRALLVHDLQKLDALEWESCFNKVLFPLLTKLLENI-SPAD-VGGMEET-----RMRASTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHAGSS-DLLSEAIPESLKNMLLVMDTA----EIFHSADARGGGPSALWEITWERIDCFLPHLRDELFKQ 1719          

HSP 2 Score: 349.747 bits (896), Expect = 2.801e-96
Identity = 228/604 (37.75%), Postives = 338/604 (55.96%), Query Frame = 1
Query:   85 YVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTRIRKNNLTINMDXXXXXXXXXXXXXIPIPSESHSDTSHPPEDSCSDEIIVTPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNEDISVNNEIEPLADDTDSQVLF--------DLTRIESNCTINFEPSGNPELSSLNI-KSDNIQYRT----------ENGIVFKSDLSGAADNSDN---ENATCKGSKSEKLPLKSKTQSTT-TPYGLACVQKLLSNLILILSPENIFHTN-HVRTGLTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMIN 1824
            Y++Q EI +++ AIKR  + S      EE  DPL  +   LK  L+ I +LSE++P  FL PFL+VI S +  G ITGLALT+V KFLS+  ID +    ++G+    E +A+ VT+ +F+GTD +SDEV+LMKIL++L TL+  P G  +++ +VC+I+ SCFRICFE +LSELLR +AE TL  +V LLFTRLP+ KE+    KN +  NM    + +            +    +  PP         VTP +       + + SN       +D P T   S    + +  + P    TDS + F        DLT +E   +  +  +  P  S L + +  ++Q  T          E+      + +  AD+SD+    +      +  +    S+ + T   PYGL C+++L   LI + +P +  ++   +  GL L+T A ES    +++    LL  I++E+ ++   LL  +RL+ +AAS RVCFL+FESMR HLKFQ+EMY+ +L+ II  +N  +PYE +E+ALE+IVQLWRIPSF+TELY+NYDCD YCS+L  EL  L  K A P      L  T +++LDALL +I+
Sbjct:    7 YIIQGEINIVVGAIKRNARWSTHTPLDEE-RDPLLHSFGHLKEVLNSITELSEIEPNVFLRPFLEVIRSEDTTGPITGLALTSVNKFLSYALIDPTHEGTAEGM----ENMADAVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFTRLPQFKEEP---KNYVGTNMKKLKMRAGGMSDSS---KWKKQKRSPRPPRHMTK----VTPGSELPTPNGTTLSSNLTGGMPFIDVP-TPISSASSEAASAVVSP---STDSGLEFSSQTTSKEDLTDLEQPGSPGYSTATEPGSSELGVPEQPDLQEGTHVEKSQSASVESIPEVLEECTSPADHSDSASVHDMDYVNPRGVRFTQSSQKEGTALVPYGLPCIRELFRFLISLTNPHDRHNSEVMIHMGLHLLTVALESAP--VAQC-QTLLGLIKDEMCRHLFQLLSIERLNLYAASLRVCFLLFESMREHLKFQMEMYIKKLMEIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYCSNLFEELTKLLSKNAFPVSGQ--LYTTHLLSLDALLTVID 586          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. UniProt/SwissProt
Match: sp|Q42510|GNOM_ARATH (ARF guanine-nucleotide exchange factor GNOM OS=Arabidopsis thaliana OX=3702 GN=GN PE=1 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 4.494e-85
Identity = 268/961 (27.89%), Postives = 450/961 (46.83%), Query Frame = 1
Query: 1084 NIKSDNIQYRTENGIVFKSDLSGAADNS-DNEN-----ATCKGSKSEKLPLKSKTQSTTTPYGLACVQKLLSNLILILSPENIFH--------TNHVRTG----------------LTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRC-LMNTQVIALDALLFMINCINSRKD------DLNRAIYYDSES--------SETNPEKKIKLTNPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQTN---QELASLFRENPRLNKTFIGEYICTRNN--VGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGN-VEEEVLNKIYEAIKTEEIVMPSEQRGIIKD--NYLWRQLLRRCLTSNATYISADYKNH-SYELFNLVWKSAVNAFVYVFE-VEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIF---SSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSG---------------QRNQ--EDELTKNE-ALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDV-DQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEI 3735
            +IK +     ++  IV K    G A++  D EN     AT   S  +  P+   ++   +PY L     +++    + S   IFH          HV  G                L LI +A E G   I   P  LLS IQ+EL +N +    S      +    +   +++ +R  LK QLE + S +I  +        Y+ +EVA+E++V   R  SF+ E+Y N DCD+ CS++  EL++L  K   P   V C L    ++ALD L+ +I  +  R        DL   ++ D  +        + ++P   +       Y KR + IG + FN D K G+++L+           Q +A  FR    L+K  +G+++   +   V V  E+   F+F+ + LD A+R+FL+ FRLPGE+  IQ +LE F++ Y+  +PE++++ D+  VL Y+I+MLN DQHN   KK+   MT E F RN    N+    GN +  E L++++ +I   EI    EQ     +     W  L+ +     A YI AD + +  +++F ++    + A   VF+  E + V  T +  G    A I+A ++L +++D +++ + K+T     SS  E + AFG + K ++A  ++F IA K+GD +R GW+N+LDC+L L K  LLP  +       + D++    E+ +   K  A S+ S    S+ +   SSG                R+Q  E +L  ++  L  I KC I ++  E++FL+  SL +   ALI                       P    S       S  DE + VFCLEL++ + L+N DRI      +++H  TI   +V+   L+++ +   LR+  +LL  +E + D++   L+++      V       +   +  L+  +A +I S+  W+ + +++ I
Sbjct:  242 SIKQEKAGVDSDYAIVSKPVEDGNANSEYDVENSMATFATGAQSLMDDGPVGPGSRKPASPYDL----HIMTEPYGVPSMVEIFHFLCSLLNVVEHVGMGSRSNTIAFDEDVPLFALNLINSAIELGGSSIRHHPR-LLSLIQDELFRNLMQFGLSMSPLILSMVCSIVLNLYQHLRTELKLQLEAFFSCVILRLAQGKYGPSYQQQEVAMEALVNFCRQKSFMVEMYANLDCDITCSNVFEELSNLLSKSTFP---VNCPLSAMHILALDGLIAVIQGMAERISNGLTGLDLG-PVHLDEYTPFWMVKCDNYSDPNHWVSFVRRRKYIKRRLMIGADHFNRDPKKGLEFLQGTHLLPDKLDPQSVACFFRYTAGLDKNLVGDFLGNHDEFCVQVLNEFAGTFDFQYMNLDTALRLFLETFRLPGESQKIQRVLEAFSERYYMQSPEILANKDAALVLSYSIIMLNTDQHNVQVKKK---MTEEDFIRN----NRHINGGNDLPREFLSELFHSICNNEIRTTPEQGAGFPEMTPSRWIDLMHKS-KKTAPYILADSRAYLDHDMFAIMSGPTIAAISVVFDHAEHEDVYQTCID-GFLAIAKISACHHLEDVLDDLVVSLCKFTTLLNPSSVDEPVLAFGDDAKARMATITIFTIANKYGDYIRTGWRNILDCILRLHKLGLLPARVAS----DAADESEHSSEQGQG--KPLANSLSSAHLQSMGTPRRSSGLMGRFSQLLSLDTEEPRSQPTEQQLAAHQRTLQTIQKCHIDSIFTESKFLQAESLLQLARALIWAA------------------GRPQKGTS-------SPEDEDTAVFCLELLIAITLNNRDRIVLLWQGVYEHIATIAQSTVMPCNLVDKAIFGLLRICQRLLPYKESLADELLRSLQLVLKLDARVADAYCEQIAIEVSRLVKANANHIRSQAGWRTITSLLSI 1153          

HSP 2 Score: 105.531 bits (262), Expect = 3.548e-21
Identity = 64/209 (30.62%), Postives = 118/209 (56.46%), Query Frame = 1
Query:   64 TSKTNAKYVVQLEITLLMTAIKRRMK-GSVIRSYQEEISDPLYSNLSSLKSTLSQIND-LSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQL-SELLRHTAECTLERIVHLLFTRLPELK 681
            ++ T    ++  EI  ++  ++R ++ G    S  +++   L  +L +L+  +   N     + P+ +L PFLDVI S E    IT +AL++V K L+   ID +  N  D + +    V ++VT+ +F  TD +S+EV+LMKIL++L   M   A  ++S+  VC ++++CFR+  +A +  ELL+  A  T+  +V  +F+ LP+++
Sbjct:   26 SNTTTLACMIDTEIAAVLAVMRRNVRWGGRYMSGDDQLEHSLIQSLKALRKQVFSWNQPWHTISPMLYLQPFLDVIRSDETGAPITSIALSSVYKILNLNVIDQNTANIEDAMHL----VVDSVTSCRFEVTDPASEEVVLMKILQVLLACMKNKASVMLSNQHVCTVVNTCFRVVHQAGMKGELLQRVARHTMHELVRCIFSHLPDVE 230          

HSP 3 Score: 89.3521 bits (220), Expect = 3.196e-16
Identity = 69/190 (36.32%), Postives = 102/190 (53.68%), Query Frame = 1
Query: 4642 WCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLE-NIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKA---NNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAG-QLLKLTCDRLYTFLPDLVEELF 5196
            W  L+QG+ ++C D R +VR  A+  LQ+ L      +L  + W  CF KV+F +L + LE    SQ D    +   E +   + A+++L+KVFLQ L  L +LSTF  LWL +L  M+ YMK        D L ++V E LKN+LLVM T    + +L++  +  G  L +LT   +    P +  ELF
Sbjct: 1245 WLRLVQGLRKVCLDQREDVRNHALQSLQKCLGGVDGINLAHSMWSQCFDKVIFTVLDDLLEIAAGSQKD----YRNMEGT--LLLAIKLLSKVFLQQLQELSQLSTFCKLWLGVLTRMEKYMKVKVRGKKSDKLQESVPELLKNILLVMKT----KGVLLQRSALGGDSLWELTWLHVNNIAPSMRLELF 1424          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. UniProt/SwissProt
Match: sp|Q9FLY5|GNL1_ARATH (ARF guanine-nucleotide exchange factor GNL1 OS=Arabidopsis thaliana OX=3702 GN=GNL1 PE=3 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 1.243e-79
Identity = 244/964 (25.31%), Postives = 452/964 (46.89%), Query Frame = 1
Query: 1039 TINFEP-SGNPELSSLNIKSDNIQYRTENG------IVFKSDLSG---AADNSDNENATCKGSKSEKLPLKSKTQSTTTPYGLACVQKLLSNLILILSPENIFHTNHVRT--------------GLTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINSRKDDLNRA--IYYDSESSE----------TNPEKKIKLTNPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQTNQEL-----ASLFRENPRLNKTFIGEYICTRNN--VGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGI---IKDNYLWRQLLRRCLTSNATYISADYKNH-SYELFNLVWKSAVNAFVYVFE-VEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFS---SSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTE--VDD-----------FISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQRNQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDV-DQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEI 3735
            T++++P SG   + + NI S +    T+        ++ ++DL       + SD+ NA   G  +              PYG+ C+ ++   L  +L   N+     V +               L LI +A E G     + P  LL+ IQ++L  N +    S      +    +   ++ ++R  LK QLE + S ++  I        Y+ +EVA+E++V L R  +FI E++ N+DCD+ CS++  ++++L  K A P       M+  ++ALD L+ M+  +  R  +   A  +    E  E           +P   +     + + K+ + +G ++FN D   G++YL  QG     ++L     A  FR    L+K  +G+++   +   + V  E+ K F+F+ + L  A+R+F+  F+L GEA  I  +LE F++ Y+  +P ++ D D+ FVL Y+I++LN DQHN   K +   MT E F RN    N      ++  E L++IY +I+  EI M  E +G    +     W  ++ +     + YI  D  +H   ++F +V    + A   VFE  E + V+   +  GL   A ++AYY+L  ++D +++ + K+T F    S+ E +   G++ + ++A +++F IA K+GD +  GWKN+L+C+L L K  +LP ++     DD             S +   ++ +   S    ++ S I  +  S  S + +    ++E+      A  ++  C I ++  +++FL+  SL + +N+LI                                    SG+DE S VFCLEL++ V L+N DRI      +++H   I+  ++    L+E+ V   L++  +LL  +E++ D++   L+++   K  V       +   +  L+  +A+++ S   W+ +++++ I
Sbjct:  244 TVDWDPNSGEKRVENGNIASISDTLGTDKDDPSSEMVIPETDLRNDEKKTEVSDDLNAAANGENA-----------MMAPYGIPCMVEIFHFLCTLL---NVGENGEVNSRSNPIAFDEDVPLFALGLINSAIELGGPSFREHPK-LLTLIQDDLFCNLMQFGMSMSPLILSTVCSIVLNLYLNLRTELKVQLEAFFSYVLLRIAQSKHGSSYQQQEVAMEALVDLCRQHTFIAEVFANFDCDITCSNVFEDVSNLLSKNAFPVNGPLSAMH--ILALDGLISMVQGMAERVGEELPASDVPTHEERYEEFWTVRCENYGDPNFWVPFVRKVKHIKKKLMLGADRFNRDPNKGLQYL--QGVHLLPEKLDPKSVACFFRYTCGLDKNVMGDFLGNHDQFCIQVLHEFAKTFDFQNMNLATALRLFVGTFKLSGEAQKIHRVLEAFSERYYEQSPHILIDKDAAFVLAYSIILLNTDQHNAQVKTR---MTEEDFIRNNRTINGG---ADLPREYLSEIYHSIRHSEIQM-DEDKGTGFQLMTASRWISVIYKS-KETSPYIQCDAASHLDRDMFYIVSGPTIAATSVVFEQAEQEDVLRRCID-GLLAIAKLSAYYHLNSVLDDLVVSLCKFTPFFAPLSADEAVLVLGEDARARMATEAVFLIANKYGDYISAGWKNILECVLSLNKLHILPDHIASDAADDPELSTSNLEQEKPSANPVPVVSQSQPSAMPRKSSSFIGRFLLSFDSEE-TKPLPSEEELAAYKHARGIVKDCHIDSIFSDSKFLQAESLQQLVNSLIRA----------------------------------SGKDEASSVFCLELLIAVTLNNRDRILLIWPTVYEHILGIVQLTLTPCTLVEKAVFGVLKICQRLLPYKENLTDELLKSLQLVLKLKAKVADAYCERIAQEVVRLVKANASHVRSRTGWRTIISLLSI 1144          

HSP 2 Score: 91.2781 bits (225), Expect = 7.098e-17
Identity = 92/353 (26.06%), Postives = 162/353 (45.89%), Query Frame = 1
Query:   67 SKTNAKYVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQI----NDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFE-AQLSELLRHTAECTLERIVHLLFTRLP---------ELKEDTRIRKNNLTINMDXXXXXXXXXXXXXIPIPSESHSDTSHPPEDSCSDEIIVTPNTSNSKDEASEIISNDIDSEKKLDYPLTAAES-----------------NEDISVNNEIEPLADDTDSQVLFDLTRIES 1032
            SK     ++  EI  ++  ++R ++  V   Y  +     +S + SLK    QI    ++   + P  ++ PFLDVI S E    ITG+AL++V K L+     +   N  + + I ++AV     + +F  TD +S+EV+LMKIL++L   +   A   +S+  +C I+++C R+  + +  SELL+  A  T+  ++  +F++LP         EL  D ++     T++ D ++   +        I     SDT    +D  S E+++ P T    DE    +S+D+++    +  + A                     E+  VN+   P+A D D   LF L  I S
Sbjct:   25 SKGAVASMINSEIGAVLAVMRRNVRWGV--RYIADDDQLEHSLIHSLKELRKQIFSWQSNWQYVDPRLYIQPFLDVILSDETGAPITGVALSSVYKILTLEVFTLETVNVGEAMHIIVDAV----KSCRFEVTDPASEEVVLMKILQVLLACVKSKASNGLSNQDICTIVNTCLRVVHQSSSKSELLQRIARHTMHELIRCIFSQLPFISPLANECELHVDNKVG----TVDWDPNSGEKRVENGNIASI-----SDTLGTDKDDPSSEMVI-PETDLRNDEKKTEVSDDLNAAANGENAMMAPYGIPCMVEIFHFLCTLLNVGENGEVNSRSNPIAFDEDVP-LFALGLINS 360          

HSP 3 Score: 67.781 bits (164), Expect = 9.767e-10
Identity = 52/189 (27.51%), Postives = 91/189 (48.15%), Query Frame = 1
Query: 4642 WCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKA---NNNCDSLDDAVRESLKNVLLVM-YTGTQDRAILVKSESEAGQLLKLTCDRLYTFLPDLVEELF 5196
            W  L++ + ++C D R EVR  A++ LQR++       L    W  CF   +F LL + L    S  +S  +  +T   +  + A ++++K FLQ L  + +  +F  LW+ +L  +++YM         + +++ + E LKN LLVM  TG     +L   +  +    +LT   +    P L  E+F
Sbjct: 1237 WLKLVKNLKKVCLDQRDEVRNHAISMLQRAIAGADGIMLPQPLWFQCFDSAVFILLDDVL--TFSIENSRKTLKKTVE-ETLVLATKLMSKAFLQSLQDISQQPSFCRLWVGVLNRLETYMSTEFRGKRSEKVNELIPELLKNTLLVMKATGV----LLPGDDIGSDSFWQLTWLHVNKISPSLQSEVF 1418          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. UniProt/SwissProt
Match: sp|F4K2K3|GNL2_ARATH (ARF guanine-nucleotide exchange factor GNL2 OS=Arabidopsis thaliana OX=3702 GN=GNL2 PE=2 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 1.180e-61
Identity = 211/887 (23.79%), Postives = 401/887 (45.21%), Query Frame = 1
Query: 1249 YGLACVQKLLSNLILILSP----ENIFHTNHVRTG--------LTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINSRKD----------------------DLNRAIYYDSESSETNPEKKIKLTNPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQTNQE---LASLFRENPRLNKTFIGEYICTRN--NVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFA-KAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGN-VEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTI----FSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEV----DDFISKDKTILLIEEDKSLTKAEAPSVISHW--FFSLTSSDYSSGQRNQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDF-LLERTVVACLRLAIQLLRK--QEDVDQ--VFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICG 3741
            YG+ C   +   L  +L+     EN+  TN V T         L LI +A E   D I + P  LL  +Q++L  + I    S      +        ++  +R  ++ QLE + S ++  + +    +P +  EVALE ++   R P+FI E Y+NYDCD  C ++  E   + C+   P      L + Q+ A + L+ +I+ I    D                      +++  I +  +  + + E  +        +KR + I    FN D K G++YL+         +   LAS FR  P L+KT IG+Y+   +  ++ V   +   F F G+ LD A+R FL+ FRLPGE+  I+ ++E F+ + Y   + ++ +  D+  +L Y+++MLN DQHNP  +++   MT ++F RN    N+    GN + +E L++++++I T    + +    +  +   W +L+ R  T+    +    +    ++F  +   ++ A    FE   D  +       +   A +A Y  L +I+D++I    K+T     +++ +ET+ AF  + K ++A  ++F +A   GD +R GW+N++DCLL L K +LLP+++ E     ++  S+     +  +D    + +  S++  +  F +L + + S      E E    + L VI +C I  +  ++  L + ++     +LI       +     I   +T+K                        FC +L++ + L N  R N F    H++   +    +      +E+ +    R+ I++L    Q+ + +  +F  L I+      +++     +   +  +I  ++AN+ +   WK +L ++ +CG
Sbjct:  237 YGIRCCIDIFHFLCSLLNVVEVVENLEGTN-VHTADEDVQIFALVLINSAIELSGDAIGQHPK-LLRMVQDDLFHHLIHYGASSSPLVLSMICSCILNIYHFLRKFMRLQLEAFFSFVLLRVTAFTGFLPLQ--EVALEGLINFCRQPAFIVEAYVNYDCDPMCRNIFEETGKVLCRHTFPTSGP--LTSIQIQAFEGLVILIHNIADNMDREEDEGNEEDDNNSNVIKPSPVEIHEYIPFWIDKPKEDFETWVDHIRVRKAQKRKLAIAANHFNRDEKKGLEYLKYNYLVSDPLDPMALASFFRFTPGLDKTMIGDYLGDPDELHLSVLRSFTHTFEFTGMNLDTALRTFLESFRLPGESQKIERMIEAFSERFYDQQSSDIFASKDTVHILCYSLIMLNTDQHNPQVRRK---MTEDEFIRN----NRAINAGNDLPKEYLSELFQSIATNAFALSTHSGPVEMNPNRWIELMNRTKTTQPFSLCQFDRRIGRDMFATIAGPSIAAVSAFFEHSDDDEVLHECVDAMISIARVAQY-GLEDILDELIASFCKFTTLLNPYTTPEETLFAFSHDMKPRMATLAVFTLANTFGDSIRGGWRNIVDCLLKLRKLQLLPQSVIEFEINEENGGSESDMNNVSSQDTKFNRRQGSSLMGRFSHFLALDNVEESVALGMSEFE----QNLKVIKQCRIGQIFSKSSVLPDVAVLNLGRSLIYAAAGKGQKFSTAIEEEETVK------------------------FCWDLIITIALSNVHRFNMFWPSYHEYLLNVANFPLFSPIPFVEKGLPGLFRVCIKILASNLQDHLPEELIFRSLTIMWKIDKEIIETCYDTITEFVSKIIIDYSANLHTNIGWKSVLQLLSLCG 1081          

HSP 2 Score: 88.1965 bits (217), Expect = 6.002e-16
Identity = 52/197 (26.40%), Postives = 110/197 (55.84%), Query Frame = 1
Query:  100 EITLLMTAIKRRMKGSVIRSYQEEISDP-LYSNLSSLKSTL-SQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQ-LSELLRHTAECTLERIVHLLFTRLPELK 681
            E+  ++  I+R +  S +   + +  D  +  +L SL++ + +   D   + P  +LSPFL+VI S E+    T +AL+++ K L     D      + G + A+ ++ + +T+ +   TD  S++ ++M+IL++L  +M  P+  L+ D AVC I+++CF++  ++    +LL+     T+  ++ ++F+RLP+ +
Sbjct:   22 EVGAVLAVIRRPLSESYLSPQETDHCDSSVQQSLKSLRALIFNPQQDWRTIDPSVYLSPFLEVIQSDEIPASATAVALSSILKILKIEIFD----EKTPGAKDAMNSIVSGITSCRLEKTDLVSEDAVMMRILQVLTGIMKHPSSELLEDQAVCTIVNTCFQVVQQSTGRGDLLQRNGRYTMHELIQIIFSRLPDFE 214          

HSP 3 Score: 57.7658 bits (138), Expect = 1.319e-6
Identity = 49/179 (27.37%), Postives = 88/179 (49.16%), Query Frame = 1
Query: 4687 RPEVRTIAMTFLQRSL-LSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMR--------AVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAGQLLKLTCDRLYTFLPDLVEELF 5196
            R E+R  A+T L++S  +       T +    C   V+FP + +  E        L  +++ EN++  MR        A+++L  VFL +L  + E + F   WL +L  MD+ MKA+   +  D+ ++E +  +L  M    +++ ILV+ E +   L ++T  ++    P L +ELF
Sbjct: 1202 REEIRNRAVTSLEKSFTMGHEDLGFTPSGCIYCIDHVIFPTIDDLHEK-------LLDYSRRENAEREMRSMEGTLKIAMKVLMNVFLVYLEQIVESAEFRTFWLGVLRRMDTCMKADLG-EYGDNKLQEVVPELLTTMIGTMKEKEILVQKEDD--DLWEITYIQIQWIAPALKDELF 1370          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. TrEMBL
Match: R7UJM2 (SEC7 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_227129 PE=4 SV=1)

HSP 1 Score: 1059.67 bits (2739), Expect = 0.000e+0
Identity = 674/1768 (38.12%), Postives = 965/1768 (54.58%), Query Frame = 1
Query:   76 NAKYVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTRIRKNNLTINMDXXXXXXXXXXXXXIPIPSESHSDTSHPPEDSCSDEIIVTPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNEDISVNNEIEPLADDTDSQVLFDLTRIESNCTINFEPSGNPELSSLNIKSDNIQYRTENGIVFKSDLSGAADNSDNENATCKGSKSEKLPLKSKTQSTTTPYGLACVQKLLSNLILILSPENIFHTN-HVRTGLTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINSRKDDLNRAIYYDSESSETNPEK--------------------KIKLT---------NPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQT---NQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWF-FSLTSSDYSSGQRNQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSC---ELQESCRGYTSDSELYKTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSS---LNKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIH-KESHYSDIDSEDELHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEWN---------------NTISNDSELNVR-----LWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAGQLLKLTCDRLYTFLPDLVEELF 5196
            N  Y++Q E+ L++TA++R  + +   ++Q+E  DPL +N S LK  L+ I +L EL P +FLSPFL+VI S +  G ITGLALT++ KFLS+  ID       +    AIE +A+ VT+ +F+GTD SSDEV+LMKIL +L TL+  PAG ++++ +VC+I+ SCFRICFE +LSELLR +AE TL  +V LLF+RLP+ KED ++R    T  MD                PS S       P+             SN++  A    ++   S  +L YP    E++          PL  D                             SL + S   +   E+G+ F  D  G               K    PL         PYGL CV++L   L+ + SP +  +T+  V  GL+L+T A E+GAD IS A + LL+ +++++ KN + LLQS+RLS FAA+ RVCFL+FESMR HLK QLEMYL++L  II+SD+  I YE RE+ALESIVQL RIP  ITELYLNYDCDLYC++L  +L  L  K A P   V  L +T +++LDALL +I+ I         +   D ++ ET  ++                    ++K+T           + YKK++ + GTE+FN     G+ +L+E     T    +E+    + NP+L+K  IGEYI  + N  V E Y K F F   R+D A+RM+L+ FRLPGEA  I  ILE FA  +H +N E  ++ D+ F L YA++MLNVDQHN N+KKQ  PMTV +FK+NL + N  +   + E+E+L+++Y+A+K++EIVMP+EQ GI+K+NY+W+ L+RR   S  ++I A       ELF+LVW   V A  +VF+  ++  I      G  +CA I+A+Y++ ++ D ++I + K+T   SS E    FG N K +L+A+++F +AQ HG ILR+GWKN+LDC+L L++AKLLP+ L +V+DF+     + LI ED S  +     V+S ++ + +T +    G   +E E  + ++   +  C +  LI E++FL E SL E   ALI  +        N   H     +     ISC +          + VF LEL+++V+L N DRIN+F   I DHFY + + +  H FLLERTVV  LRLAI+LLR++E   QV   L IL + K ++L  V  HV   LH+L+  +AANI S  DW  L T++E+ G GT   P+ +       +   + SL+ +   ++ EL+  S         YNS      +L  H   +     +    +G+  +++    +  +     W+LV  +  +  + +                        NQ++IVL        D  ++ K CE L++LVRD AH+TP NFESCVH +RVF E  +  +     ++ +    E   SG+  R       N  K   +   H +  H SD + E++ ++ IS Q         LLDLMHTLH RAA I+  W                +T      + +      LW  CWCPLLQG+ARLCCD R  VR+ A+T+LQR+LL   L +L+  +WE+CF KVLFPLLSN LE+I  Q       + T   + RMRA  +L KVFLQHL  L  LSTFTALWLTILE+MD +M  + + D L +A+ ESLKN+LLVM+T      IL  S  E  QL KLT DR+ TFLP+L  E+F
Sbjct:    7 NGVYIIQGEVNLVVTAMRRNSRWTS-HNHQDEEQDPLLNNFSKLKDLLNIIAELKELAPNEFLSPFLEVIKSEDTTGPITGLALTSINKFLSYSLID----PHCETAAAAIENIADAVTHARFVGTDPSSDEVVLMKILHVLRTLLLTPAGAMLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLMDMVQLLFSRLPQFKEDLKMR----TGGMD----------------PSRSSKHRKRSPKSKH--------KKSNTQQPAEPPAAHPGQSSAELAYPPAPEEASRG-------SPLPPD-----------------------------SLALTSPTDE---EHGVRFTPDQMG---------------KEGAAPL--------IPYGLPCVRELFRFLVSLTSPVDRHNTDVMVHMGLSLLTVALEAGADNIS-AYSSLLALVKDDMLKNLLFLLQSERLSLFAAAMRVCFLLFESMRGHLKLQLEMYLNKLQEIIVSDSPRISYEQREIALESIVQLLRIPGLITELYLNYDCDLYCTNLFEDLMKLLSKNAFP---VSGLFSTHLLSLDALLAVIDSIEQHCHHRVDSKETDEKNGETESKEAPAPKTAPAAARNIAKIRPNRMKVTASIPSEEELAAIKYKKKLYQTGTEQFNQKPSKGVSFLQEHELLSTPLDAEEVVEFIKGNPKLDKKQIGEYISNKKNNKVLEAYQKSFVFDDTRVDEALRMYLETFRLPGEAPVISYILEHFADHWHKTNGEPFANADAAFTLAYAVIMLNVDQHNTNAKKQNIPMTVHEFKKNLTKVNGGE---DFEQEMLDEMYQAVKSDEIVMPAEQTGIVKENYMWKVLIRRGAGSGGSFIHAPTGALDRELFSLVWGPTVAALSFVFDKSLEETIIQKAVTGFRKCAMISAHYDINDVFDNLVISLCKFTTLLSSVE----FGNNSKAQLSARTVFNLAQSHGHILREGWKNILDCMLQLYRAKLLPEVLVKVEDFLDPSGKVSLIREDVSQNQRSDSGVLSSFYSYFVTETPQQRGPSPEEQEAIR-KSQRCLQDCHVERLITESKFLIEESLLELAKALIAAS--------NPDLH----DNGGCGGISCYDD---------ADVFFLELLIKVVLQNRDRINNFWQSIRDHFYDLAVNATEHTFLLERTVVGLLRLAIRLLRREEISSQVLASLRILLMIKPTLLHSVGRHVAYALHELLRTNAANIHSADDWYTLFTLLEVVGAGTNPPPMLQ-------QATSMVSLSDTGAQSDSELTACSGSSEAGDRGYNS----DGELYAHDPAAIAGKHVATEGKGHVVEAKPLPASHGS-----WMLVYSTNKTDGEQRG-----------------------NQFSIVLNE-ELKHHDSKSLIKCCETLAFLVRDAAHVTPHNFESCVHAIRVFVEASINGAHLKCQQQKAQATNEQQPSGRKARKLKKAEENKMKKSKSSPSHLQHIHESDDERENDDYHSISIQ---------LLDLMHTLHTRAASIFSSWAEEEKCRLEGKESFYLDTEGQQEAVKISAEASTLWVKCWCPLLQGIARLCCDARRNVRSQALTYLQRALLVHDLQTLSAVEWENCFNKVLFPLLSNLLESINPQ-------DPTGIEETRMRASTLLCKVFLQHLSPLLSLSTFTALWLTILEFMDKFMHVDKS-DLLCEAIPESLKNMLLVMHTA----GILSTSAGERSQLWKLTWDRIDTFLPNLRREVF 1585          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. TrEMBL
Match: A0A5G3KAL2 (Olfactory receptor class II (xb178 gene) OS=Xenopus tropicalis OX=8364 GN=or11l1.18 PE=4 SV=1)

HSP 1 Score: 1000.35 bits (2585), Expect = 0.000e+0
Identity = 658/1807 (36.41%), Postives = 976/1807 (54.01%), Query Frame = 1
Query:   85 YVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTR--IRKN-----NLTINMDXXXXXXXXXXXXXIPIPSESHSDTSHPPEDSCSDEIIV--TPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNEDISVNNEIEPLADDTDSQVLFDLTRIESNCTINFEPSGNPELSSLNIKSDNIQYRTENGI-------VFKSDLSGAADNSDNENATCKG------SKSEKLPLKSKTQSTTTPYGLACVQKLLSNLILILSPENIFHTN-HVRTGLTLITAAFESGA--DYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINSR-------------------KDDLNRAIYYDSESSETNPEKKIKLTNPMLYKKRIIKI-----------------GTEKFNNDIKDGIKYLREQGFCQT---NQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE----AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQR-NQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKL-SDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELY-----------KTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSL-NKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDE----LHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEW----------NNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAG--QLLKLTCDRLYTFLPDLVEELFYEPLL 5211
            Y+VQ EI++++ AIKR  + S+     EE  DPL  + S LK  L+ I +LSE++P  FL PFL+VI S +  G ITGLALT+V KFLS+  ID S    ++G    IE +A+ VT+ +F+GTD +SDEV+LMKIL++L TL+  P G  +++ +VC+I+ SCFRICFE +LSELLR +AE TL  +V LLF+RLP+ KE+ +  I  N     N+ IN       S    ++K       H   +    +  S + +V  T  T+N   E   I ++  D+    ++P++   S    +V      ++  TDS V               +P+ +P LS  ++   +    +   I       V  +D S +A   D +    +G      S+ E L L         PYGL C+++L   LI + +P +  ++   +  GL LIT A ES    +Y+S     LL  +++EL ++   LL  +RL+ +AAS R CFL+FE MR HLKFQLEMY+ +L+ II  +N  +PYE +E+ALE+IVQLWRIPSF+TELY+NYDCD YCS+L  +L  L  K A P      L  T +++L+ALL +I+   S                      DL+         +  N   K   +  ++  K  + +                 GTE+FN   K G+++L+E+    T   N E+A   RENPRL+K  IGE++  R N+ + E ++  F+F+GLR+D A+R++L+ FRLPGEA  IQ +LE F + +  SN    +  D+ F L YA++MLN DQHN N +KQ  PMT+E+F++NL   N  K +   ++++L  IY AIK EEIVMP EQ G++K+NY W  LL R  T    ++  D  ++ ++LF + W   + A  YVF+  MD  I      G  +CA I+A+Y L ++ D +II + K+T  SS  E +E     FG N K ++AAK++F ++ +HGDILR+GWKN++D +L LF+A+LLPK + EV+DF+  +  I L  E+    + E+  +    + +L+ ++ SS +  + E++  K  AL  I  C    LI E++FL+  SL E + ALI                          +++ D  ++    DE+   FCLE++MR++L N DR+      + DH Y + + +V   FL+ER VV  LRLAI+LLR++E   QV   L IL + K +VL  V+  V  G+H+L+  +AANI S  DW  L  ++E  G G K  P                +L  +++++ND  ++  S+  S H    N +D                    RGYTSDSE+Y             T  ++ ++ W++V   ++ V  +K A  I + V +            VNQY++ +    F   D  ++ KS E LS++VRD AH+TP NFE CV T+RVF E  +     +++  + N +Y       + ++    N+ +        +   +SD D EDE     ++ +S Q     ++ +LLDLMHTLH RAA IY  W             I+ DS+    LW NCWCPLLQG+A LCCD R +VR  A+T+LQR+LL   L +L   +WE CF KVLFPLL+  LENI S +D +    +T     RMR   +L+KVFLQHL  L  LSTF ALWLTIL++MD YM A ++ D L +A+ ESLKN+LLVM T      I   ++S  G   L ++T +R+  FLP L EELF + ++
Sbjct:    7 YIVQGEISIVVGAIKRNARWSMHTPVDEE-QDPLLHSFSVLKEVLNNIKELSEIEPNVFLRPFLEVIRSEDTTGPITGLALTSVNKFLSYALIDPSHEGTAEG----IENMADAVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFSRLPQFKEEAKSYIGTNMKKVYNMIINNSGGMSDSSKWKKQKKSPRQPRHVTKAMAAAEPSSQQPVVNGTTITTNLTGEVPFIDASSPDA----NFPISGVSSEATSAV------VSPTTDSGVDMSSQATSKEDLSELDPA-SPSLSIEDLMERHTYSASVESIPEVLDDNVSLADQSDSASVHDMDYVNPRGVRFTQSSQKEGLLL-------ILPYGLPCIRELFRFLISLTNPHDRHNSEVMIHMGLQLITVALESAPIENYVS-----LLGLVKDELCRHLFQLLSIERLNLYAASLRACFLLFEGMREHLKFQLEMYIKKLMDIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYCSNLFEDLTKLLSKNAFPVSGQ--LYTTHLLSLEALLTVIDSTESHCQAKNLSNVSQDKKETGKPSGDLSEGTKDSGNRNAENNGSKPPTSGHLMADKMTLGVQETEYSTDGGKFNLLITGTEQFNQKPKKGVQFLQEKDLLATPMDNAEVAQWLRENPRLDKKMIGEFVSDRKNLDLLESFVGTFHFQGLRVDEALRLYLEAFRLPGEAPVIQRLLEAFTEHWRKSNGTPFAHSDACFALAYAVIMLNTDQHNHNVRKQNVPMTLEEFRKNLKGVNGGKDF---DQDMLEDIYHAIKNEEIVMPEEQTGLVKENYFWNVLLHRGATPEGMFLHVDPGSYDHDLFTMTWGPTIAALSYVFDKSMDETIIQKAISGFRKCAMISAHYGLSDVFDNLIISLCKFTTLSS--EAVENLPTVFGSNLKAQIAAKTVFHLSHRHGDILREGWKNIMDSMLQLFRAELLPKAMVEVEDFVDPNGKISLQREEIPANRGESTVLSFVSWLTLSGTEQSSLRGPSTENQEAKKLALECIKLCDPEKLITESKFLQLESLQELMKALI--------------------------SVTPDEETY----DEEDAAFCLEMLMRIVLENRDRVGCVWQAVRDHLYRLCVHAVEFCFLVERAVVGLLRLAIRLLRREEISGQVILSLRILLMMKPTVLSKVSRQVAFGVHELLKTNAANIHSSNDWYTLFCLLECIGAGVKPPP----------------ALQVTTRADNDTGAQSDSEVSSYHPSEVN-LD--------------------RGYTSDSEVYAEHSKQSKMHRSVTDVDMMNSGWLMV--GKEDVDSSKVATVINKPVANAP----------VNQYSLTIGL-DFGPHDTKSLMKSVESLSFIVRDAAHVTPENFELCVKTIRVFVEASLNGGYKSQEKRVKNHKYDSKSNRFKKKTKEKENSVRRTRASNQRQYRSHSD-DEEDESVPASYHTVSLQ-----VSHDLLDLMHTLHTRAATIYSSWAEEQRNLETAAEKITADSK---TLWSNCWCPLLQGIAWLCCDARRQVRMQALTYLQRALLVHDLQALDALEWESCFNKVLFPLLTKLLENI-SPAD-VGGMEET-----RMRGSTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHAGSS-DLLPEAIPESLKNMLLVMDTA----GIFHSADSRTGYSDLWEITWERIDCFLPRLREELFKQTVI 1677          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. TrEMBL
Match: A0A5F9CPX6 (Golgi brefeldin A resistant guanine nucleotide exchange factor 1 OS=Oryctolagus cuniculus OX=9986 GN=GBF1 PE=4 SV=1)

HSP 1 Score: 999.194 bits (2582), Expect = 0.000e+0
Identity = 663/1802 (36.79%), Postives = 971/1802 (53.88%), Query Frame = 1
Query:   85 YVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTRIRKNNLTINMDXXXXXXXXXXXXXIPIPSESHSDTSHPPEDSCSDEIIVTPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNEDISVNNEIEPLADDTDSQVLF--------DLTRIESNCTINFEPSGNPELSSLNI-KSDNIQYRTENGIVFKS-------------DLSGAADNSDN---ENATCKGSKSEKLPLKSKTQSTT-TPYGLACVQKLLSNLILILSPENIFHTN-HVRTGLTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMIN---------CINS----RKDDLNRAIY--YDSESSETNPEKKIKLTNPMLY--------------KKRIIKIGTEKFNNDIKDGIKYLREQGFCQT---NQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE----AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQR-NQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELYKTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYS----EYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKS---SLNKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDELHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEWN------NTISNDSELNVR-LWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAGQ---LLKLTCDRLYTFLPDLVEELFYE-------PLLPISDK 5226
            Y++Q EI +++ AIKR  + S      EE  DPL  + S LK  L+ I +LSE++P  FL PFL+VI S +  G ITGLALT+V KFLS+  ID +    ++G+    E +A+ VT+ +F+GTD +SDEV+LMKIL++L TL+  P G  +++ +VC+I+ SCFRICFE +LSELLR +AE TL  +V LLFTRLP+ KE+    KN +  NM    + +            +    +  PP         V P++       + + SN       +D P T   S    + +  + P    TDS + F        DLT +E   +  +  +  P  S L + +  ++Q + E   V K+             + +  AD+SD+    +      +  +    S+ + T   PYGL C+++L   LI + +P +  ++   +  GL L+T A ES      ++   LL  I++E+ ++   LL  +RL+ +AAS RVCFL+FESMR HLKFQLEMY+ +L+ II  +N  +PYE +E+ALE+IVQLWRIPSF+TELY+NYDCD YCS+L  +L  L  K A P      L  T +++LDALL +I+          +NS     K +  RA +   D     +N +KK     P                 KK+++  GTE+FN   K GI++L+E+G       N E+A   RENPRL+K  IGE++  R N+ + E ++  F+F+GLRLD A+R++L+ FRLPGEA  IQ +LE F + +   N    ++ D+ F L YA++MLN DQHN N +KQ APMT+E+F++NL   N  K +   E+++L  +Y AIK EEIVMP EQ G++++NY+W  LL R  T    ++     ++  +LF + W   + A  YVF+  ++  I      G  +CA I+A+Y L ++ D +II + K+T  SS  E+IE     FG N K  +AAK++F +A +HGDILR+GWKN+++ +L LF+A+LLPK + EV+DF+  +  I L  E+    + E+  +    + +L+  + SS +  + E++  K  AL  I +C    +I E++FL+  SL E + AL+                          +++ D  ++    DE+   FCLE+++R++L N DR+      + DH Y + + +    FL+ER VV  LRLAI+LLR++E   QV   L IL L K SVL  V+  V  GLH+L+  +AANI S  DW  L T++E  G G K     +A           T+   +S +     S+L  Y                     +D S +     RGYTSDSE+Y  T +        +   + D+   N     +G+   DN K  S      P P+VNQY++ +        D  ++ K  E LS++VRD AHITP NFE CV TLR+F E  +     S  K+S  H  +Y   G   + +S      ++   + +      +SD D EDE            +++  LLDLMHTLH RAA IY  W        T     E + R LW +CWCPLLQG+A LCCD R +VR  A+T+LQR+LL   L  L   +WE CF KVLFPLL+  LENI S +D +    +T     RMRA  +L+KVFLQHL  L  LSTF ALWLTIL++MD YM A ++ D L +A+ ESLKN+LLVM T      I   +++  G    L ++T +R+  FLP L +ELF +       P+ P S K
Sbjct:    7 YIIQGEINIVVGAIKRNARWSTHTPLDEE-RDPLLHSFSHLKEVLNSITELSEIEPNVFLRPFLEVIRSEDTTGPITGLALTSVNKFLSYALIDPTHEGTAEGM----ENMADAVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFTRLPQFKEEP---KNYVGTNMKKLKMRAGGMSDSS---KWKKQKRSPRPPRHMTK----VMPSSELPTPNGTTLSSNLTGGMPFIDVP-TPVSSVSSEAASAVVSP---STDSGLEFSSQTTSKEDLTDLEQPGSPGYSTAAEPGSSELGVLEQPDLQTQQERAHVEKAQSASVESIPEVLEECASTADHSDSASVHDMDYVNPRGVRFTQSSQKEGTALVPYGLPCIRELFRFLISLTNPHDRHNSEVMIHMGLHLLTVALESAPVAQCQS---LLGLIKDEMCRHLFQLLSVERLNLYAASLRVCFLLFESMREHLKFQLEMYIKKLMEIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYCSNLFEDLTKLLSKNAFPVSGQ--LYTTHLLSLDALLTVIDSTEAHCQAKVLNSLTQQEKKEPARASHEAVDVIREASNTDKKFTRKPPRFSSLLPDPRELIEIKNKKKLLITGTEQFNQKPKKGIQFLQEKGLLTIPMDNTEVAQWLRENPRLDKKMIGEFVSDRKNIDLLESFVSTFSFQGLRLDEALRLYLEAFRLPGEAPVIQRLLEAFTEHWRNCNGSPFANSDACFALAYAVIMLNTDQHNHNVRKQNAPMTLEEFRKNLKGVNGGKDF---EQDILEDMYHAIKNEEIVMPEEQTGLVRENYVWNVLLHRGATPEGIFLRVPPGSYDLDLFTMTWGPTIAALSYVFDKSLEETIIQKAISGFRKCAMISAHYGLSDVFDNLIISLCKFTALSS--ESIENLPSVFGSNPKAHIAAKTVFHLAHRHGDILREGWKNIMEAMLQLFRAQLLPKAMVEVEDFVDPNGKISLQREETPSNRGESTVLSFVSWLTLSGPEQSSVRGPSTENQEAKRMALDCIKQCDPEKMITESKFLQLESLQELMKALV--------------------------SVTPDEETY----DEEDAAFCLEMLLRIVLENRDRVGCVWQTVRDHLYHLCVQAQDFCFLVERAVVGLLRLAIRLLRREEISGQVLLSLRILLLMKPSVLSRVSHQVAYGLHELLKTNAANIHSGDDWATLFTLLECIGSGVKPPAALQA-----------TARADASDTGAQSDSELPSY-------------------HQNDVSLD-----RGYTSDSEVY--TDHGRPGK---IHRSATDADVVNSGWLVVGKDDIDNAKPGSGPSRPGPSPLVNQYSLTVGL-DLGPHDTKSLLKCVESLSFIVRDAAHITPDNFELCVKTLRIFVEASLNGGCKSQEKRSKSH--KYDSKGNRFKKKSKEGSMLRRPRTSSQHATRGGHSDED-EDE-----GVPASYHTVSLQLLDLMHTLHTRAASIYSSWAEEQRHLETGGRKIEADSRTLWAHCWCPLLQGIACLCCDARRQVRMQALTYLQRALLVHDLQKLDALEWESCFNKVLFPLLTKLLENI-SPAD-IGGMEET-----RMRASTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHAGSS-DLLSEAIPESLKNMLLVMDTA----EIFHSADTRGGSPSALWEITWERIDCFLPHLRDELFKQTVIQDPVPMEPHSQK 1688          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. TrEMBL
Match: A0A3Q3WKE3 (Golgi brefeldin A resistant guanine nucleotide exchange factor 1 OS=Mola mola OX=94237 PE=4 SV=1)

HSP 1 Score: 998.423 bits (2580), Expect = 0.000e+0
Identity = 640/1810 (35.36%), Postives = 965/1810 (53.31%), Query Frame = 1
Query:   85 YVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTRIRKNNLTINMDXXXXXXXXXXXXXIPIPSESHSDTSHPPEDSCSDEIIVTPNTSNSKDEASEIISNDI-DSEKKLDYPLTAA----------ESNEDISVNNEIEPLADDTDSQVLFDLTRIESNCTI--------NFEPSGNPELSSLNIKSDNIQYRTENGIV-------FKSDLSGAADNSDNENATCKGSKSEKLPLKSKTQSTTTPYGLACVQKLLSNLILILSPENIFHTNHV-RTGLTLITAAFESG--ADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINSRKDDLNRAIYYDSESSET-----------------------NPEKKIKLTNPMLY---------------KKRIIKIGTEKFNNDIKDGIKYLREQGFCQT---NQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSN--PEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE----AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQRNQ--EDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELY----------KTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSL----NKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDELHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEW----------NNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAG--QLLKLTCDRLYTFLPDLVEELFYE 5202
            Y+VQ EI +++ AIKR  + +      EE  DPL ++   LK  L+ + +LS+++P  FL PFL+V+ S +  G ITGLALT+V KFLSF  ID +    ++    AIE +A+ VT+ +F+GTD +SDEV+LMKIL++L TL+  P G  +++ +VC+I+ SCFRICFE +LSELLR +AE TL  +V LLF+RLP+ KE+    K+ +  NM    + +            +    +  PP       ++ +P++   + ++  + +N++ D    ++  L  +            +   + ++ ++  +  T    L DL +  S+  I          EP G+P+  S    +D  Q  +   I          ++ S +A   D +    +G +  +     +  ++  PYGL C+++L   LI + +P +  +T+ +   GL L+T A ESG  A+Y S     LL  ++ EL ++   LL  +R++ + +S RVCFL+FESMR HLKFQLEMYL +L+ II S+N  +PYE +E+ALE++VQLWRIPSF+TELY+NYDCD YCS+L  +L  L  K A P      L  T +++L+ALL +I+   +       +     + SET                       +P +K     P  +               KK+++  GTE+FN   K GI++L+E+G   +   N ++A   RENPRL+K  IGEY+  R N+ + + ++K F F+ LR+D A+R +L+ FRLPGEA  IQ +LE F   +H  N  P M +D  + F L YA++MLN DQHN N +KQ  PMTVEQFK+NL   N  K +   ++++L  IY AIK EEIVMP EQ G++K+NY+W  LL R  T+   ++     ++ ++LF + W   + A  YVF+  +D  I      G  +CA IAA+Y   ++ D +II + K+T  SS  E++E     FG N K + AAK++F +A +HG+ILR+GWKN+++ +L LF+A+LLPK + EV+DF+  +  I L  E+    + E+ +V+S   +   S    SGQR    E++  K  A+  I +C    LI E++FL+  SL E + ALI                          ++S D  ++    DE+   FCLE+++RV+L N DR+      + DH Y + + +    FL+ER VV  +RLAI+LLR+++   QV   L +L + K  VL  V+  V  GLH+L+  +AANI    DW  L +++E  G G K    ++                 S+  +ND  ++     S H     ++D                    RGYTSDSE+Y           TT  ++ S+ W++V   +  ++K              +   ++   P+VNQY++ L        D  ++ K  E LS++VRD AH+TP NFE CV  +RVF E  +         KKS  ++       K   GR    G+  +   +    +    S  D E++     S       ++++LLDLMHTLH RAA IY  W             I  DS+    LW +CWCPLLQG+A LCCD R +VR  A+T+LQR+LL   L +L   +WE CF KVLFPLL+  L+NI S +D +    +T     RMRA  +L+KVFLQHL  L  L TF ALWLTIL++MD YM A ++ D L +A+ ESLKN+LLVM T      I   ++S  G   L ++T +R+  FLP+L EELF +
Sbjct:    7 YIVQGEIGIVVGAIKRNSRWNTHNPLDEE-QDPLLNSFGQLKEVLNNVKELSDVEPNIFLRPFLEVVRSEDTTGPITGLALTSVNKFLSFGLIDANHEAAAE----AIENMADAVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFSRLPQFKEEA---KSYVGANMKKLKMRAGGMSESS---KWKKQKRSPRPPR-----HLVRSPSSQMDQAQSGTLSNNNLSDGVPFIEQGLPTSNLPASDSAASSISSPTATDSGLDTCSKATSRDDLSDLEQYSSSANIPGIAAPIPGSEP-GSPDAQSEGRPADPAQSASVESIPEVLEDKGSTTEQSDSASVHDMDYVNPRGVRFTQS--TQRDGASLIPYGLPCLRELFRFLISLTNPHDRHNTDAMMHMGLQLLTVALESGHIANYQS-----LLVLVKEELCRHLFQLLSVERMNLYTSSIRVCFLLFESMRVHLKFQLEMYLRKLMDIITSENIKMPYEMKEMALEALVQLWRIPSFVTELYINYDCDFYCSNLFEDLTKLLSKNAFPVSGQ--LYTTHLLSLEALLTVIDSTEAHCQAKGVSSTAHQDQSETPLGEGKALGCKSALGTNTNAKCAHPAEKTAPKKPQRFSSLLPDSQELMEIRTKKKLLITGTEQFNQKPKKGIQFLQEKGLLSSPMDNDQIAQWLRENPRLDKKMIGEYVSDRKNMELLDSFVKTFTFQRLRIDEALRRYLEAFRLPGEAPVIQRLLETFTDNWHKENGCPFMTND--AGFALAYAVIMLNTDQHNHNVRKQNIPMTVEQFKKNLKGVNGNKDF---DQDMLEDIYMAIKNEEIVMPDEQTGLVKENYVWNVLLHRGDTAEGVFLHLPPGSYDHDLFTMTWGPTIAALSYVFDKSLDENILQKAITGFRKCALIAAHYGFSDVFDNLIISLCKFTSLSS--ESVENLPTVFGSNSKAQTAAKTVFDLAHRHGNILREGWKNIMESMLQLFRAELLPKAMVEVEDFVEPNGKISLQREETPSIRGES-AVLSFVNWLTLSGAEQSGQRGPSTENQEAKQAAIVCIRQCDPEKLITESKFLQLESLQELMKALI--------------------------SVSPDEETY----DEEDAAFCLEMLLRVVLENRDRVACVWQTVRDHLYHLCVHATESCFLVERAVVGLIRLAIRLLRREDISSQVLLSLRLLLMMKAHVLSRVSREVAYGLHELLKTNAANIHCTDDWYTLFSLLECIGAGVKPPASFQ---------------LSSTAPDNDTGAQSDSELSPHHPSEVNID--------------------RGYTSDSEVYSEHSKTRITRSTTDVDIASSGWLVVGKDDLEISKTSP-----------LSSKAQLNHPLVNQYSLTLGQ-DLGQHDTKSLIKCVETLSFIVRDAAHVTPDNFELCVRAIRVFVEASLNGGYRNHDKKKSHKYDSSKARVRKKAGGRDKEGGSGMRRGSSRATSQRPSRSHSDDEEDEGVPASYHTVSLQVSQDLLDLMHTLHTRAASIYSSWAEEQQHLEAAARKIEADSQ---TLWTSCWCPLLQGIAWLCCDARRQVRMQALTYLQRALLVHDLQTLDATEWESCFNKVLFPLLTKLLDNI-SPAD-VGGMEET-----RMRACTLLSKVFLQHLSPLLSLPTFAALWLTILDFMDKYMHAGSS-DLLLEAIPESLKNMLLVMDTA----GIFHSADSRTGFSDLWEITWERIVCFLPNLREELFKQ 1690          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. TrEMBL
Match: A0A5G3KAE0 (Olfactory receptor class II (xb178 gene) OS=Xenopus tropicalis OX=8364 GN=or11l1.18 PE=4 SV=1)

HSP 1 Score: 997.653 bits (2578), Expect = 0.000e+0
Identity = 660/1796 (36.75%), Postives = 985/1796 (54.84%), Query Frame = 1
Query:   85 YVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTR--IRKNNLTINMDXXXXXXXXXXXXXIPIPSES-HSDTSHPPEDSCSDEIIV--TPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNEDISVNNEIEPLADDTDSQVLF--DLTRIESNCTINFEPSGNPE-LSSLNIKSDNIQYRTENGIVFK-----------SDLSGAADNSDNENATCKGSKSEKLPLKSKTQSTTTPYGLACVQKLLSNLILILSPENIFHTN-HVRTGLTLITAAFESGA--DYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINSR------------KDDLNRAIYYDSESSE--TNPEKK--------------IKLTNPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQT---NQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE----AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQR-NQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKL-SDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELY-----------KTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSL-NKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDE----LHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEW----------NNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAG--QLLKLTCDRLYTFLPDLVEELFYEPLL 5211
            Y+VQ EI++++ AIKR  + S+     EE  DPL  + S LK  L+ I +LSE++P  FL PFL+VI S +  G ITGLALT+V KFLS+  ID S    ++G    IE +A+ VT+ +F+GTD +SDEV+LMKIL++L TL+  P G  +++ +VC+I+ SCFRICFE +LSELLR +AE TL  +V LLF+RLP+ KE+ +  I  N   + M    +S  S+ +++   P +  H   +    +  S + +V  T  T+N   E   I ++  D+    ++P++   S    +V +       D  SQ     DL+ ++        PS + E LS L +    ++  T +  V             +D S +A   D +    +G +  +   K  T     PYGL C+++L   LI + +P +  ++   +  GL LIT A ES    +Y+S     LL  +++EL ++   LL  +RL+ +AAS R CFL+FE MR HLKFQLEMY+ +L+ II  +N  +PYE +E+ALE+IVQLWRIPSF+TELY+NYDCD YCS+L  +L  L  K A P      L  T +++L+ALL +I+   S             K +  +     SE ++   N EKK              ++  N +  KK+++  GTE+FN   K G+++L+E+    T   N E+A   RENPRL+K  IGE++  R N+ + E +  +  +  LR+D A+R++L+ FRLPGEA  IQ +LE F + +  SN    +  D+ F L YA++MLN DQHN N +KQ  PMT+E+F++NL   N  K +   ++++L  IY AIK EEIVMP EQ G++K+NY W  LL R  T    ++  D  ++ ++LF + W   + A  YVF+  MD  I      G  +CA I+A+Y L ++ D +II + K+T  SS  E +E     FG N K ++AAK++F ++ +HGDILR+GWKN++D +L LF+A+LLPK + EV+DF+  +  I L  E+    + E+  +    + +L+ ++ SS +  + E++  K  AL  I  C    LI E++FL+  SL E + ALI                          +++ D  ++    DE+   FCLE++MR++L N DR+      + DH Y + + +V   FL+ER VV  LRLAI+LLR++E   QV   L IL + K +VL  V+  V  G+H+L+  +AANI S  DW  L  ++E  G G K  P                +L  +++++ND  ++  S+  S H    N +D                    RGYTSDSE+Y             T  ++ ++ W++V   ++ V  +K A  I + V +            VNQY++ +    F   D  ++ KS E LS++VRD AH+TP NFE CV T+RVF E  +     +++  + N +Y       + ++    N+ +        +   +SD D EDE     ++ +S Q     ++ +LLDLMHTLH RAA IY  W             I+ DS+    LW NCWCPLLQG+A LCCD R +VR  A+T+LQR+LL   L +L   +WE CF KVLFPLL+  LENI S +D +    +T     RMR   +L+KVFLQHL  L  LSTF ALWLTIL++MD YM A ++ D L +A+ ESLKN+LLVM T      I   ++S  G   L ++T +R+  FLP L EELF + ++
Sbjct:    7 YIVQGEISIVVGAIKRNARWSMHTPVDEE-QDPLLHSFSVLKEVLNNIKELSEIEPNVFLRPFLEVIRSEDTTGPITGLALTSVNKFLSYALIDPSHEGTAEG----IENMADAVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFSRLPQFKEEAKSYIGTNMKKLKMRAGGMSDSSKWKKQKKSPRQPRHVTKAMAAAEPSSQQPVVNGTTITTNLTGEVPFIDASSPDA----NFPISGVSSEATSAVVSPTTDSGVDMSSQATSKEDLSELDPAS-----PSLSKEKLSHLGVPKYLMERHTYSASVESIPEVLDDNVSLADQSDSASVHDMDYVNPRGVRFTQSSQKEGT--VLVPYGLPCIRELFRFLISLTNPHDRHNSEVMIHMGLQLITVALESAPIENYVS-----LLGLVKDELCRHLFQLLSIERLNLYAASLRACFLLFEGMREHLKFQLEMYIKKLMDIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYCSNLFEDLTKLLSKNAFPVSGQ--LYTTHLLSLEALLTVIDSTESHCQAKNLSNVSQDKKETGKPSGDLSEGTKDSGNREKKTLKKPQRFSCLLPNVQELNDIKTKKKLLITGTEQFNQKPKKGVQFLQEKDLLATPMDNAEVAQWLRENPRLDKKMIGEFVSDRKNLDLLESFFFVAAY-CLRVDEALRLYLEAFRLPGEAPVIQRLLEAFTEHWRKSNGTPFAHSDACFALAYAVIMLNTDQHNHNVRKQNVPMTLEEFRKNLKGVNGGKDF---DQDMLEDIYHAIKNEEIVMPEEQTGLVKENYFWNVLLHRGATPEGMFLHVDPGSYDHDLFTMTWGPTIAALSYVFDKSMDETIIQKAISGFRKCAMISAHYGLSDVFDNLIISLCKFTTLSS--EAVENLPTVFGSNLKAQIAAKTVFHLSHRHGDILREGWKNIMDSMLQLFRAELLPKAMVEVEDFVDPNGKISLQREEIPANRGESTVLSFVSWLTLSGTEQSSLRGPSTENQEAKKLALECIKLCDPEKLITESKFLQLESLQELMKALI--------------------------SVTPDEETY----DEEDAAFCLEMLMRIVLENRDRVGCVWQAVRDHLYRLCVHAVEFCFLVERAVVGLLRLAIRLLRREEISGQVILSLRILLMMKPTVLSKVSRQVAFGVHELLKTNAANIHSSNDWYTLFCLLECIGAGVKPPP----------------ALQVTTRADNDTGAQSDSEVSSYHPSEVN-LD--------------------RGYTSDSEVYAEHSKQSKMHRSVTDVDMMNSGWLMV--GKEDVDSSKVATVINKPVANAP----------VNQYSLTIGL-DFGPHDTKSLMKSVESLSFIVRDAAHVTPENFELCVKTIRVFVEASLNGGYKSQEKRVKNHKYDSKSNRFKKKTKEKENSVRRTRASNQRQYRSHSD-DEEDESVPASYHTVSLQ-----VSHDLLDLMHTLHTRAATIYSSWAEEQRNLETAAEKITADSK---TLWSNCWCPLLQGIAWLCCDARRQVRMQALTYLQRALLVHDLQALDALEWESCFNKVLFPLLTKLLENI-SPAD-VGGMEET-----RMRGSTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHAGSS-DLLPEAIPESLKNMLLVMDTA----GIFHSADSRTGYSDLWEITWERIDCFLPRLREELFKQTVI 1672          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Cavefish
Match: gbf1 (golgi brefeldin A resistant guanine nucleotide exchange factor 1 [Source:ZFIN;Acc:ZDB-GENE-081107-54])

HSP 1 Score: 959.133 bits (2478), Expect = 0.000e+0
Identity = 654/1810 (36.13%), Postives = 973/1810 (53.76%), Query Frame = 1
Query:   85 YVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLS-ELLRHTAECTLERIVHLLFTRLPELKEDTR--IRKNNLTINMDXXXXXXXXXXXXXIPIPSESHSDTSHPPEDSCSDEIIVTPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNEDISVNNEIEPLADDTDSQVLFDLTRIESNCTI-NFEPSGNPELSSLNIKSDNIQYRTENGIVFK-----------SDLSGAADNSDNENATCKGSKSEKLPLKSKTQSTTTPYGLACVQKLLSNLILILSPENIFHTN-HVRTGLTLITAAFESGADYISKAP-NVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCI----------NSRKDDLNRAIYYDSES-------------------SETNPEKKIKLTNPMLY---------------KKRIIKIGTEKFNNDIKDGIKYLREQGFCQT---NQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE----AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVIS--HWFFSLTSSDYSSGQRNQ--EDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELY--------KTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCV----KSSLNKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDEL----HYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEW----------NNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAG--QLLKLTCDRLYTFLPDLVEELFYEPLLP 5214
            Y+VQ EI+ ++ AIKR  + S      EE  DPL ++ S +K  L+ I +LS+++P  FL PFL+V+ S +  G ITGLALT+V KFLS+  ID +    ++G    IE +A+ VT+ +F+GTD +SDEV+LMKIL++L TL+  P G  +++ +VC+I+ SCFRICFE +LS E   H   C     V   F RLP+ KE+ +  +  N   + M    +S  S+ +++   P  S      P      D+  +T   SN+       I     S   L    + A S    + ++ +   +  T  + L DL +  S  T     P+ +P    L  +   ++ RT++  V             ++ S +A   D +    +G +  +     K  +   PYGL C+++L   LI + +P +  +++  +  GL L+  A E  A +I  AP   LL  +++EL ++ I LL  DR++ +AAS RVCFL+FE MR HLKFQLEMYL +L+ II S+N  +PYE +E+ALE+IV LWRIPSF+TELY+NYDCD YCS+L  +L  L  K A P      L  T +++L+ALL +I+            N+ + D +  +  + E+                   SE++  KK  L  P  +               KK+++  GTE+FN   K GI++L+E+G   +   N E+A   RENPRL+K  IGE++  R N+ + + ++  F F+GLR+D A+R++L+ FRLPGEA  IQ +LE F   +H  N       D+ F L YA++MLN DQHN N +KQ  PMT+EQF++NL   N  K   + ++++L  IY AIK EEIVMP EQ G++K+NY+W  LL R  T    ++     ++ ++LF++ W   + A  YVF+  +D  I      G  +CA I+A+Y   ++ D +II + K+T  SS  E++E     FG N K ++AAK++F +A +HGDILR+GWKN++D +L LF+A+LLPK + EV+DF+  +  I L  E+    + E+ +V+S  +W  +L+     SG R    E++  K  A+  I +C    LI E++FL+  SL E + ALI                          +++ D  ++    DE+   FCLE+++R++L N DR++     + DH Y + + +    FL+ER VV  LRLAI+LLR+++   QV   L +L + K  VL  V+  V  GLH+L+  +AANI    DW  L +++E  G G K                Q+TS    S +     S++S Y     E+  ++D                    RGYTSDSE+Y          +  ++D   W++V   +D +  NK++   G           + P PI NQY++ L        D  ++ K  E LS++VRD AH+TP NFE CV  +RVF E  +    ++   KKS  ++ +     K PR +   +  TK     P     SH SD D EDE     ++ +S Q     ++++LLDLMHTLH RAA IY  W             I  DS+    LW +CWCPLLQGMA LCCD R +VR  A+T+LQR+LL   L +L   +WE CF KVLFPLL+  L+NI S +D +    +T     RMRA  +L+KVFLQHL  L  L TF ALWLTIL++MD YM A ++ D L +A+ ESLKN+LLVM T      I   ++S  G   L ++T +R+  FLP L EELF + ++P
Sbjct:    7 YIVQGEISTVVGAIKRNSRWSTHTPLDEE-QDPLLNSFSQVKDILNNIKELSDVEPNVFLRPFLEVVRSEDTTGPITGLALTSVNKFLSYGLIDANHEGAAEG----IENMADAVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSGESTCHFEAC----CVACSFHRLPQFKEEAKSFVGANMKKLKMRAGGMSESSKWKKQKRSPRPSRHMIRSP--SGQMDQAQLT-TLSNNLSGGVPFIEQQSGSSGSLPASDSVASSISSPTTDSGLYNCSKTTSKEDLTDLEQSSSTATTPGTAPNTDPGQLDLQCEGKQVE-RTQSASVESIPEVLEDRDSLAEQSDSASVHDMDYVNPRGVRFTQS--TQKEGAALIPYGLPCLRELFRFLISLTNPHDRHNSDVMMHMGLQLLNVALE--ATHI--APYQSLLVLVKDELCRHLIQLLSVDRMNLYAASMRVCFLLFEGMRGHLKFQLEMYLKKLMDIITSENPKMPYEMKEMALEAIVHLWRIPSFVTELYINYDCDFYCSNLFEDLTKLLSKNAFPVSGQ--LYTTHLLSLEALLTVIDSTEAHCQAKGMNNAAEQDQSETLTVEGETTVSSSTDAATGILSLHYLMSESSASKKT-LKKPHRFSSCLPDSQDLIDIKNKKKLLITGTEQFNQKPKKGIQFLQEKGLLSSPMDNNEVAQWLRENPRLDKKMIGEFVSDRKNMELLDSFVNTFTFQGLRIDEALRLYLEAFRLPGEAPVIQRLLETFTDNWHKVNGNPFLTNDAGFALAYAVIMLNTDQHNHNVRKQNIPMTIEQFRKNLKGVNGGK---DFDQDMLEDIYNAIKNEEIVMPDEQTGLVKENYVWSVLLHRGATPEGFFLHVPAGSYDHDLFSMTWGPTIAALSYVFDKSLDDTIIQKAIAGFRKCALISAHYGFSDVFDNLIISLCKFTTLSS--ESVENLPTVFGSNWKAQVAAKTVFNLAHRHGDILREGWKNIMDAMLQLFRAELLPKPMVEVEDFVEPNGKISLQREETPSNRGES-AVLSFVNW-LTLSGGAEQSGLRGPSTENQEAKQAAILCIKQCDPEKLITESKFLQLESLQELMKALI--------------------------SVTPDEETY----DEEDAAFCLEMLLRIVLENRDRVSCVWQTVRDHLYHLCVHANESCFLVERAVVGLLRLAIRLLRREDISSQVLLSLRLLLMMKPHVLSRVSREVAYGLHELLKTNAANIHCTDDWYTLFSLLECIGAGVKPPAAL-----------QVTSTNPDSDTGAQSDSEISSYH--QSEV--TLD--------------------RGYTSDSEVYTEHGKSRIPRSATDVD-VGWLVV--GKDDLDGNKASVAPGSK--------PQTPPPI-NQYSLTLGQ-DMGLHDTKSLIKCVESLSFIVRDAAHVTPENFELCVKAIRVFVEASLNGGYRTHEKKKSHKYDSKSSRLRKKPREKEGVSRRTKTTSQRP---SRSH-SD-DEEDEGVPASYHTVSLQ-----VSQDLLDLMHTLHTRAASIYSSWAEEQRHLETGGRKIEADSQ---TLWSSCWCPLLQGMAWLCCDARRQVRMQALTYLQRALLVHDLQTLDAIEWESCFNKVLFPLLTKLLDNI-SPAD-VGGMEET-----RMRACTLLSKVFLQHLSPLLSLPTFAALWLTILDFMDKYMHAGSS-DLLLEAIPESLKNMLLVMDTA----GIFHSADSRTGYSDLWEITWERIDCFLPRLREELFKQAVMP 1684          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Cavefish
Match: arfgef2 (ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited) [Source:ZFIN;Acc:ZDB-GENE-090312-50])

HSP 1 Score: 146.362 bits (368), Expect = 1.611e-34
Identity = 144/579 (24.87%), Postives = 253/579 (43.70%), Query Frame = 1
Query: 1429 LSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQV-------IALDALLFMINCINSRKDDLN-----RAIYYDSESSETNPEKKI----------------------KLTNPMLY-----KKRIIKIGTEKFNNDIKDGIKYLREQGFCQTNQE-LASLFRENPRLNKTFIGEYIC--TRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSN--PEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVM------------------PSEQRGIIKDNYL------WRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLL 2961
            LSKN +    S     F  S  +   +    + HLK Q+E++  R I + I +  +  +E++ + ++++ ++      + ++Y+NYDCDL  +++   L +   KIA   RS + L  T +         L+ L+ ++ C+     DL      +A       +E   E K+                      +  +P  Y     +K II+ G + FN   K G++YL+EQG   T+ E +A    +  RL  T +GE++    + N  V   Y+   +F G     A+R FL+ FRLPGEA  I  ++E FA  Y   N    + +  D+ +VL Y+I+ML  D H+P  K +   MT EQ+ +     N  K   ++ EE L+ IY+ I  ++I M                    +QR ++ +  +       + L+     + A + SA +  H   +F L W   + AF    +   D  + +    G+     IA  + +    D  I  ++++T+ ++S    E   KN  T    K++  +A   G+ L + W  +L C+  L  A+L+
Sbjct:  494 LSKNGV----SSVPEVFELSLAIFLTLLSHFKVHLKMQIEVFF-REIFLTILETSSSSFEHKWMVIQTLTRICADAQCVVDIYVNYDCDLNAANIFERLVNDLSKIAQ-GRSGQELGMTPLQELSLRKKGLECLVSILKCMVEWSRDLYVNPNLQANLGQEHQAEGEAEPKLPEHLSSRRDSVSSQDSAVSSSVQHDHPEQYEVIKQQKEIIEHGIDLFNKKPKRGVQYLQEQGMLGTSAEDIAQFLHQEERLCTTQVGEFLGENAKFNKEVMYCYVDQLDFCGKDFVSALRTFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQVKNK---MTKEQYIKMNRGINDSK---DLPEEYLSSIYDEIAGKKIAMKESKEYSITPKSSKQSVASEKQRRLLYNMEMEQMAKTAKALMEAVSHAQAPFFSATHLEHVRPMFKLAWTPLLAAFSVGLQDCDDQEVASLCLEGIRCAIRIACIFGMQLERDAYIQALARFTLLTASSSITEMKQKNIDT---IKTLITVAHTDGNYLGNSWHEILRCISQLELAQLI 1057          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Cavefish
Match: arfgef1 (ADP-ribosylation factor guanine nucleotide-exchange factor 1 (brefeldin A-inhibited) [Source:ZFIN;Acc:ZDB-GENE-030131-108])

HSP 1 Score: 140.584 bits (353), Expect = 8.425e-33
Identity = 136/551 (24.68%), Postives = 240/551 (43.56%), Query Frame = 1
Query: 1534 KFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQV-------IALDALLFMINCINSRKDD----------LNRAIYYDSESSETNPEKKI-------------------------KLTNPMLY-----KKRIIKIGTEKFNNDIKDGIKYLREQGFCQTNQE-LASLFRENPRLNKTFIGEYICT--RNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSN--PEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDN--YLWRQLLRRCLTS--------------------NATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCA-SIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLL 2961
            + Q+E++   +   I+ +     Y+++ + ++++ ++      + ++Y+NYDCDL  +++   L +   KIA   R    L  T +         L+ L+ ++ C+     D          L +    + ES+E+   + I                            NP  +     +K II+ G + FN   K GI+YL+EQG   T  E +A    +  RL+ +  GE++    R N  V   Y+   +F+G     A+RMFL+ FRLPGEA  I  ++E FA  Y   N    + +  D+ +VL Y+I+ML  D H+P  K +   MT EQ+ +     N  K   ++ EE L+ IY+ I  ++I M   +   +K N   +  +  RR L +                     A + SA +  H   +F L W   + AF    + + D     S+ +   +CA  IA  + +    D  +  ++++T+ ++S    E   KN  T    K++  +A   G+ L + W  +L C+  L  A+L+
Sbjct:  177 EMQIEVFFKEIFLYIL-ETSTSSYDHKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANIFERLVNDLSKIAQ-GRGGHELGTTPLQELTLRKKGLECLVSILKCMVEWSKDQYVNPNSQTSLGQEKPSEQESNESKHPETINRYGSINSLDSTASSGIGSYSTQMSGTDNPEQFEVLKQQKEIIEQGIDLFNKKPKRGIQYLQEQGMLGTTPEDIAQFLHQEERLDSSQAGEFLGDNDRFNKEVMYAYVDQMDFQGKDFVSALRMFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQVKNK---MTKEQYIKMNRGINDSK---DLPEEYLSAIYDEIAGKKISMKETKELTLKSNKQSVASEKQRRLLYNVEMEQMAKTAKALMEAVSHVQAPFTSATHLEHVRPMFKLAWTPFLAAFSVGLQ-DCDDTEVASLCLEGIRCAIRIACIFTIQLERDAYVQALARFTLLTASSGITEMKQKNIDT---IKTLITVAHTDGNYLGNSWHEILKCISQLELAQLI 715          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Cavefish
Match: arfgef2 (ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited) [Source:ZFIN;Acc:ZDB-GENE-090312-50])

HSP 1 Score: 134.42 bits (337), Expect = 6.736e-31
Identity = 143/570 (25.09%), Postives = 240/570 (42.11%), Query Frame = 1
Query: 1429 LSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQV-------IALDALLFMINCINSRKDDLNRAIYYDSESSETN-PEK-----------------KIKLTNPMLY-----KKRIIKIGTEKFNNDIKDGIKYLREQGFCQTNQE-LASLFRENPRLNKTFIGEYIC--TRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSN--PEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVM------------------PSEQRGIIKDNYL------WRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLL 2961
            LSKN +    S     F  S  +   +    + HLK Q+E+            +  + Y    V   S+         + ++Y+NYDCDL  +++   L +   KIA   RS + L  T +         L+ L+ ++ C+     DL       +   E N PE                   ++  +P  Y     +K II+ G + FN   K G++YL+EQG   T+ E +A    +  RL  T +GE++    + N  V   Y+   +F G     A+R FL+ FRLPGEA  I  ++E FA  Y   N    + +  D+ +VL Y+I+ML  D H+P  K +   MT EQ+ +     N  K   ++ EE L+ IY+ I  ++I M                    +QR ++ +  +       + L+     + A + SA +  H   +F L W   + AF    +   D  + +    G+     IA  + +    D  I  ++++T+ ++S    E   KN  T    K++  +A   G+ L + W  +L C+  L  A+L+
Sbjct:  401 LSKNGV----SSVPEVFELSLAIFLTLLSHFKVHLKMQIEVM-----------DHTLHYSTVSVFHRSLFSSASDAQCVVDIYVNYDCDLNAANIFERLVNDLSKIAQ-GRSGQELGMTPLQELSLRKKGLECLVSILKCMVEWSRDLYVNPNLQANLGERNLPEHLSSRRDSVSSQDSAVSSSVQHDHPEQYEVIKQQKEIIEHGIDLFNKKPKRGVQYLQEQGMLGTSAEDIAQFLHQEERLCTTQVGEFLGENAKFNKEVMYCYVDQLDFCGKDFVSALRTFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQVKNK---MTKEQYIKMNRGINDSK---DLPEEYLSSIYDEIAGKKIAMKESKEYSITPKSSKQSVASEKQRRLLYNMEMEQMAKTAKALMEAVSHAQAPFFSATHLEHVRPMFKLAWTPLLAAFSVGLQDCDDQEVASLCLEGIRCAIRIACIFGMQLERDAYIQALARFTLLTASSSITEMKQKNIDT---IKTLITVAHTDGNYLGNSWHEILRCISQLELAQLI 945          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Cavefish
Match: si:dkey-283b15.4 (cytohesin 2 [Source:HGNC Symbol;Acc:HGNC:9502])

HSP 1 Score: 117.087 bits (292), Expect = 2.841e-27
Identity = 74/199 (37.19%), Postives = 111/199 (55.78%), Query Frame = 1
Query: 1927 LYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQ-TNQELASLFRENPRLNKTFIGEYICTRN--NVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQF---KRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSE 2505
            L K R + +G +KFN D K GI +L E    + T +++A    +   LNKT IG+Y+  R+  N+ V + ++ L  F  L L  A+R FL  FRLPGEA  I  ++E FA+ Y   NP +    D+ +VL +AI+MLN   HNPN + +    TVE+F    R + E       G++ EE+L  +Y++IK E   +P +
Sbjct:   76 LQKSRHVAMGRKKFNMDPKKGIVFLVENELLRHTPEDIAQFLYKGEGLNKTAIGDYLGERDEFNIRVLQAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCHCNPGVFQSTDTCYVLSFAIIMLNTSLHNPNVRDKP---TVERFISMNRGINE------GGDLPEELLRNLYDSIKNEPFKIPED 265          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Sea Lamprey
Match: gbf1 (golgi brefeldin A resistant guanine nucleotide exchange factor 1 [Source:ZFIN;Acc:ZDB-GENE-081107-54])

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 409/1140 (35.88%), Postives = 611/1140 (53.60%), Query Frame = 1
Query: 1933 KKRIIKIGTEKFNNDIKDGIKYLREQGFCQTNQ---ELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE----AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQRN--QEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQED-VDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELY-----------KTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLT---TAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSL---NKKSSIHNREYCDS-GKSPRGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDELHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEWNNTISNDSELNVR---------------LWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLD--DAVRESLKNVLLVMYTGTQDRAILVKSESEAG--QLLKLTCDRLYTFLPDLVEELFYEPLL 5211
            KK+++  GTEKFN   K GI++L+E     T     E+A   R+NPRL+K  IGE++  R +  +   ++K F F  LR+D ++R++L+ FRL GEA  I  +LE F   +H  N     + D+ F L YA++MLN DQHN N +KQ  PMT+E+FK+NL   N  K   + E+++L +IY AI+ +EIVMP E  G+++DNY+W  LL R ++    ++      +  +LF + W   + A  +VF+   D  I         +CA I+AYY L ++ D +II + K+T+ S+  E+++     FG N K +L+AK++F +A +HGDILR+GWKN++D +L +F+AKLLPK++ EV+DF+  +  I ++ E+    ++++ ++ S   +   S    SGQR    ED+  K  A+  I +C    L+ E+RFL+  SL E + AL                          +++S ++     G DE++ VF LE++++++L N DR+      + DH Y +++ +  H FLLER VV  LRLAI+LLR++E+   QV   L +L L K +VL   +  +  GLH+L+  +AANI S++DW  L T++E  G G K          + L+      +  S   ++ EL         H+         PN +            S RGYTSD+E+Y            TT  ++  + W+LV   +D V                       P P+VNQY++ L     AH    D  ++ K  E LS++VRD AH+TP NF  CV  +R+F E  +   +   +KK+  H  E      K  + R    G          +HK + +SD D +++     S      +++  LLDLMHTLH RAA IY  W       +E  VR               LW +CWCPLLQG ARLCCD R +VRT A+T+LQR+LL   L +L+  +WE CF KVLFPLL+  LENI       +  +QT   + RMR   +L+KVFLQHL  L  L TF ALWLTIL++MD YM A+N+   L   +A+ ESLKN+LLVM T      I   +E+  G  QL ++T +R+  FLP L +ELF +P++
Sbjct:  648 KKKLLMKGTEKFNVKPKTGIEFLQENKLLATPMDCTEVARWLRDNPRLDKKMIGEFVSDRKHKELLSAFVKTFTFETLRIDESLRLYLEAFRLSGEAPVIHRLLEAFTDQWHVMNGSPFVNNDACFALAYAVIMLNTDQHNHNVRKQNVPMTLEEFKKNLKGVNGSK---DFEQDMLEEIYNAIRNDEIVMPEEHTGLVRDNYMWNLLLHRGVSQEGLFLHVPGGAYHLDLFTMSWGPTIAALSFVFDKSTDETIIQKAISSRRKCAMISAYYGLSDVFDNLIISLCKFTMLSN--ESVDNLPVMFGSNPKAQLSAKTVFNLAHRHGDILREGWKNIMDSMLQIFRAKLLPKSMVEVEDFVDPNGRISILREESPSQRSDS-TMFSFVNWLTLSGPEQSGQRGPSAEDQEFKKIAMKCIEECHPEQLLTESRFLRLESLQELMKAL--------------------------SSMSMEDE----GYDEEAAVFYLEMLLQIILQNKDRVGCLWQTVRDHLYQLIVHASEHCFLLERAVVGLLRLAIRLLRREENSTPQVLHSLRVLLLMKPAVLAKASRQIAFGLHELLKTNAANIHSQEDWSTLFTLLECIGAGAKPP--------SSLQYMAGVEVADSGAQSDSELPS-------HQ---------PNGV-----------TSDRGYTSDTEVYTEHNKPARMHRSTTDLDISGSGWLLV--GKDDVEGGGGGA--------GGGGGGGRPSPLVNQYSLSLGQELGAH----DTKSLTKCVESLSFIVRDAAHVTPDNFPLCVRAIRIFVEASLNGGIKGSDKKTKTHKYEKPSRLKKKGKDRDGGGGRRGNGGGGRSVHKGAAHSDDDDDEDESVPASYH----TVSLQLLDLMHTLHTRAASIYSSW-------AEEQVRQEAATPTADAADASTLWASCWCPLLQGTARLCCDARRQVRTQALTYLQRALLMHDLQTLSALEWEACFNKVLFPLLTKLLENI-------SPADQTGMEETRMRTSTLLSKVFLQHLSPLLSLPTFAALWLTILDFMDKYMHADNSDLLLPEMEAIPESLKNMLLVMDTA----GIFQNAEARTGFSQLWEITWERIDCFLPQLRDELFRQPVI 1680          

HSP 2 Score: 183.726 bits (465), Expect = 1.024e-46
Identity = 121/350 (34.57%), Postives = 188/350 (53.71%), Query Frame = 1
Query:  811 EDSCSDEIIVTPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNED-ISVNNEI---EPLADDTDSQVLFDLTRIESNCTINFEPSGNPELSSLNIKSDNIQYRTENGIVFKSDLSGAADNSDNENATCKGSKSEKLPLKSKTQSTTTPYGLACVQKLLSNLILILSPENIFHTNH----VRTGLTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINS 1836
            + S SD  + +P+   + D ASE+ ++   S++   +  T  E  E   S+N+ +   E + +D++ Q        ES C         P L     +  ++ Y    G+ F ++ S +A +                       +   PYGL CV++L   L+   S  N++  ++    V  GL L+T A E+  + ++   + LL+ +Q++L ++ I LL  +RL  FAAS RVC L+FESMR HLKFQLEMYL +L+ +I S++  +PYE +E+ALE++VQLWRIP  +TELY+NYDCD YCS+L  EL  L  K A P      L  T +++L+ALL +IN I +
Sbjct:  235 QGSLSDAGMPSPSEQPACDSASELTADHTSSQESGTWAATLHEEPETRASLNSALCSEETIPEDSEGQ--------ESPC--------EPPLH----EGRDLDYVNPRGVRF-TNFSQSAPSG---------------------TTVLLPYGLPCVRELFRFLV---SLTNLYDRHNSDVMVHMGLQLLTVAMETAHESVAHYAS-LLALVQDDLCRHLIQLLGMERLGLFAASLRVCLLLFESMREHLKFQLEMYLKKLMDVITSESPRLPYEMKEMALEAVVQLWRIPGLVTELYINYDCDFYCSNLFEELTKLLSKNAFPITGQ--LYTTHLLSLEALLTVINSIEA 536          

HSP 3 Score: 147.132 bits (370), Expect = 1.585e-35
Identity = 78/154 (50.65%), Postives = 112/154 (72.73%), Query Frame = 1
Query:  232 DLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTR 693
            +LSE++   FL PFL+VI S +  G ITGL+L++V KFLS+  ID +     DG   A E +A+ +T+ +F+GTD +SDEV+LMKIL++L  L+  P G  +++ +VC+I+ SCFRICFE++LSELLR +AE TL  +V LLF RLPE KE+++
Sbjct:    1 ELSEVEANVFLGPFLEVIRSEDTTGPITGLSLSSVNKFLSYGLIDPA----HDGAAAAAENMADAITHARFVGTDPASDEVVLMKILQVLRMLLLTPVGSHLTNESVCEIMQSCFRICFESRLSELLRKSAEHTLVDMVQLLFARLPEFKEESK 150          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004144.1 (pep scaffold:Pmarinus_7.0:GL477097:6043:63444:-1 gene:ENSPMAG00000003754.1 transcript:ENSPMAT00000004144.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.88 bits (333), Expect = 3.744e-31
Identity = 121/476 (25.42%), Postives = 211/476 (44.33%), Query Frame = 1
Query: 1663 ITELYLNYDCDLYCSDLLHELADLFCKIA----------TPDRSVRCLMNTQVIALDALLFMINCINSRKDDLNRAIYYDSESSETNPEKKIKLTNPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQTNQE-LASLFRENPRLNKTFIGEYICTRN--NVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSN--PEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVM------------PSEQRGIIKDNYLWRQLL-----------RRCLTS-----NATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLL 2961
            + ++Y+NYDCDL  +++   L +   KIA          TP++     ++ +   LD L+ ++ C+    +           S   NPE+   L      +K II+ G E FN   K GI++L+EQ    T  E +A       RL+ T +G+Y+   +  N      Y+   +F G     A+R+FL+ FRLPGEA  I  ++E FA  +   N    + +  D+ +VL Y+I+ML  D H+   K +   M+ EQ+ +     N  K   ++ EE L+ IY+ I  ++I M            P  + G    +   R+LL            + L        A + SA + +H   +F L W   + AF    +   D+ + +    G+     IA  +++    D  +  ++++T+ +++    E   KN  T    K++  +A   G+ L + W  +L C+  L  A+L+
Sbjct:  398 VVDIYVNYDCDLNAANIFERLVNDLSKIAQGRSGQELGITPNQE----LSLRKKGLDCLVSILKCMVEWTNIYCIGSVSTQLSGADNPEQFEVLKQ----QKEIIEQGIELFNKKPKRGIQFLQEQNMLGTTTEDVAQFLHSENRLDSTQVGDYLGENDKLNKETMYTYVDQMDFSGKDFVSALRLFLEGFRLPGEAQKIDRLMEKFAARFCECNQGQTVFASADTAYVLAYSIIMLTTDLHSLQVKHK---MSKEQYIKMNRGINDSK---DLPEEYLSSIYDEIAGKKIAMMILTPSILRPLPPPARHGTDVASERQRRLLYNLEMEAMSRTAKALMEAVSHVQAAFTSATHLDHVRPMFKLAWTPFLAAFSVGLQDCDDTEVASLCLDGIRGAIRIACIFHMQLERDAYVQALARFTLLTANSGITEMKQKNIDT---IKTLIMVAHTDGNYLGNSWHEILKCISQLELAQLI 856          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004134.1 (pep scaffold:Pmarinus_7.0:GL477097:5536:63408:-1 gene:ENSPMAG00000003754.1 transcript:ENSPMAT00000004134.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.339 bits (329), Expect = 1.057e-30
Identity = 126/497 (25.35%), Postives = 217/497 (43.66%), Query Frame = 1
Query: 1663 ITELYLNYDCDLYCSDLLHELADLFCKIA----------TPDRSVRCLMNTQVI-----ALDALLFMINCI-------------NSRKDDLNRAIYYDSESSET------NPEKKIKLTNPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQTNQE-LASLFRENPRLNKTFIGEYICTRN--NVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSN--PEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVM---------PSEQRGIIKDNYLWRQLL-----------RRCLTS-----NATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLL 2961
            + ++Y+NYDCDL  +++   L +   KIA          TP+++   + + Q +      LD L+ ++ C+              S  D L+        S  T      NPE+   L      +K II+ G E FN   K GI++L+EQ    T  E +A       RL+ T +G+Y+   +  N      Y+   +F G     A+R+FL+ FRLPGEA  I  ++E FA  +   N    + +  D+ +VL Y+I+ML  D H+   K +   M+ EQ+ +     N  K   ++ EE L+ IY+ I  ++I M         P  + G    +   R+LL            + L        A + SA + +H   +F L W   + AF    +   D+ + +    G+     IA  +++    D  +  ++++T+ +++    E   KN  T    K++  +A   G+ L + W  +L C+  L  A+L+
Sbjct:  417 VVDIYVNYDCDLNAANIFERLVNDLSKIAQGRSGQELGITPNQAHVAVQSVQELSLRKKGLDCLVSILKCMVEWSKDQYINPNSQSNLDSLDSTASSGIGSVSTQLSGADNPEQFEVLKQ----QKEIIEQGIELFNKKPKRGIQFLQEQNMLGTTTEDVAQFLHSENRLDSTQVGDYLGENDKLNKETMYTYVDQMDFSGKDFVSALRLFLEGFRLPGEAQKIDRLMEKFAARFCECNQGQTVFASADTAYVLAYSIIMLTTDLHSLQVKHK---MSKEQYIKMNRGINDSK---DLPEEYLSSIYDEIAGKKIAMNESILRPLPPPARHGTDVASERQRRLLYNLEMEAMSRTAKALMEAVSHVQAAFTSATHLDHVRPMFKLAWTPFLAAFSVGLQDCDDTEVASLCLDGIRGAIRIACIFHMQLERDAYVQALARFTLLTANSGITEMKQKNIDT---IKTLIMVAHTDGNYLGNSWHEILKCISQLELAQLI 900          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004124.1 (pep scaffold:Pmarinus_7.0:GL477097:5491:41441:-1 gene:ENSPMAG00000003754.1 transcript:ENSPMAT00000004124.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.939 bits (302), Expect = 1.233e-27
Identity = 122/513 (23.78%), Postives = 219/513 (42.69%), Query Frame = 1
Query: 1663 ITELYLNYDCDLYCSDLLHELADLFCKIA----------TPDRSVRCLMNTQVIALDALLFMINCI-----------NSRKD-DLNRAIYYDSESSETNPEK---------------------KIKLT---NPMLY-----KKRIIKIGTEKFNNDIKDGIKYLREQGFCQTNQE-LASLFRENPRLNKTFIGEYICTRN--NVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSN--PEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVM------------------PSEQRGIIKD------NYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLL 2961
            + ++Y+NYDCDL  +++   L +   KIA          TP++     ++ +   LD L+ ++ C+           NS+ +    R    D+     +PE                        +L+   NP  +     +K II+ G E FN   K GI++L+EQ    T  E +A       RL+ T +G+Y+   +  N      Y+   +F G     A+R+FL+ FRLPGEA  I  ++E FA  +   N    + +  D+ +VL Y+I+ML  D H+   K +   M+ EQ+ +     N  K   ++ EE L+ IY+ I  ++I M                     QR ++ +      +   + L+       A + SA + +H   +F L W   + AF    +   D+ + +    G+     IA  +++    D  +  ++++T+ +++    E   KN  T    K++  +A   G+ L + W  +L C+  L  A+L+
Sbjct:    6 VVDIYVNYDCDLNAANIFERLVNDLSKIAQGRSGQELGITPNQE----LSLRKKGLDCLVSILKCMVEWSKDQYINPNSQSNLGKERPAEQDATVDSRHPETIGRYGSVNSLDSTASSGIGSVSTQLSGADNPEQFEVLKQQKEIIEQGIELFNKKPKRGIQFLQEQNMLGTTTEDVAQFLHSENRLDSTQVGDYLGENDKLNKETMYTYVDQMDFSGKDFVSALRLFLEGFRLPGEAQKIDRLMEKFAARFCECNQGQTVFASADTAYVLAYSIIMLTTDLHSLQVKHK---MSKEQYIKMNRGINDSK---DLPEEYLSSIYDEIAGKKIAMNESKEFAQISRPPKPNVASERQRRLLYNLEMEAMSRTAKALMEAVSHVQAAFTSATHLDHVRPMFKLAWTPFLAAFSVGLQDCDDTEVASLCLDGIRGAIRIACIFHMQLERDAYVQALARFTLLTANSGITEMKQKNIDT---IKTLIMVAHTDGNYLGNSWHEILKCISQLELAQLI 505          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Sea Lamprey
Match: si:dkey-283b15.4 (cytohesin 2 [Source:HGNC Symbol;Acc:HGNC:9502])

HSP 1 Score: 104.76 bits (260), Expect = 9.378e-24
Identity = 69/205 (33.66%), Postives = 110/205 (53.66%), Query Frame = 1
Query: 1924 MLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQ-TNQELASLFRENPRLNKTFIGEYICTRN--NVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSD-----PDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQF---KRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSE 2505
            ++ + + + +G +KFN D K GI++L E    + T +++A    +   LNKT IGEY+  R+  N+ V   +++L  F  L L  A+R FL  FRLPGEA  I  ++E FA  Y   N  +         D+ +VL +AI+MLN   HNPN + +    T E+F    R + +       G++ EE+L  +Y++IK E   +P +
Sbjct:   61 IVQRNKQMSMGRKKFNMDPKKGIRFLTENELLKNTPEDIAQFLYKGEGLNKTAIGEYLGERDDFNIQVLHAFVELHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMEAFATRYCQCNAGVFQSTGGVATDTCYVLSFAIIMLNTSLHNPNVRDKP---TTERFILMNRGIND------GGDLPEELLRNLYDSIKNEPFKIPED 256          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Yeast
Match: GEA2 (Guanine nucleotide exchange factor for ADP ribosylation factors (ARFs); involved in vesicular transport between the Golgi and ER, Golgi organization, and actin cytoskeleton organization; GEA2 has a paralog, GEA1, that arose from the whole genome duplication [Source:SGD;Acc:S000000748])

HSP 1 Score: 219.935 bits (559), Expect = 4.997e-58
Identity = 186/661 (28.14%), Postives = 316/661 (47.81%), Query Frame = 1
Query: 1249 YGLACVQKLLSNLILILSPEN-IFHTNHVRT-GLTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQ-SDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISD---------NENIPYEYREVALESIVQLW-RIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINSRKDDLNRAIYYDSESSETNPEKKIKLTNPM-LYKKRIIKIG----TEKFNNDIKDGIKYLREQGF--CQTNQELAS-LFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAY---HTSNPEMVS------------DPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYK---------------NHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE--------------------------------AFGKNEKTKLAAKSMFQIAQKHGD---ILRDGWKNLLDCLLCLFKAKLLPKNL 2973
            YGL  V++ L+ L+ +++PEN + H+   R  GL LI  A E   D +   P  L + I + + K+ + ++Q + +LS   A+ ++   +   + ++L+ Q+E+ L+R+ SI++ D         N+N P   +E+ +E I  LW R PSF T  ++N+DC+L  +D+         K+A P+ ++    +   I L+ L+ +++ +     D++R             E+  +  N M + KKR  K      T  FN   K GI  L E+GF    +++++A  LF  N R+NK  IG  +C  + V +  EYI+LF+F GLR+D AIR+ L +FRLPGE+  I+ I+E F+ AY      +P  +S            D DS F+L Y+I+MLN D HNP  K+    M+ E +  NL      K +       L++IY +I+ +EIVMP E  G    N  W +     L S+ T I+   K               N    +F  V  S V+    ++ V  D  I+T M   L +C+ I+A+++  ++ + I+  I+K T   +S    E                                 FG++ K +L     F+I +++ D     ++ W N+++ +L L++  +L  ++
Sbjct:  327 YGLPVVRQYLNLLLSLIAPENELKHSYSTRIFGLELIQTALEISGDRLQLYPR-LFTLISDPIFKSILFIIQNTTKLSLLQATLQLFTTLVVILGNNLQLQIELTLTRIFSILLDDGTANNSSSENKNKPSIIKELLIEQISILWTRSPSFFTSTFINFDCNLDRADVSINFLKALTKLALPESALTTTESVPPICLEGLVSLVDDMFDHMKDIDR-------------EEFGRQKNEMEILKKRDRKTEFIECTNAFNEKPKKGIPMLIEKGFIASDSDKDIAEFLFNNNNRMNKKTIGLLLCHPDKVSLLNEYIRLFDFSGLRVDEAIRILLTKFRLPGESQQIERIIEAFSSAYCENQDYDPSKISDNAEDDISTVQPDADSVFILSYSIIMLNTDLHNPQVKEH---MSFEDYSGNLKGCCNHKDFPFW---YLDRIYCSIRDKEIVMPEEHHG----NEKWFEDAWNNLISSTTVITEIKKDTQSVMDKLTPLELLNFDRAIFKQVGPSIVSTLFNIYVVASDDHISTRMITSLDKCSYISAFFDFKDLFNDILNSIAKGTTLINSSHDDELSTLAFEYGPMPLVQIKFEDTNTEIPVSTDAVRFGRSFKGQLNTVVFFRIIRRNKDPKIFSKELWLNIVNIILTLYEDLILSPDI 963          

HSP 2 Score: 80.4925 bits (197), Expect = 1.845e-15
Identity = 47/165 (28.48%), Postives = 91/165 (55.15%), Query Frame = 1
Query:  175 SDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRL 669
            +DP  S    L+  L+++ +L  +  L  L PFL ++S+  + G IT LAL +++KF +   I+ S  N       A  A  N +T+ +F G+   SD+ +L+K++ LL +++  P G L+S+  +  ++ +   +    + SE+LR+ A+ T+  +   +F++L
Sbjct:   69 NDPFLSGFIQLRLMLNKLKNLDNIDSLTILQPFLLIVSTSSISGYITSLALDSLQKFFTLNIINESSQNYIG----AHRATVNALTHCRFEGSQQLSDDSVLLKVVFLLRSIVDSPYGDLLSNSIIYDVLQTILSLACNNRRSEVLRNAAQSTMIAVTVKIFSKL 229          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Yeast
Match: GEA1 (Guanine nucleotide exchange factor for ADP ribosylation factors (ARFs); involved in vesicular transport between the Golgi and ER, Golgi organization, and actin cytoskeleton organization; GEA1 has a paralog, GEA2, that arose from the whole genome duplication [Source:SGD;Acc:S000003792])

HSP 1 Score: 198.749 bits (504), Expect = 1.452e-51
Identity = 195/724 (26.93%), Postives = 323/724 (44.61%), Query Frame = 1
Query: 1084 NIKSDNIQYRT-ENGIVFKSDLSGAADNSDNENATCKGSKSEKLPLKS--KTQSTTTPYGLACVQKLLSNLILILSPENIFH--TNHVRTGLTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSD-RLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISII----ISDN--ENIPYEYREVALESIVQLW-RIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINSRKDDLNRAIYYDSESSETNPEKKIKLTNPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGF--CQTNQELAS-LFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNP-------------------------EMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYG-NVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYL---WRQLLRRCLTSNATYISADYKNH----------SYE--LFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQET-----------IEAF-----------------GKNEKTKLAAKSMFQIAQKHGD---ILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDF 2991
            N+K D I   T +N +    D S  AD++ NE    +  + ++   ++  K ++    YG+  ++  L  L+ ++ PEN     T+ ++  L LI AA E   D     P  L S I + + K+ + ++QS  + S   A+ ++   +   +  +L  Q+E+ L R+  I+    IS +  +  P   RE+ +E +  LW   P+F  +L++N+DC+L  SDL  +      K + P  +V    N   I L+ +L +I  I +     +RA +  ++       K+I +      K   I +  E FN   K GI+ L E+GF    +N+++AS LF  N RLNK  IG  +C      + +E+I LF+F+GLR+D AIR+ L +FRLPGE+  I+ I+E F+  Y                               +  D DS FVL Y+I+MLN D HNP  K     MT + +  NL    +  Y G +     L+KIY +IK +EIVMP E  G   + +    W  L+    TS  T +  D+ N            YE  +F+ V    +     +F V     I+  +   + +C  I  Y++  +  +  ++++ + T  + S              +E F                 G+N K +L     FQI ++  D   +    W  ++  +L LF+  L+  NL    +F
Sbjct:  254 NLKDDIIGTTTSDNDLSSTDDDSAVADDNKNEKPVQQVIREQENDEETAEKAENVEPNYGITVIKDYLGLLLSLVMPENRMKHTTSAMKLSLQLINAAIEISGDKFPLYPR-LFSLISDPIFKSVLFIIQSSTQYSLLQATLQLFTSLVVILGDYLPMQIELTLRRIFEILEDTTISGDVSKQKPPAIRELIIEQLSILWIHSPAFFLQLFVNFDCNLDRSDLSIDFIKELTKFSLPAAAVNTSNNIPPICLEGVLSLIENIYNDLQRFDRAEFVKNQ-------KEIDILKQRDRKTEFI-LCVETFNEKAKKGIQMLIEKGFIDSDSNRDIASFLFLNNGRLNKKTIGLLLCDPKKTSLLKEFIDLFDFKGLRVDEAIRILLTKFRLPGESQQIERIVEAFSSKYSADQSNDKVELEDKKAGKNGSESMTEDDIIHVQPDADSVFVLSYSIIMLNTDSHNPQVKDH---MTFDDYSNNL----RGCYNGKDFPRWYLHKIYTSIKVKEIVMPEEHHG--NERWFEDAWNNLISS--TSVMTEMQRDFTNPISKLAQIDILQYEKAIFSNVRDIILKTLFKIFTVASSDQISLRILDAISKCTFINYYFSFDQSYNDTVLHLGEMTTLAQSSAKAVELDVDSIPLVEIFVEDTGSKISVSNQSIRLGQNFKAQLCTVLYFQIIKEISDPSIVSTRLWNQIVQLILKLFENLLMEPNLPFFTNF 957          

HSP 2 Score: 88.1965 bits (217), Expect = 9.650e-18
Identity = 52/175 (29.71%), Postives = 93/175 (53.14%), Query Frame = 1
Query:  178 DPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTRIRK 702
            DPL S L  L+  ++ +  L  L  L+ L PFL+++S+  + G  T LAL +++K  + + I+ +  +    +QIA+      +T+ +F  +   SD+ +L+K++ LL  ++    G  +SD  +  ++ +   +    Q SE+LR TAE T+  I   LFT+L  L   T+  K
Sbjct:   73 DPLISGLVQLRLKINDLKGLDSLNALELLKPFLEIVSASSVSGYTTSLALDSLQKVFTLKIINKTFND----IQIAVRETVVALTHCRFEASKQISDDSVLLKVVTLLRDIITSSFGDYLSDTIIYDVLQTTLSLACNTQRSEVLRKTAEVTIAGITVKLFTKLKLLDPPTKTEK 243          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Yeast
Match: SEC7 (Guanine nucleotide exchange factor (GEF) for ADP ribosylation factors; involved in proliferation of the Golgi, intra-Golgi transport and ER-to-Golgi transport; found in the cytoplasm and on Golgi-associated coated vesicles [Source:SGD;Acc:S000002577])

HSP 1 Score: 88.1965 bits (217), Expect = 1.027e-17
Identity = 98/416 (23.56%), Postives = 174/416 (41.83%), Query Frame = 1
Query: 1867 YDSESSETNPEKKIKLTNPMLY-----KKRIIKIGTEKFNNDIKDGIKYLREQGFCQTNQ--ELASLFRENPRLNKTFIGEYICTRN--NVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYG-NVEEEVLNKIYEAIKTEEIVMPSEQRGII--KDNYLWRQ-------LLRRCLTSNA---------------------------TYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTI-GLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNL 2973
            Y+ E S +   + I   +P  +     +K  +      FNN  K  I  L ++GF + +    +A    E   L+   +G+Y+   +  N+ +   ++  F+F G+ +  A+R FL  FRLPGE   I   +  FA+ +   NP + S  D+ +VL Y+++MLN D H+   K +   M++++F  N    N+    G ++  + L  ++  I   EI + SEQ   +   D  L +Q          R LT  A                            Y +A +  H   +F  +W S + A    F+ + D +  T+  + GL     IA+ +    I D    ++     F + Q   E   KN     A   + ++A   G+ L   WK++L  +  + + +L+ K +
Sbjct:  800 YEDEESRSLSSQNIDADDPTQFENLKLRKTALSECIAIFNNKPKKAIPVLIKKGFLKDDSPISIAKWLLETEGLDMAAVGDYLGEGDDKNIAIMHAFVDEFDFTGMSIVDALRSFLQSFRLPGEGQKIDRFMLKFAERFVDQNPGVFSKADTAYVLSYSLIMLNTDLHSSQIKNK---MSLQEFLEN----NEGIDNGRDLPRDFLEGLFNEIANNEIKLISEQHQAMLSGDTNLVQQQQSAFNFFNSRDLTREAYNQVSKEISSKTELVFKNLNKNKGGPDVYYAASHVEHVKSIFETLWMSFLAALTPPFK-DYDDIDTTNKCLEGLKISIKIASTF---RINDARTSFVGALVQFCNLQNLEEIKVKNVN---AMVILLEVALSEGNYLEGSWKDILLVVSQMERLQLISKGI 1201          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Nematostella
Match: EDO31538 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXN1])

HSP 1 Score: 606.29 bits (1562), Expect = 0.000e+0
Identity = 410/1139 (36.00%), Postives = 599/1139 (52.59%), Query Frame = 1
Query: 1933 KKRIIKIGTEKFNNDIKDGIKYLREQGFCQTN---QELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE----AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQRNQ--EDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDF-----LLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELYKTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSLNKKSSIHNREY------CDSGKSPRGRSNYNGNTKKN-------IPNPKIHKESHYSDIDSEDELHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEWNNTISNDSELNVR---LWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGT------------------QDRAILVKSESEAGQ---LLKLTCDRLYTFLPDLVEELF 5196
            +K++++ G+E FNN  K GI++L+E G   T    +E+A L RENPRL+K  IGEYI  ++N  V + +++ F F  LR+D  +R FL+ FRLPGE+  I+ I+E F++ +   NPE+ ++ D+ F L YA++MLNVDQHN N  KQQ PM +E FKRNL + N    +      +L +I+  IK EEIVMP+E+ G I+D Y W+ LL+R LT    Y+SA   +   +LF ++W   V A  YV++  ++  +      G  +C+ I+A+Y+L ++ D ++I + K+T   +  E  E    AFG N K + +A+++F +A +HGDILR+GWKN++DC+L LFKAKLLPK++ E +DF+S  +  LL EE  +    E  + I  W+  L + +  +  R Q  ED+  + +A  +I       LI E++FL+  SL E I  L                   T  SNP    S          DE++  FCLEL++RV+L N DR++     + DH Y   +   + D      L+ER+VV  LRLAI+LLRK+E  ++V T L +L + K SVL      +  GLH+L+  +AA+I S +DW  + T++E C G     P              +T   K  K+++D  S +SD  S                      SC+ Q    G  +  E       +     W+L+S  EDS                          PI NQY++ ++       D     KSC+ L++L++D AH++  NF  CVH +RV+ E    +SLN  +     E        D+     GRS+  G   K+       I   K  + +  S   SEDEL    +      ++   L++LM+ LH  AA  Y   N+  S+ SE       LW  CWCPLLQG+ARLCCD R EVR  A+TFLQR+LL   +  L+  +WE CF KVLFP+LS  LE + +  D +         + RMRA  +L+KVFLQHL  L  LSTFTALWLTIL++MD YM A+ + D L +A+ ESLKN+LLVM T                       A LV+S+S+  +   L ++T +R+  FLP+L  ELF
Sbjct:  676 RKKLLQAGSEHFNNKPKKGIEFLQEHGLLHTPLDPEEMARLLRENPRLDKKTIGEYIGKKDNSKVLDAFVRSFEFHDLRVDEGLRQFLESFRLPGESPVIEHIMEFFSEVFFECNPEVYANKDAVFTLAYAVIMLNVDQHNANI-KQQKPMVLEDFKRNLRKINGGNDFPAT---MLEEIFTCIKNEEIVMPAERTGRIRDTYEWKVLLKRSLTPEGKYVSAVGSSFDQDLFCIIWGPTVAALSYVYDNGVEKSVVQKAITGFRKCSLISAHYSLSDVFDNLVISLCKFTTLLAPPEAGESLAVAFGSNLKAQQSARTLFALAHRHGDILREGWKNIMDCMLQLFKAKLLPKSMVEAEDFVS-GRVSLLKEELPTARSVEPNTSIFSWYQYLVNPE-PANTRGQTPEDKEAQKQAQLMIRDLHPELLITESKFLRFESLNELIKVL-------------------TFTSNPDTYESVGAHC-----DEEAAGFCLELLIRVVLQNRDRVSLLWHTVRDHVY---VTEYVPDLTIIICLVERSVVGLLRLAIRLLRKEEISNEVLTTLRVLLMMKHSVLMACGRQISFGLHELLRTNAASITSTRDWVTVFTLLE-CVGAAATPPT-------------VTPGPKPDKADSD--SGISDGVS----------------------SCDSQ---IGLFTAIEAEPDISASAVGDAWLLIS-KEDSEGS-----------------------PI-NQYDLTVSV-QLNKHDSKCFVKSCQSLTFLIQDCAHVSKENFLHCVHAVRVYTE----ASLNGGTGFRQNEKNLKDLSADNKSGSWGRSSKKGVPAKSSKKSPTAITKRKAARSAGSSPATSEDELEIYETINNAYDAMALQLIELMYALHTCAASFYGR-NDFKSDLSETGAEMSFLWTKCWCPLLQGIARLCCDNRKEVRMSALTFLQRALLVQDMQVLSAVEWESCFNKVLFPMLSRLLE-VPNPDDPIGL------EETRMRAATLLSKVFLQHLSPLLSLSTFTALWLTILDFMDKYMHADKS-DLLFEAIPESLKNMLLVMSTAGIFHQEDYMLSLGNRPVEPSGSARLVRSDSDVHRYSALWQVTWERIDCFLPNLKNELF 1701          

HSP 2 Score: 351.673 bits (901), Expect = 1.927e-98
Identity = 226/609 (37.11%), Postives = 347/609 (56.98%), Query Frame = 1
Query:   61 MTSKTNAKYVVQLEITLLMTAIKRRMK-GSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKED------TRIRKNNLTINMDXXXXXXXXXXXXXIPIPSESH----SDTSHPPEDSCSDEIIVTPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNE----DISVNNEIEPLADDTDSQVLFDLTRIESNCTINFEPSGNPELSSLNIKSDNIQYRTENGIVFKSDLSGAADNSDNENATCKGSK-SEKLPLKSKTQSTTTPYGLACVQKLLSNLILILSPENIFHTNH-VRTGLTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINS 1836
            M +  N  Y+VQ E++L+++A++R  + GS   S+Q+E  DPL    S LK  LS ++DLSE+    FL PFLDVI S +  G ITG+ALT+V KFLS+  ID +  + + G    IE +A+ VT+ +F+GTD SSDEV+LMKIL++L TL+  P G  +++ +VC+I+ SCFRICFE +LSELLR +AE TL  +V LLF+RLP+ K+D      T IRK    +     A++S  R +   P P  SH    S T+   +D      I  P  S S+    E  +   ++  +     T     E    D    N+    +D+ +S          +  T + E   + +L+SL+   DN++     G       + A D+  N     +G + + + P K  +     PYGL C+++L   LI +++P++  ++   +  GL+L+T A ESGA ++    + L++ +++EL KN  LL+Q D L  FA + RVCFL+FE++R HLK Q EM+  +L+ I+  D + + YE RE+ L++I QL+R+P+ +TELYLNYDCDLY +++  EL  L  K A P  S   L +  ++ALDALL ++  +  
Sbjct:    1 MATLRNGVYIVQGEMSLVVSALRRNARWGS--HSHQDEEQDPLLHGFSQLKEQLSTVDDLSEVDVNTFLGPFLDVIRSEDTTGPITGVALTSVNKFLSYGLIDPTSESAASG----IENLADAVTHARFVGTDPSSDEVVLMKILQVLRTLLLTPVGAHMTNESVCEIMQSCFRICFETRLSELLRRSAEQTLMDMVQLLFSRLPQFKDDFKPGQMTNIRK----VFKRAGAIASGKRKKHFSPKPKRSHLESPSQTAQESQDPPEHTPIGQPTESQSEQTQGESTTEPEETSSRRSSTATDDTKPERGLSDADAANDQGGPSDEEESNA-------STVITDHMEEDVSTDLASLDEGDDNVEEVQAEG-------TAAPDDYVNP----RGVRFTPQQPAKEGSTGPLVPYGLPCIRELFRFLISLINPQDRHNSEAMIHMGLSLLTVALESGAHHLGTFTS-LINLVKDELCKNLFLLIQCDFLGLFAMALRVCFLLFEALRVHLKLQFEMFFKKLMEILTMDMQGVHYEKRELVLDAINQLFRVPNLVTELYLNYDCDLYSANVFEELCKLLSKNAFPAGS---LFSVHLLALDALLGVVQSVEG 577          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Nematostella
Match: EDO41902 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S350])

HSP 1 Score: 154.451 bits (389), Expect = 1.828e-37
Identity = 141/580 (24.31%), Postives = 253/580 (43.62%), Query Frame = 1
Query: 1429 LSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLM------NTQVIALDALLFMINCINSRKDDLNRAIYYDSESSETNPEKK-------------------------------IKLTNPMLYK-----KRIIKIGTEKFNNDIKDGIKYLREQGFC-QTNQELASLFRENPRLNKTFIGEYICTRNNVG--VREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNP--EMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDN--YLWRQLLRRCL--------------------TSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLL 2961
            LSKN +    S   S F  S  +   +  S + HLK Q+E++   +   I+ +  +  ++++ + ++++ ++      + ++YLNYDCDL  S++   L     KIA   +++          + ++  L+ L+ ++ C+     + +R +Y +  S     E K                               I   NP  ++     K +++ G  KFN + K G+K+L+E G    +  E+A     + RL+K  IGE I   ++    V  EY+   +F  +    ++R+FL  FRLPGEA  I  ++E FA  Y  +NP   + +  D+ +VL Y+I+ML  D HNP  K++   +T EQ+       N  K   ++ +E L  IY+ I+  EI M +  +   + +  YL  +  RR L                        T+ SA +  H   +F + W   + AF    +   D  + +    G+     IA  + +    D  +  +S++T+ ++S    E   KN  T    K++  +AQ  G+ L   W  +L C+  L  A+L+
Sbjct:  479 LSKNGV----SSVPSVFELSLAIFLTLLSSFKTHLKMQIEVFFKEIFLNIL-ETSSSSFQHKWMVMQALTRICSDAQCVVDIYLNYDCDLSLSNIFERLTSDLSKIAQGRQAIELGATPVQEKSMRIKGLECLVSILKCLV----EWSRELYINPNSQVAVGEDKDSTSGSSGLGSELKSFGGSQGSLNSNSAASGITPDNPEQFESLKQMKGLMEQGIAKFNKNPKKGMKFLQENGLLGMSAGEVAEFLHGDERLDKMQIGELIGDNDDFSKQVMYEYVDKLDFTDMEFVSSLRLFLTNFRLPGEAQKIDRLMEKFASRYFDTNPNNSVFASADAAYVLAYSIIMLTTDLHNPQVKRK---ITKEQYCSMNRGINDSK---DLPQEYLEGIYDEIQHNEIKMRTAPKSANRYSTIYLQNEKSRRMLYYQEMEQMAQTAKSLIEGVSHVQTTFTSATHVEHVRPMFKVAWTPFLAAFSVNLQHCDDPQVASLCLDGIRCAIRIACIFGMQLERDSFVQALSRFTLLTASSSLHEMKTKNIDT---IKTLITVAQTDGNYLGHSWHEILKCISQLELAQLI 1040          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Nematostella
Match: EDO38004 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEA8])

HSP 1 Score: 106.301 bits (264), Expect = 3.909e-24
Identity = 70/200 (35.00%), Postives = 112/200 (56.00%), Query Frame = 1
Query: 1918 NPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQ-TNQELASLFRENPRLNKTFIGEYICTRN--NVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYG-NVEEEVLNKIYEAIKTEEIVMPSE 2505
            +P + +K+I   G +KF+ D + GI YL   G    T ++LA    +   LNKT IG Y+      N+ V  +++ L  F+ + L  A+R FL  FRLPGEA  I  ++E FA+ Y   NP + +  D+ +VL +AI++LN   HNPN K +    TVE+F     + N+    G +++ + L  +Y++IK+EE  +P +
Sbjct:   55 DPKMKQKQI---GKKKFSMDPQKGIDYLVMHGLLNNTPEDLADFLLKEEGLNKTQIGNYLGENKEFNLDVFAKFVDLHKFKDMILVQALRQFLWSFRLPGEAQKIDRMMEAFAQKYCADNPGLFTSTDTCYVLSFAIILLNTSLHNPNVKDKP---TVEKF----IQMNRGINCGEDLDRDFLVALYDSIKSEEFKIPED 244          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Nematostella
Match: EDO27360 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9G5])

HSP 1 Score: 100.908 bits (250), Expect = 8.550e-24
Identity = 47/108 (43.52%), Postives = 72/108 (66.67%), Query Frame = 1
Query: 1942 IIKIGTEKFNNDIKDGIKYLREQGFCQTN---QELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAY 2256
            +++ G+E FNN  K GI++L+E G   T    +E+A L RENPRL+K  IGEYI  ++N  V + +++ F F  LR+D  +R FL+ FRLPGE+  I+ I+E F++ +
Sbjct:    1 LLQAGSEHFNNKPKKGIEFLQEHGLLHTPLDPEEMARLLRENPRLDKKTIGEYIGKKDNSKVLDAFVRSFEFHDLRVDEGLRQFLESFRLPGESPVIEHIMEFFSEVF 108          

HSP 2 Score: 62.7734 bits (151), Expect = 1.209e-10
Identity = 30/109 (27.52%), Postives = 58/109 (53.21%), Query Frame = 1
Query: 2545 LLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMF 2871
            LL+R LT    Y+SA   +   +LF ++W   V A  YV++  ++  +      G  +C+ I+A+Y+L ++ D ++I + K+T   +  ET        + +L+ K++F
Sbjct:  111 LLKRSLTPEGKYVSAVGSSFDQDLFCIIWGPTVAALSYVYDNGVEKSVVQKAITGFRKCSLISAHYSLSDVFDNLVISLCKFTTLLAPPETALEVPYRIERRLSIKALF 219          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Nematostella
Match: EDO34882 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN35])

HSP 1 Score: 104.375 bits (259), Expect = 7.652e-23
Identity = 67/188 (35.64%), Postives = 99/188 (52.66%), Query Frame = 1
Query: 1945 IKIGTEKFNNDIKDGIKYLREQGFCQTNQE-LASLFRENPRLNKTFIGEYICTRNN---VGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNP-EMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIV 2493
            ++IG  +FN   + G+ YL        N E +A        ++K  +GEY+    N   + V + + + F+F G+ +D A+R FL +FR+PGEA  I+ ++E FA+ Y + NP +  S  D   +L +AIVMLN D H+PN KK+   MT E F RNL   N     GN   E L  IY  +  +E  
Sbjct:   36 MRIGINQFNRKPEKGVTYLIAHQVIDDNPEAVAKFLLSEHGVSKQRLGEYLGNLQNDFNMAVLKCFAESFDFTGMEIDVALRTFLAQFRIPGEAQKIERLMEVFAEQYISCNPTDDTSAQDKVLILAFAIVMLNTDLHSPNVKKR---MTQEDFIRNLEGTNNG---GNFPSESLAGIYRRVFKKEFT 217          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Medaka
Match: gbf1 (golgi brefeldin A resistant guanine nucleotide exchange factor 1 [Source:NCBI gene;Acc:101172839])

HSP 1 Score: 766.918 bits (1979), Expect = 0.000e+0
Identity = 513/1427 (35.95%), Postives = 746/1427 (52.28%), Query Frame = 1
Query: 1246 PYGLACVQKLLSNLILILSPENIFHTNHV-RTGLTLITAAFESG--ADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALL--------------------------------------------FMINC----------INSRKDDLNRAIYYDSESSETNPEKKIKLTN---------PMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQT---NQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVE--QFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE----AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQRNQ--EDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELY----------KTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSLNKKSSIHNREYCDSGKSPRGRSNYNGNTK------KNIPNPKIHKESHYSDIDSEDELHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEW----------NNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAG--QLLKLTCDRLYTFLPDLVEELFYEPLL 5211
            PYGL C++++   LI + +P +  +T+ +   GL L+T A ES   A+Y S     LL  ++ ELS++   LL  +R++ +AAS RVCFL+FESMR HLKFQLEMYL +L+ II S+N  +PYE +E+ALE++VQLWRIPSF+TELY+NYDCD YCS+L  +L  L  K A P      L  T +++L+ALL                                              +NC          + + K  L R    D  ++E NP+K  + ++          +  KK+++  GTE+FN   K GI++L+E+G       N ++A   ++NPRL+K  IGEYI  R N+ + + ++  F F+GLR+D A+R++L+ FRLPGEA  IQ +LE F   +H  NP                           +  Q   MT +  QFK+NL   N  K   + ++++L  IY AIK EEIVMP EQ G++K+NY+W  LL R  +S   ++     ++ ++LF + W   + A  YVF+  +D  I      G  +CA IAA+Y   ++ D +II + K+T  SS  E++E     FG N K + AAK++F +A +HG+ILR+GWKN++D +L LF+A+LLPK + EV+DF+  +  I L  E+    + E+ +V+S   +   S    SG R    E++  K  A+  I +C    LI E++FL+  SL E + ALI                          +++ D  ++    DE+   FCLE+++R++L N DR++     + DH Y + + +    FL+ER VV  LRLAI+LLR+++   QV   L +L + K  VL  V+  V  GLH+L+  +AANI    DW  L +++E  G G K    +           QI S T  S +     S+LS Y                    H+ +      S RGYTSDSE+Y           TT  ++ S+ W++V   +D +  NK+ +     VN   +L      P+VNQY++ L        D  ++ K  E LS++VRD AH+TP NFE CV  +RVF E  +           + +Y DS KS R R    G  K      +             S   S+DE    + A     +++  LLDLMHTLH RAA IY  W             I  DS+    LW +CWCPLLQG+A LCCD R +VR  A+T+LQR+LL   L +L   +WE CF KVLFPLL+  L++I S +D +    +T     RMRA  +L+KVFLQHL  L  L TF ALWLTIL++MD YM A ++ D L +A+ ESLKN+LLVM T      I   +ES  G   L ++T +R+  FLP+L EELF + ++
Sbjct:  265 PYGLPCLREVFRFLISLTNPHDRHNTDAMMHMGLQLLTVALESANIANYQS-----LLVLVKEELSRHLFQLLSVERMNLYAASIRVCFLLFESMRVHLKFQLEMYLKKLMDIITSENIKMPYEMKEMALEALVQLWRIPSFVTELYINYDCDFYCSNLFEDLTKLLSKNAFPVSGQ--LYTTHLLSLEALLTVIDSIEAHCQAKVPDTVAQQDQSDTLLAEGDASSINGTDSASGMQMNCSPGCPPTSGHLMAEKMRLGRQ---DQGTAERNPKKPQRFSSYLPDSQELMDIRTKKKLLITGTEQFNQKPKKGIQFLQEKGLLSDPLDNNQVAQWLKDNPRLDKKMIGEYISDRKNMELLDSFVNTFTFQGLRIDEALRLYLEAFRLPGEAPVIQRLLETFTDNWHDVNP---------------------------TPLQTNAMTDDGRQFKKNLKGVNGNK---DFDQDMLEDIYNAIKNEEIVMPDEQTGLVKENYVWSVLLHRGASSEGVFLHLPPSSYDHDLFTMTWGPTIAALSYVFDKSLDDSIIQKAIGGFRKCAVIAAHYGFSDVFDNLIISLCKFTTLSS--ESVENLPTVFGSNSKAQTAAKTVFDLAHRHGNILREGWKNIMDSMLQLFRAELLPKAMVEVEDFVEPNGKISLQREETPSNRGES-AVLSFVNWLTLSGAEQSGLRGPSTENQEAKQAAILCIKQCDPEKLITESKFLQLESLQELMKALI--------------------------SVTPDEETY----DEEDAAFCLEMLLRIVLENRDRVSCVWQTVRDHLYHLCVHATESCFLVERAVVGLLRLAIRLLRREDISSQVLLSLRLLLMMKPHVLSRVSREVSFGLHELLKTNAANIHCTDDWYTLFSLLECMGAGVKPPASF-----------QIASTTADSDTGAQSDSELSSY--------------------HASEV----SSDRGYTSDSEVYTEHSKTRMPRSTTDVDVASSGWLVV--GKDDLEINKTPQ-----VNSKAQLN----HPLVNQYSLTLGQ-DLGQHDTKSLVKCVETLSFIVRDAAHVTPDNFELCVRAIRVFVEASLNGGYRNHDKKKSHKY-DSSKS-RMRKKGGGREKDSGAGLRRGGGGGRASGQRLSRSHSDDEEDEGVPASYH--TVSLQLLDLMHTLHTRAANIYSSWAEEQRHLETAGKKIEADSQT---LWTSCWCPLLQGIAWLCCDARRQVRMQALTYLQRALLVHDLQTLDATEWESCFNKVLFPLLTKLLDSI-SPAD-VGGMEET-----RMRACTLLSKVFLQHLSPLLSLPTFAALWLTILDFMDKYMHAGSS-DLLLEAIPESLKNMLLVMDTA----GIFHSTESRTGYSDLWEITWERIVCFLPNLREELFKQTVI 1552          

HSP 2 Score: 85.8853 bits (211), Expect = 4.214e-16
Identity = 44/94 (46.81%), Postives = 63/94 (67.02%), Query Frame = 1
Query:  415 VANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPA-GYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTR 693
            +A+ VT+ +F+GTD +SDEV               PA G  +++ +VC+I+ SCFRICFE +LSELLR +AE TL  +V LLF+RLP+ KE+ +
Sbjct:    1 MADAVTHARFVGTDPASDEV--------------PPAFGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFSRLPQFKEEAK 80          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Medaka
Match: gbf1 (golgi brefeldin A resistant guanine nucleotide exchange factor 1 [Source:NCBI gene;Acc:101172839])

HSP 1 Score: 668.692 bits (1724), Expect = 0.000e+0
Identity = 434/1177 (36.87%), Postives = 630/1177 (53.53%), Query Frame = 1
Query: 1834 SRKDDLNRAIYYDSESSETNPEKKIKLTN---------PMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQT---NQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE----AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQRN--QEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELY----------KTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSLNKKSSIHNREYCDSGKSPRGRSNYNGNTK------KNIPNPKIHKESHYSDIDSEDELHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEW----------NNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAG--QLLKLTCDRLYTFLPDLVEELFYEPLLPISDK 5226
            + K  L R     +E+ + NP+K  + ++          +  KK+++  GTE+FN   K GI++L+E+G       N ++A   ++NPRL+K  IGEYI  R N+ + + ++  F F+GLR+D A+R++L+ FRLPGEA  IQ +LE F   +H  N       D+ F L YA++MLN DQHN N +KQ  PMTVEQFK+NL   N  K +   ++++L  IY AIK EEIVMP EQ G++K+NY+W  LL R  +S   ++     ++ ++LF + W   + A  YVF+  +D  I      G  +CA IAA+Y   ++ D +II + K+T  SS  E++E     FG N K + AAK++F +A +HG+ILR+GWKN++D +L LF+A+LLPK + EV+DF+  +  I L  E+    + E+ +V+S   +   S    SG R    E++  K  A+  I +C    LI E++FL+  SL E + ALI                          +++ D  ++    DE+   FCLE+++R++L N DR++     + DH Y + + +    FL+ER VV  LRLAI+LLR+++   QV   L +L + K  VL  V+  V  GLH+L+  +AANI    DW  L +++E  G G K    +           QI S T  S +     S+LS Y                    H+ +      S RGYTSDSE+Y           TT  ++ S+ W++V   +D +  NK+ +     VN   +L      P+VNQY++ L        D  ++ K  E LS++VRD AH+TP NFE CV  +RVF E  +           + +Y DS KS R R    G  K      +             S   S+DE    + A     S+   LLDLMHTLH RAA IY  W             I  DS+    LW +CWCPLLQG+A LCCD R +VR  A+T+LQR+LL   L +L   +WE CF KVLFPLL+  L++I S +D +    +T     RMRA  +L+KVFLQHL  L  L TF ALWLTIL++MD YM A ++ D L +A+ ESLKN+LLVM T      I   +ES  G   L ++T +R+  FLP+L EELF + ++  SD+
Sbjct:  650 AEKMRLGRQDQGTAEADKRNPKKPQRFSSYLPDSQELMDIRTKKKLLITGTEQFNQKPKKGIQFLQEKGLLSDPLDNNQVAQWLKDNPRLDKKMIGEYISDRKNMELLDSFVNTFTFQGLRIDEALRLYLEAFRLPGEAPVIQRLLETFTDNWHKVNGSPFMTNDAGFALAYAVIMLNTDQHNHNVRKQNIPMTVEQFKKNLKGVNGNKDF---DQDMLEDIYNAIKNEEIVMPDEQTGLVKENYVWSVLLHRGASSEGVFLHLPPSSYDHDLFTMTWGPTIAALSYVFDKSLDDSIIQKAIGGFRKCAVIAAHYGFSDVFDNLIISLCKFTTLSS--ESVENLPTVFGSNSKAQTAAKTVFDLAHRHGNILREGWKNIMDSMLQLFRAELLPKAMVEVEDFVEPNGKISLQREETPSNRGES-AVLSFVNWLTLSGAEQSGLRGPSTENQEAKQAAILCIKQCDPEKLITESKFLQLESLQELMKALI--------------------------SVTPDEETY----DEEDAAFCLEMLLRIVLENRDRVSCVWQTVRDHLYHLCVHATESCFLVERAVVGLLRLAIRLLRREDISSQVLLSLRLLLMMKPHVLSRVSREVSFGLHELLKTNAANIHCTDDWYTLFSLLECMGAGVKPPASF-----------QIASTTADSDTGAQSDSELSSY--------------------HASEV----SSDRGYTSDSEVYTEHSKTRMPRSTTDVDVASSGWLVV--GKDDLEINKTPQ-----VNSKAQLN----HPLVNQYSLTLGQ-DLGQHDTKSLVKCVETLSFIVRDAAHVTPDNFELCVRAIRVFVEASLNGGYRNHDKKKSHKY-DSSKS-RMRKKGGGREKDSGAGLRRGGGGGRASGQRLSRSHSDDEEDEGVPASYHTVSL--QLLDLMHTLHTRAANIYSSWAEEQRHLETAGKKIEADSQ---TLWTSCWCPLLQGIAWLCCDARRQVRMQALTYLQRALLVHDLQTLDATEWESCFNKVLFPLLTKLLDSI-SPAD-VGGMEET-----RMRACTLLSKVFLQHLSPLLSLPTFAALWLTILDFMDKYMHAGSS-DLLLEAIPESLKNMLLVMDTA----GIFHSTESRTGYSDLWEITWERIVCFLPNLREELFKQTVIQGSDQ 1724          

HSP 2 Score: 184.496 bits (467), Expect = 3.196e-46
Identity = 97/200 (48.50%), Postives = 137/200 (68.50%), Query Frame = 1
Query: 1246 PYGLACVQKLLSNLILILSPENIFHTNHV-RTGLTLITAAFESG--ADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINS 1836
            PYGL C++++   LI + +P +  +T+ +   GL L+T A ES   A+Y S     LL  ++ ELS++   LL  +R++ +AAS RVCFL+FESMR HLKFQLEMYL +L+ II S+N  +PYE +E+ALE++VQLWRIPSF+TELY+NYDCD YCS+L  +L  L  K A P      L  T +++L+ALL +I+ I +
Sbjct:  393 PYGLPCLREVFRFLISLTNPHDRHNTDAMMHMGLQLLTVALESANIANYQS-----LLVLVKEELSRHLFQLLSVERMNLYAASIRVCFLLFESMRVHLKFQLEMYLKKLMDIITSENIKMPYEMKEMALEALVQLWRIPSFVTELYINYDCDFYCSNLFEDLTKLLSKNAFPVSGQ--LYTTHLLSLEALLTVIDSIEA 585          

HSP 3 Score: 184.496 bits (467), Expect = 3.883e-46
Identity = 98/203 (48.28%), Postives = 141/203 (69.46%), Query Frame = 1
Query:   85 YVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTR 693
            Y+VQ EIT ++ AIKR  + +   S  EE  DPL ++   LK  L+ I +LS+++P  FL PFL+V+ S +  G ITGLALT+V KFLS+  ID +    ++    A E +A+ VT+ +F+GTD +SDEV+LMKIL++L TL+  P G  +++ +VC+I+ SCFRICFE +LSELLR +AE TL  +V LLF+RLP+ KE+ +
Sbjct:    7 YIVQGEITTVVGAIKRNSRWNTHTSLDEE-QDPLLNSFGQLKEILNNIKELSDVEPNIFLRPFLEVVRSEDTTGPITGLALTSVNKFLSYGLIDANHEAAAE----ATENMADAVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFSRLPQFKEEAK 204          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Medaka
Match: gbf1 (golgi brefeldin A resistant guanine nucleotide exchange factor 1 [Source:NCBI gene;Acc:101172839])

HSP 1 Score: 667.537 bits (1721), Expect = 0.000e+0
Identity = 432/1172 (36.86%), Postives = 627/1172 (53.50%), Query Frame = 1
Query: 1834 SRKDDLNRAIYYDSESSETNPEKKIKLTN---------PMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQT---NQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE----AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQRNQ--EDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELY----------KTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSLNKKSSIHNREYCDSGKSPRGRSNYNGNTK------KNIPNPKIHKESHYSDIDSEDELHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEW----------NNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAG--QLLKLTCDRLYTFLPDLVEELFYEPLL 5211
            + K  L R     +E+ + NP+K  + ++          +  KK+++  GTE+FN   K GI++L+E+G       N ++A   ++NPRL+K  IGEYI  R N+ + + ++  F F+GLR+D A+R++L+ FRLPGEA  IQ +LE F   +H  N       D+ F L YA++MLN DQHN N +KQ  PMTVEQFK+NL   N  K +   ++++L  IY AIK EEIVMP EQ G++K+NY+W  LL R  +S   ++     ++ ++LF + W   + A  YVF+  +D  I      G  +CA IAA+Y   ++ D +II + K+T  SS  E++E     FG N K + AAK++F +A +HG+ILR+GWKN++D +L LF+A+LLPK + EV+DF+  +  I L  E+    + E+ +V+S   +   S    SG R    E++  K  A+  I +C    LI E++FL+  SL E + ALI                          +++ D  ++    DE+   FCLE+++R++L N DR++     + DH Y + + +    FL+ER VV  LRLAI+LLR+++   QV   L +L + K  VL  V+  V  GLH+L+  +AANI    DW  L +++E  G G K    +           QI S T  S +     S+LS Y                    H+ +      S RGYTSDSE+Y           TT  ++ S+ W++V   +D +  NK+ +     VN   +L      P+VNQY++ L        D  ++ K  E LS++VRD AH+TP NFE CV  +RVF E  +           + +Y DS KS R R    G  K      +             S   S+DE    + A     S+   LLDLMHTLH RAA IY  W             I  DS+    LW +CWCPLLQG+A LCCD R +VR  A+T+LQR+LL   L +L   +WE CF KVLFPLL+  L++I S +D +    +T     RMRA  +L+KVFLQHL  L  L TF ALWLTIL++MD YM A ++ D L +A+ ESLKN+LLVM T      I   +ES  G   L ++T +R+  FLP+L EELF + ++
Sbjct:  650 AEKMRLGRQDQGTAEADKRNPKKPQRFSSYLPDSQELMDIRTKKKLLITGTEQFNQKPKKGIQFLQEKGLLSDPLDNNQVAQWLKDNPRLDKKMIGEYISDRKNMELLDSFVNTFTFQGLRIDEALRLYLEAFRLPGEAPVIQRLLETFTDNWHKVNGSPFMTNDAGFALAYAVIMLNTDQHNHNVRKQNIPMTVEQFKKNLKGVNGNKDF---DQDMLEDIYNAIKNEEIVMPDEQTGLVKENYVWSVLLHRGASSEGVFLHLPPSSYDHDLFTMTWGPTIAALSYVFDKSLDDSIIQKAIGGFRKCAVIAAHYGFSDVFDNLIISLCKFTTLSS--ESVENLPTVFGSNSKAQTAAKTVFDLAHRHGNILREGWKNIMDSMLQLFRAELLPKAMVEVEDFVEPNGKISLQREETPSNRGES-AVLSFVNWLTLSGAEQSGLRGPSTENQEAKQAAILCIKQCDPEKLITESKFLQLESLQELMKALI--------------------------SVTPDEETY----DEEDAAFCLEMLLRIVLENRDRVSCVWQTVRDHLYHLCVHATESCFLVERAVVGLLRLAIRLLRREDISSQVLLSLRLLLMMKPHVLSRVSREVSFGLHELLKTNAANIHCTDDWYTLFSLLECMGAGVKPPASF-----------QIASTTADSDTGAQSDSELSSY--------------------HASEVS----SDRGYTSDSEVYTEHSKTRMPRSTTDVDVASSGWLVV--GKDDLEINKTPQ-----VNSKAQLN----HPLVNQYSLTLGQ-DLGQHDTKSLVKCVETLSFIVRDAAHVTPDNFELCVRAIRVFVEASLNGGYRNHDKKKSHKY-DSSKS-RMRKKGGGREKDSGAGLRRGGGGGRASGQRLSRSHSDDEEDEGVPASYHTVSL--QLLDLMHTLHTRAANIYSSWAEEQRHLETAGKKIEADSQ---TLWTSCWCPLLQGIAWLCCDARRQVRMQALTYLQRALLVHDLQTLDATEWESCFNKVLFPLLTKLLDSI-SPAD-VGGMEET-----RMRACTLLSKVFLQHLSPLLSLPTFAALWLTILDFMDKYMHAGSS-DLLLEAIPESLKNMLLVMDTA----GIFHSTESRTGYSDLWEITWERIVCFLPNLREELFKQTVI 1719          

HSP 2 Score: 185.267 bits (469), Expect = 2.376e-46
Identity = 97/200 (48.50%), Postives = 137/200 (68.50%), Query Frame = 1
Query: 1246 PYGLACVQKLLSNLILILSPENIFHTNHV-RTGLTLITAAFESG--ADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINS 1836
            PYGL C++++   LI + +P +  +T+ +   GL L+T A ES   A+Y S     LL  ++ ELS++   LL  +R++ +AAS RVCFL+FESMR HLKFQLEMYL +L+ II S+N  +PYE +E+ALE++VQLWRIPSF+TELY+NYDCD YCS+L  +L  L  K A P      L  T +++L+ALL +I+ I +
Sbjct:  393 PYGLPCLREVFRFLISLTNPHDRHNTDAMMHMGLQLLTVALESANIANYQS-----LLVLVKEELSRHLFQLLSVERMNLYAASIRVCFLLFESMRVHLKFQLEMYLKKLMDIITSENIKMPYEMKEMALEALVQLWRIPSFVTELYINYDCDFYCSNLFEDLTKLLSKNAFPVSGQ--LYTTHLLSLEALLTVIDSIEA 585          

HSP 3 Score: 184.882 bits (468), Expect = 3.116e-46
Identity = 98/203 (48.28%), Postives = 141/203 (69.46%), Query Frame = 1
Query:   85 YVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTR 693
            Y+VQ EIT ++ AIKR  + +   S  EE  DPL ++   LK  L+ I +LS+++P  FL PFL+V+ S +  G ITGLALT+V KFLS+  ID +    ++    A E +A+ VT+ +F+GTD +SDEV+LMKIL++L TL+  P G  +++ +VC+I+ SCFRICFE +LSELLR +AE TL  +V LLF+RLP+ KE+ +
Sbjct:    7 YIVQGEITTVVGAIKRNSRWNTHTSLDEE-QDPLLNSFGQLKEILNNIKELSDVEPNIFLRPFLEVVRSEDTTGPITGLALTSVNKFLSYGLIDANHEAAAE----ATENMADAVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFSRLPQFKEEAK 204          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Medaka
Match: gbf1 (golgi brefeldin A resistant guanine nucleotide exchange factor 1 [Source:NCBI gene;Acc:101172839])

HSP 1 Score: 666.766 bits (1719), Expect = 0.000e+0
Identity = 432/1172 (36.86%), Postives = 627/1172 (53.50%), Query Frame = 1
Query: 1834 SRKDDLNRAIYYDSESSETNPEKKIKLTN---------PMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQT---NQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIE----AFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQRNQ--EDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELY----------KTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSLNKKSSIHNREYCDSGKSPRGRSNYNGNTK------KNIPNPKIHKESHYSDIDSEDELHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEW----------NNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAG--QLLKLTCDRLYTFLPDLVEELFYEPLL 5211
            + K  L R     +E+ + NP+K  + ++          +  KK+++  GTE+FN   K GI++L+E+G       N ++A   ++NPRL+K  IGEYI  R N+ + + ++  F F+GLR+D A+R++L+ FRLPGEA  IQ +LE F   +H  N       D+ F L YA++MLN DQHN N +KQ  PMTVEQFK+NL   N  K +   ++++L  IY AIK EEIVMP EQ G++K+NY+W  LL R  +S   ++     ++ ++LF + W   + A  YVF+  +D  I      G  +CA IAA+Y   ++ D +II + K+T  SS  E++E     FG N K + AAK++F +A +HG+ILR+GWKN++D +L LF+A+LLPK + EV+DF+  +  I L  E+    + E+ +V+S   +   S    SG R    E++  K  A+  I +C    LI E++FL+  SL E + ALI                          +++ D  ++    DE+   FCLE+++R++L N DR++     + DH Y + + +    FL+ER VV  LRLAI+LLR+++   QV   L +L + K  VL  V+  V  GLH+L+  +AANI    DW  L +++E  G G K    +           QI S T  S +     S+LS Y                    H+ +      S RGYTSDSE+Y           TT  ++ S+ W++V   +D +  NK+ +     VN   +L      P+VNQY++ L        D  ++ K  E LS++VRD AH+TP NFE CV  +RVF E  +           + +Y DS KS R R    G  K      +             S   S+DE    + A     S+   LLDLMHTLH RAA IY  W             I  DS+    LW +CWCPLLQG+A LCCD R +VR  A+T+LQR+LL   L +L   +WE CF KVLFPLL+  L++I S +D +    +T     RMRA  +L+KVFLQHL  L  L TF ALWLTIL++MD YM A ++ D L +A+ ESLKN+LLVM T      I   +ES  G   L ++T +R+  FLP+L EELF + ++
Sbjct:  662 AEKMRLGRQDQGTAEADKRNPKKPQRFSSYLPDSQELMDIRTKKKLLITGTEQFNQKPKKGIQFLQEKGLLSDPLDNNQVAQWLKDNPRLDKKMIGEYISDRKNMELLDSFVNTFTFQGLRIDEALRLYLEAFRLPGEAPVIQRLLETFTDNWHKVNGSPFMTNDAGFALAYAVIMLNTDQHNHNVRKQNIPMTVEQFKKNLKGVNGNKDF---DQDMLEDIYNAIKNEEIVMPDEQTGLVKENYVWSVLLHRGASSEGVFLHLPPSSYDHDLFTMTWGPTIAALSYVFDKSLDDSIIQKAIGGFRKCAVIAAHYGFSDVFDNLIISLCKFTTLSS--ESVENLPTVFGSNSKAQTAAKTVFDLAHRHGNILREGWKNIMDSMLQLFRAELLPKAMVEVEDFVEPNGKISLQREETPSNRGES-AVLSFVNWLTLSGAEQSGLRGPSTENQEAKQAAILCIKQCDPEKLITESKFLQLESLQELMKALI--------------------------SVTPDEETY----DEEDAAFCLEMLLRIVLENRDRVSCVWQTVRDHLYHLCVHATESCFLVERAVVGLLRLAIRLLRREDISSQVLLSLRLLLMMKPHVLSRVSREVSFGLHELLKTNAANIHCTDDWYTLFSLLECMGAGVKPPASF-----------QIASTTADSDTGAQSDSELSSY--------------------HASEVS----SDRGYTSDSEVYTEHSKTRMPRSTTDVDVASSGWLVV--GKDDLEINKTPQ-----VNSKAQLN----HPLVNQYSLTLGQ-DLGQHDTKSLVKCVETLSFIVRDAAHVTPDNFELCVRAIRVFVEASLNGGYRNHDKKKSHKY-DSSKS-RMRKKGGGREKDSGAGLRRGGGGGRASGQRLSRSHSDDEEDEGVPASYHTVSL--QLLDLMHTLHTRAANIYSSWAEEQRHLETAGKKIEADSQ---TLWTSCWCPLLQGIAWLCCDARRQVRMQALTYLQRALLVHDLQTLDATEWESCFNKVLFPLLTKLLDSI-SPAD-VGGMEET-----RMRACTLLSKVFLQHLSPLLSLPTFAALWLTILDFMDKYMHAGSS-DLLLEAIPESLKNMLLVMDTA----GIFHSTESRTGYSDLWEITWERIVCFLPNLREELFKQTVI 1731          

HSP 2 Score: 184.882 bits (468), Expect = 2.645e-46
Identity = 97/200 (48.50%), Postives = 137/200 (68.50%), Query Frame = 1
Query: 1246 PYGLACVQKLLSNLILILSPENIFHTNHV-RTGLTLITAAFESG--ADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINS 1836
            PYGL C++++   LI + +P +  +T+ +   GL L+T A ES   A+Y S     LL  ++ ELS++   LL  +R++ +AAS RVCFL+FESMR HLKFQLEMYL +L+ II S+N  +PYE +E+ALE++VQLWRIPSF+TELY+NYDCD YCS+L  +L  L  K A P      L  T +++L+ALL +I+ I +
Sbjct:  405 PYGLPCLREVFRFLISLTNPHDRHNTDAMMHMGLQLLTVALESANIANYQS-----LLVLVKEELSRHLFQLLSVERMNLYAASIRVCFLLFESMRVHLKFQLEMYLKKLMDIITSENIKMPYEMKEMALEALVQLWRIPSFVTELYINYDCDFYCSNLFEDLTKLLSKNAFPVSGQ--LYTTHLLSLEALLTVIDSIEA 597          

HSP 3 Score: 184.496 bits (467), Expect = 3.240e-46
Identity = 98/203 (48.28%), Postives = 141/203 (69.46%), Query Frame = 1
Query:   85 YVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTR 693
            Y+VQ EIT ++ AIKR  + +   S  EE  DPL ++   LK  L+ I +LS+++P  FL PFL+V+ S +  G ITGLALT+V KFLS+  ID +    ++    A E +A+ VT+ +F+GTD +SDEV+LMKIL++L TL+  P G  +++ +VC+I+ SCFRICFE +LSELLR +AE TL  +V LLF+RLP+ KE+ +
Sbjct:    7 YIVQGEITTVVGAIKRNSRWNTHTSLDEE-QDPLLNSFGQLKEILNNIKELSDVEPNIFLRPFLEVVRSEDTTGPITGLALTSVNKFLSYGLIDANHEAAAE----ATENMADAVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFSRLPQFKEEAK 204          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Medaka
Match: arfgef2 (ADP ribosylation factor guanine nucleotide exchange factor 2 [Source:NCBI gene;Acc:101159743])

HSP 1 Score: 154.451 bits (389), Expect = 5.197e-37
Identity = 149/583 (25.56%), Postives = 263/583 (45.11%), Query Frame = 1
Query: 1429 LSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQV-------IALDALLFMINCINSRKDD----------LNRAIYYDSESSETN-PEK----------------KIKLT---NPMLY-----KKRIIKIGTEKFNNDIKDGIKYLREQGFCQTN-QELASLFRENPRLNKTFIGEYICTRN--NVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSN--PEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVM------------------PSEQRGIIKDNYL------WRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCA-SIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLL 2961
            LSKN +    S     F  S  +   +    + HLK Q+E++  R I + I +     +E++ + ++++ ++      + ++Y+NYDCDL  +++   L +   KIA   RS + L  T +         L+ L+ ++ C+     D          L +    DSE +E   PE+                 I ++   +P  Y     +K II+ G + FN   K GI+YL++QG   T  Q++A   ++  RL+ T +GE++   N  N+ V   Y+   +F G     A+R FL+ FRLPGEA  I  ++E FA  Y   N    + +  D+ +VL Y+I+ML  D H+P  K +   MT EQ+ +     N  K   ++ EE L+ IY+ I  ++I M                    +QR ++ +  +       + L+     + A + SA +  H   +F L W   + AF    + + D     S+ +   +CA  IA  +++    D  +  ++++T+ ++S    E   KN  T    K++  +A   G+ L + W  +L C+  L  A+L+
Sbjct:  495 LSKNGV----SSVPEVFELSLAIFLTLLSHFKVHLKMQIEVFF-REIFLTILETSTSSFEHKWMVIQTLTRICADAQCVVDIYVNYDCDLNAANIFERLVNDLSKIAQ-GRSGQELGMTPLQELSLRKKGLECLVSILKCMVEWSKDMYVNPNLQTNLGQEHPSDSEGAELKLPEQLAGRRDSISSLDSTVSSIPMSQADHPEQYEVIKQQKDIIEHGIDLFNKKPKRGIQYLQDQGMLGTTAQDVAQFLQQEDRLDTTQVGEFLGENNKFNIEVMYSYVDQLDFCGRDFVSALRAFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQVKNK---MTKEQYIKMNRGINDSK---DLPEEYLSSIYDEIAGKKIAMKESKEYSITPKSTKPNVASEKQRRLLYNVEMEQMAKTAKALMEAVSHAQAPFFSAKHLEHVRPMFKLAWTPLLAAFSVGLQ-DCDDPEVASLCLEGIRCAIRIACIFSMQLERDAYVQALARFTLLTASSSITEMKQKNIDT---IKTLITVAHTDGNYLGNSWHEILRCISQLELAQLI 1061          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Planmine SMEST
Match: SMESG000010938.1 (SMESG000010938.1)

HSP 1 Score: 3551.53 bits (9208), Expect = 0.000e+0
Identity = 1742/1749 (99.60%), Postives = 1743/1749 (99.66%), Query Frame = 1
Query:   61 MTSKTNAKYVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTRIRKNNLTINMDXXXXXXXXXXXXXIPIPSESHSDTSHPPEDSCSDEIIVTPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNEDISVNNEIEPLADDTDSQVLFDLTRIESNCTINFEPSGNPELSSLNIKSDNIQYRTENGIVFKSDLSGAADNSDNENATCKGSKSEKLPLKSKTQSTTTPYGLACVQKLLSNLILILSPENIFHTNHVRTGLTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINSRKDDLNRAIYYDSESSETNPEKKIKLTNPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQTNQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQRNQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELYKTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSLNKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDELHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEWNNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAGQLLKLTCDRLYTFLPDLVEELFYEPLLPISDKIEESNENIQSVDETEISEFNQEIKCEE 5307
            MTSKTNAKYVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTND DGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTRIRKNNLTINMDLSALSSKSRLRRKIPI SESHSDTSHPPEDSCSDEIIVTPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNEDISVNNEIEPLADDTDSQVLFDLTRIESNCTIN EPSGNPELSSLNIKSDNIQYRTE GIVFKSDLSGAADNSDNENATCKGSKSEKLPLKSKTQSTTTPYGLACVQKLLSNLILILSPENIFHTNHVRTGLTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINSRKDDLNRAIYYDSESSETNPEKKIKLTNPMLYKK IIKIGTEKFNNDIKDGIKYLREQGFCQTNQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQRNQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELYKTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSLNKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESH+SDIDSEDELHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEWNNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTI MTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAGQLLKLTCDRLYTFLPDLVEELFYEPLLPISDKIEESNENIQSVDETEISEFNQEIKCEE
Sbjct:    1 MTSKTNAKYVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDRDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTRIRKNNLTINMDLSALSSKSRLRRKIPIASESHSDTSHPPEDSCSDEIIVTPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNEDISVNNEIEPLADDTDSQVLFDLTRIESNCTINSEPSGNPELSSLNIKSDNIQYRTEKGIVFKSDLSGAADNSDNENATCKGSKSEKLPLKSKTQSTTTPYGLACVQKLLSNLILILSPENIFHTNHVRTGLTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINSRKDDLNRAIYYDSESSETNPEKKIKLTNPMLYKKHIIKIGTEKFNNDIKDGIKYLREQGFCQTNQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQRNQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELYKTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSLNKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHHSDIDSEDELHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEWNNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIGMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAGQLLKLTCDRLYTFLPDLVEELFYEPLLPISDKIEESNENIQSVDETEISEFNQEIKCEE 1749          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Planmine SMEST
Match: SMESG000010938.1 (SMESG000010938.1)

HSP 1 Score: 3527.26 bits (9145), Expect = 0.000e+0
Identity = 1733/1749 (99.09%), Postives = 1734/1749 (99.14%), Query Frame = 1
Query:   61 MTSKTNAKYVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTRIRKNNLTINMDXXXXXXXXXXXXXIPIPSESHSDTSHPPEDSCSDEIIVTPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNEDISVNNEIEPLADDTDSQVLFDLTRIESNCTINFEPSGNPELSSLNIKSDNIQYRTENGIVFKSDLSGAADNSDNENATCKGSKSEKLPLKSKTQSTTTPYGLACVQKLLSNLILILSPENIFHTNHVRTGLTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINSRKDDLNRAIYYDSESSETNPEKKIKLTNPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQTNQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQRNQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELYKTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSLNKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDELHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEWNNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAGQLLKLTCDRLYTFLPDLVEELFYEPLLPISDKIEESNENIQSVDETEISEFNQEIKCEE 5307
            MTSKTNAKYVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTND DGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTRIRKNNLTINMDLSALSSKSRLRRKIPI SESHSDTSHPPEDSCSDEIIVTPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNEDISVNNEIEPLADDTDSQVLFDLTRIESNCTIN EPSGNPELSSLNIKSDNIQYRTE GIVFKSDLSGAADNSDNENATCKGSKSEKLPLKSKTQSTTTPYGLACVQKLLSNLILILSPENIFHTNHVRTGLTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINSRKDDLNRAIYYDSESSETNPEKKIKLTNPMLYKK IIKIGTEKFNNDIKDGIKYLREQGFCQTNQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQRNQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELYKTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSLNKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESH+SDIDSEDELHYKISAQ         LLDLMHTLHNRAAKIYFEWNNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTI MTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAGQLLKLTCDRLYTFLPDLVEELFYEPLLPISDKIEESNENIQSVDETEISEFNQEIKCEE
Sbjct:    1 MTSKTNAKYVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDRDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTRIRKNNLTINMDLSALSSKSRLRRKIPIASESHSDTSHPPEDSCSDEIIVTPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNEDISVNNEIEPLADDTDSQVLFDLTRIESNCTINSEPSGNPELSSLNIKSDNIQYRTEKGIVFKSDLSGAADNSDNENATCKGSKSEKLPLKSKTQSTTTPYGLACVQKLLSNLILILSPENIFHTNHVRTGLTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINSRKDDLNRAIYYDSESSETNPEKKIKLTNPMLYKKHIIKIGTEKFNNDIKDGIKYLREQGFCQTNQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQRNQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELYKTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSLNKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHHSDIDSEDELHYKISAQ---------LLDLMHTLHNRAAKIYFEWNNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIGMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAGQLLKLTCDRLYTFLPDLVEELFYEPLLPISDKIEESNENIQSVDETEISEFNQEIKCEE 1740          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Planmine SMEST
Match: SMESG000010938.1 (SMESG000010938.1)

HSP 1 Score: 3516.86 bits (9118), Expect = 0.000e+0
Identity = 1724/1731 (99.60%), Postives = 1725/1731 (99.65%), Query Frame = 1
Query:  115 MTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTRIRKNNLTINMDXXXXXXXXXXXXXIPIPSESHSDTSHPPEDSCSDEIIVTPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNEDISVNNEIEPLADDTDSQVLFDLTRIESNCTINFEPSGNPELSSLNIKSDNIQYRTENGIVFKSDLSGAADNSDNENATCKGSKSEKLPLKSKTQSTTTPYGLACVQKLLSNLILILSPENIFHTNHVRTGLTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINSRKDDLNRAIYYDSESSETNPEKKIKLTNPMLYKKRIIKIGTEKFNNDIKDGIKYLREQGFCQTNQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQRNQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELYKTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSLNKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHYSDIDSEDELHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEWNNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAGQLLKLTCDRLYTFLPDLVEELFYEPLLPISDKIEESNENIQSVDETEISEFNQEIKCEE 5307
            MTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTND DGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTRIRKNNLTINMDLSALSSKSRLRRKIPI SESHSDTSHPPEDSCSDEIIVTPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNEDISVNNEIEPLADDTDSQVLFDLTRIESNCTIN EPSGNPELSSLNIKSDNIQYRTE GIVFKSDLSGAADNSDNENATCKGSKSEKLPLKSKTQSTTTPYGLACVQKLLSNLILILSPENIFHTNHVRTGLTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINSRKDDLNRAIYYDSESSETNPEKKIKLTNPMLYKK IIKIGTEKFNNDIKDGIKYLREQGFCQTNQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQRNQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELYKTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSLNKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESH+SDIDSEDELHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEWNNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTI MTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAGQLLKLTCDRLYTFLPDLVEELFYEPLLPISDKIEESNENIQSVDETEISEFNQEIKCEE
Sbjct:    1 MTAIKRRMKGSVIRSYQEEISDPLYSNLSSLKSTLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRYIDISMTNDRDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTLMHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLFTRLPELKEDTRIRKNNLTINMDLSALSSKSRLRRKIPIASESHSDTSHPPEDSCSDEIIVTPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNEDISVNNEIEPLADDTDSQVLFDLTRIESNCTINSEPSGNPELSSLNIKSDNIQYRTEKGIVFKSDLSGAADNSDNENATCKGSKSEKLPLKSKTQSTTTPYGLACVQKLLSNLILILSPENIFHTNHVRTGLTLITAAFESGADYISKAPNVLLSQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLSRLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSDLLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINSRKDDLNRAIYYDSESSETNPEKKIKLTNPMLYKKHIIKIGTEKFNNDIKDGIKYLREQGFCQTNQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSYELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIMDKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDGWKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPSVISHWFFSLTSSDYSSGQRNQEDELTKNEALSVINKCSIPALIEETRFLKEASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSGRDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLERTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLHDLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQITSLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQESCRGYTSDSELYKTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNVKLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITPTNFESCVHTLRVFAEVCVKSSLNKKSSIHNREYCDSGKSPRGRSNYNGNTKKNIPNPKIHKESHHSDIDSEDELHYKISAQIDKGSINENLLDLMHTLHNRAAKIYFEWNNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIGMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAGQLLKLTCDRLYTFLPDLVEELFYEPLLPISDKIEESNENIQSVDETEISEFNQEIKCEE 1731          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Planmine SMEST
Match: SMESG000046567.1 (SMESG000046567.1)

HSP 1 Score: 524.628 bits (1350), Expect = 1.346e-173
Identity = 254/255 (99.61%), Postives = 254/255 (99.61%), Query Frame = 1
Query: 4543 MHTLHNRAAKIYFEWNNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAGQLLKLTCDRLYTFLPDLVEELFYEPLLPISDKIEESNENIQSVDETEISEFNQEIKCEE 5307
            MHTLHNRAAKIYFEWNNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLS VLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAGQLLKLTCDRLYTFLPDLVEELFYEPLLPISDKIEESNENIQSVDETEISEFNQEIKCEE
Sbjct:    1 MHTLHNRAAKIYFEWNNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIAMTFLQRSLLSSVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSFNQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKANNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAGQLLKLTCDRLYTFLPDLVEELFYEPLLPISDKIEESNENIQSVDETEISEFNQEIKCEE 255          
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Planmine SMEST
Match: SMESG000053199.1 (SMESG000053199.1)

HSP 1 Score: 109.383 bits (272), Expect = 7.961e-25
Identity = 70/219 (31.96%), Postives = 116/219 (52.97%), Query Frame = 1
Query: 1939 RIIKIGTEKFNNDIKDGIKYLREQGFCQTNQELASLFRENPRLNKTFIGEY---ICTRNNVGVREEYIKLFNFRGLRLDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLLYAIVMLNVDQHNPNSKKQQAPMTVEQ-FKRNLYEPNKKKYYGNVEEEVLNKIYEAIKTEEIV-----MP-----SEQRGIIKDNYLWRQLLR 2553
            R ++IGT+KFN++ ++GI+YL  +   Q   +  + F  +  LNK  +G+Y   I    N  V +EYI LF+F  +    +IR FL  F LPGE+  I  I+  +AK YH  NP +  + + T+++ YA++MLN   HNP +KK+      E+ F + +   N    +   E   + +I++ IK+  ++     +P     S+   I K  +LW+Q  R
Sbjct:   59 RNLRIGTKKFNHNPEEGIEYLVSKKAIQETPKAIATFLTDKSLNKRAVGDYLGNISKPFNCDVLQEYISLFDFSEMEFIDSIRFFLSGFHLPGESQKIDKIISLWAKYYHEQNPSIFKNENETYIMTYAVIMLNTCLHNPTAKKENGGFGREEDFIKIMGNFNSDTQF---ELSFVKRIFKNIKSNPLLCLHKHLPDNKYNSDISNIEKAGWLWKQGGR 274          
The following BLAST results are available for this feature:
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GBF15.832e-9736.41golgi brefeldin A resistant guanine nucleotide exc... [more]
GBF11.576e-4736.41golgi brefeldin A resistant guanine nucleotide exc... [more]
GBF14.322e-9536.41golgi brefeldin A resistant guanine nucleotide exc... [more]
ARFGEF19.408e-3524.70ADP ribosylation factor guanine nucleotide exchang... [more]
ARFGEF22.812e-3424.27ADP ribosylation factor guanine nucleotide exchang... [more]
back to top
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gbf-12.875e-15731.13pep chromosome:WBcel235:III:11751320:11773681:-1 g... [more]
gbf-11.497e-4037.08pep chromosome:WBcel235:III:11751628:11756613:-1 g... [more]
agef-13.827e-3522.24Arf-1 Guanine nucleotide Exchange Factor homolog ... [more]
bris-12.614e-2033.18BRag/Iqsec/Schizo related Arf GEF family member [... [more]
bris-12.950e-2033.18BRag/Iqsec/Schizo related Arf GEF family member [... [more]
back to top
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
garz3.676e-3833.33gene:FBgn0264560 transcript:FBtr0305075[more]
garz3.149e-3833.33gene:FBgn0264560 transcript:FBtr0087897[more]
garz3.553e-3833.33gene:FBgn0264560 transcript:FBtr0087898[more]
Sec712.072e-3623.75gene:FBgn0028538 transcript:FBtr0080537[more]
step1.812e-2735.32gene:FBgn0086779 transcript:FBtr0085910[more]
back to top
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gbf13.276e-9437.77golgi brefeldin A resistant guanine nucleotide exc... [more]
gbf12.631e-7237.85golgi brefeldin A resistant guanine nucleotide exc... [more]
gbf12.631e-7237.85golgi brefeldin A resistant guanine nucleotide exc... [more]
arfgef24.743e-3625.26ADP-ribosylation factor guanine nucleotide-exchang... [more]
arfgef24.967e-3625.26ADP-ribosylation factor guanine nucleotide-exchang... [more]
back to top
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
or11l1.180.000e+036.41olfactory receptor class II (xb178 gene) [Source:X... [more]
or11l1.180.000e+036.75olfactory receptor class II (xb178 gene) [Source:X... [more]
or11l1.180.000e+036.76olfactory receptor class II (xb178 gene) [Source:X... [more]
or11l1.180.000e+036.63olfactory receptor class II (xb178 gene) [Source:X... [more]
or11l1.180.000e+036.40olfactory receptor class II (xb178 gene) [Source:X... [more]
back to top
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gbf11.872e-9636.57golgi-specific brefeldin A-resistance factor 1 [So... [more]
Arfgef11.808e-3424.53ADP-ribosylation factor guanine nucleotide-exchang... [more]
Arfgef22.070e-3423.92ADP-ribosylation factor guanine nucleotide-exchang... [more]
Arfgef13.705e-3324.62ADP-ribosylation factor guanine nucleotide-exchang... [more]
Cyth28.495e-2734.69cytohesin 2 [Source:MGI Symbol;Acc:MGI:1334255][more]
back to top
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9R1D7|GBF1_CRIGR1.922e-4636.64Golgi-specific brefeldin A-resistance guanine nucl... [more]
sp|Q92538|GBF1_HUMAN2.801e-9636.41Golgi-specific brefeldin A-resistance guanine nucl... [more]
sp|Q42510|GNOM_ARATH4.494e-8527.89ARF guanine-nucleotide exchange factor GNOM OS=Ara... [more]
sp|Q9FLY5|GNL1_ARATH1.243e-7925.31ARF guanine-nucleotide exchange factor GNL1 OS=Ara... [more]
sp|F4K2K3|GNL2_ARATH1.180e-6123.79ARF guanine-nucleotide exchange factor GNL2 OS=Ara... [more]
back to top
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7UJM20.000e+038.12SEC7 domain-containing protein OS=Capitella teleta... [more]
A0A5G3KAL20.000e+036.41Olfactory receptor class II (xb178 gene) OS=Xenopu... [more]
A0A5F9CPX60.000e+036.79Golgi brefeldin A resistant guanine nucleotide exc... [more]
A0A3Q3WKE30.000e+035.36Golgi brefeldin A resistant guanine nucleotide exc... [more]
A0A5G3KAE00.000e+036.75Olfactory receptor class II (xb178 gene) OS=Xenopu... [more]
back to top
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gbf10.000e+036.13golgi brefeldin A resistant guanine nucleotide exc... [more]
arfgef21.611e-3424.87ADP-ribosylation factor guanine nucleotide-exchang... [more]
arfgef18.425e-3324.68ADP-ribosylation factor guanine nucleotide-exchang... [more]
arfgef26.736e-3125.09ADP-ribosylation factor guanine nucleotide-exchang... [more]
si:dkey-283b15.42.841e-2737.19cytohesin 2 [Source:HGNC Symbol;Acc:HGNC:9502][more]
back to top
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gbf11.024e-4635.88golgi brefeldin A resistant guanine nucleotide exc... [more]
ENSPMAT00000004144.13.744e-3125.42pep scaffold:Pmarinus_7.0:GL477097:6043:63444:-1 g... [more]
ENSPMAT00000004134.11.057e-3025.35pep scaffold:Pmarinus_7.0:GL477097:5536:63408:-1 g... [more]
ENSPMAT00000004124.11.233e-2723.78pep scaffold:Pmarinus_7.0:GL477097:5491:41441:-1 g... [more]
si:dkey-283b15.49.378e-2433.66cytohesin 2 [Source:HGNC Symbol;Acc:HGNC:9502][more]
back to top
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
GEA24.997e-5828.14Guanine nucleotide exchange factor for ADP ribosyl... [more]
GEA11.452e-5126.93Guanine nucleotide exchange factor for ADP ribosyl... [more]
SEC71.027e-1723.56Guanine nucleotide exchange factor (GEF) for ADP r... [more]
back to top
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO315381.927e-9836.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419021.828e-3724.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380043.909e-2435.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO273608.550e-2443.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348827.652e-2335.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gbf14.214e-1635.95golgi brefeldin A resistant guanine nucleotide exc... [more]
gbf13.196e-4636.87golgi brefeldin A resistant guanine nucleotide exc... [more]
gbf12.376e-4636.86golgi brefeldin A resistant guanine nucleotide exc... [more]
gbf12.645e-4636.86golgi brefeldin A resistant guanine nucleotide exc... [more]
arfgef25.197e-3725.56ADP ribosylation factor guanine nucleotide exchang... [more]
back to top
BLAST of Golgi brefeldin A resistant guanine nucleotide exchange factor 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010938.10.000e+099.60SMESG000010938.1[more]
SMESG000010938.10.000e+099.09SMESG000010938.1[more]
SMESG000010938.10.000e+099.60SMESG000010938.1[more]
SMESG000046567.11.346e-17399.61SMESG000046567.1[more]
SMESG000053199.17.961e-2531.96SMESG000053199.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019511 ID=SMED30019511|Name=Golgi brefeldin A resistant guanine nucleotide exchange factor 1|organism=Schmidtea mediterranea sexual|type=transcript|length=5320bp
TATTCTATAAATTATTAATAATCTTGATTATTACGTTATTAAATTAGCAA
TATATTCAAAATGACCAGCAAGACAAATGCTAAATATGTGGTTCAATTAG
AGATAACGTTATTGATGACTGCCATAAAAAGGAGAATGAAAGGCAGTGTA
ATTCGTTCTTATCAAGAAGAAATATCAGATCCATTGTACAGTAATTTGTC
GAGCCTCAAATCCACTTTATCTCAAATAAATGACCTATCAGAATTAAAAC
CTTTGGATTTTTTGTCTCCATTTTTAGACGTAATTAGTTCTGGAGAAATG
ATTGGATTAATTACTGGATTGGCTTTAACTGCCGTGGAAAAATTTCTTAG
TTTTCGATATATAGATATTTCAATGACAAATGACAGTGATGGTTTACAAA
TTGCAATTGAAGCAGTAGCTAATACGGTTACTAATACCAAATTTATCGGA
ACTGATCATAGTTCAGACGAGGTGATTTTGATGAAAATATTACGACTCCT
TGATACGCTAATGCATGTGCCAGCTGGATATTTAATCAGTGACTATGCTG
TATGCAAGATCATATCAAGCTGTTTCAGAATATGCTTCGAGGCTCAATTA
TCCGAGTTATTGCGACACACAGCAGAATGTACACTAGAACGAATTGTTCA
TTTGCTGTTTACGAGATTGCCAGAATTAAAGGAAGACACCAGAATTAGAA
AAAATAATTTGACAATAAACATGGATTTGTCAGCACTGTCATCCAAATCG
AGATTGCGAAGAAAAATTCCAATACCGTCAGAATCTCATTCAGATACATC
GCATCCTCCAGAGGACAGTTGTTCCGATGAAATTATTGTTACACCTAATA
CTTCCAATTCAAAAGATGAGGCATCTGAAATTATTAGTAATGACATTGAT
TCAGAAAAGAAATTAGACTACCCTTTGACTGCTGCTGAATCCAATGAAGA
TATAAGTGTAAATAATGAGATTGAACCTTTAGCAGATGATACTGATTCGC
AAGTGTTATTTGACTTAACTAGAATTGAATCTAATTGCACTATTAATTTC
GAGCCCAGTGGAAATCCTGAGTTGAGTTCACTAAACATCAAATCTGATAA
TATCCAATACAGAACAGAAAATGGCATTGTATTTAAATCGGATTTATCAG
GCGCAGCAGATAACTCAGATAATGAAAACGCGACTTGCAAAGGATCAAAA
TCAGAAAAATTACCACTTAAATCCAAAACTCAATCAACTACTACTCCTTA
TGGTTTAGCTTGTGTTCAAAAATTGCTGTCAAATTTGATTTTAATACTTT
CACCTGAAAATATTTTCCACACCAATCACGTTCGCACTGGTCTTACTTTG
ATTACAGCTGCATTTGAATCAGGTGCCGATTACATTTCGAAAGCTCCAAA
TGTACTACTATCTCAAATTCAAAATGAATTATCGAAGAATTTCATTCTAT
TACTCCAATCAGATCGTTTATCGTTCTTTGCTGCTTCAGCAAGAGTTTGC
TTTCTAATGTTTGAGTCAATGCGTCATCATCTTAAATTTCAATTAGAAAT
GTACCTATCCCGTCTAATTAGTATAATCATATCTGATAATGAGAACATAC
CATATGAATATCGAGAAGTCGCTCTAGAATCTATTGTTCAATTATGGCGA
ATTCCCAGTTTTATCACAGAACTCTATTTGAATTATGACTGTGATCTTTA
CTGTTCTGATCTACTACATGAACTTGCGGATCTATTTTGTAAAATAGCAA
CTCCAGATCGGTCTGTGAGATGTTTAATGAACACACAAGTGATCGCTCTA
GACGCGTTGTTATTTATGATAAACTGTATTAATTCAAGAAAAGATGATTT
AAATCGAGCAATTTATTATGATAGTGAAAGTTCGGAAACGAACCCAGAAA
AGAAAATCAAACTCACAAATCCAATGCTTTATAAAAAACGTATAATAAAA
ATTGGAACTGAAAAATTCAATAATGATATCAAAGATGGTATTAAATATCT
TCGAGAACAAGGATTTTGTCAAACAAATCAAGAACTTGCATCACTTTTTA
GAGAAAATCCCAGATTGAATAAAACATTTATTGGTGAATATATTTGTACA
AGAAATAATGTTGGAGTTAGAGAGGAATACATAAAACTCTTTAATTTTCG
GGGGTTGAGACTTGATTGTGCCATTAGAATGTTTTTAGACGAATTCCGAT
TGCCAGGTGAAGCCGCAAATATTCAATTGATTCTCGAATGTTTTGCGAAA
GCATACCACACCAGTAATCCTGAAATGGTATCTGATCCCGATTCGACATT
TGTTTTATTGTATGCCATTGTTATGCTTAATGTCGATCAGCACAATCCTA
ATTCCAAAAAGCAACAAGCTCCTATGACTGTTGAACAATTTAAACGAAAT
TTATACGAGCCGAATAAAAAGAAATATTATGGAAATGTTGAGGAAGAAGT
TTTGAATAAAATTTATGAGGCTATTAAGACAGAAGAAATAGTTATGCCAT
CTGAACAGCGCGGTATTATTAAGGATAATTATTTATGGCGACAATTATTA
AGACGATGTTTAACCTCAAATGCTACGTATATTTCGGCAGATTACAAAAA
TCACAGTTATGAGTTATTTAATTTAGTATGGAAATCTGCCGTAAATGCTT
TTGTTTACGTTTTTGAAGTTGAAATGGATTCGGTTATTAATACAAGCATG
ACTATTGGATTATACCAATGCGCTTCTATCGCAGCATATTATAATTTGTG
TGAAATAATGGATAAAATTATTATTTATATTTCAAAATATACCATATTTT
CATCATCTCAAGAAACAATTGAAGCTTTTGGGAAGAATGAAAAAACGAAA
CTTGCTGCTAAGTCTATGTTTCAAATAGCTCAGAAACATGGGGACATTTT
AAGAGATGGCTGGAAAAATTTACTAGATTGTTTGTTATGTTTATTTAAAG
CAAAATTGTTACCAAAAAATTTAACAGAAGTAGATGATTTTATTTCTAAA
GACAAAACTATTTTATTAATTGAAGAAGATAAATCATTAACAAAAGCAGA
GGCACCAAGTGTCATTTCTCATTGGTTCTTTTCATTGACGTCATCAGATT
ATTCATCTGGCCAAAGAAATCAGGAAGATGAACTAACGAAAAATGAAGCT
CTAAGTGTAATTAATAAATGTTCTATTCCAGCTTTAATAGAAGAGACTAG
ATTTCTGAAAGAAGCATCTTTGACAGAATTTATAAACGCTTTAATTAATG
GAACGAGAGTGGGTGATGAAAACCTCATTAATACAATTCATCACCGCCAA
ACACTGAAATCCAATCCATCTGCTACGATTAGTTGTGATAATAGTTCTTG
GCCCAGCGGACGAGATGAACAATCTCGTGTATTTTGTCTAGAATTGATGA
TGCGAGTTTTGTTGCATAATAGTGATCGCATAAATTCTTTTCTTTCATTG
ATTCATGATCATTTTTATACGATACTTATTGGTTCTGTAATTCATGACTT
TTTATTGGAGCGAACAGTTGTCGCATGTCTTCGATTGGCTATTCAATTAC
TGAGAAAACAAGAAGATGTTGATCAAGTGTTTACATGTTTAGAAATATTA
GCCTTGACTAAAACTAGTGTTTTGAAACATGTGAATCTTCATGTTGTCTG
TGGCTTGCACGATTTGATATACATGCATGCAGCAAACATTCCTTCAGAAA
AAGACTGGAAATTACTTTTGACTATGATTGAGATTTGTGGTGGTGGTACA
AAACTTGATCCGATTTACAAAGCAGAAATAGTTAATAGATTACGAAAAAA
ACAAATCACTAGTTTGACAAAATCTTCTAAATCCAACAATGATGAATTAT
CGAAATTATCTGACTATGATAGTATTCATAAGGAAATCTATAATAGTGTT
GATGATATTCCAAACAAATTATTGGAACACAGTGATCAAAGTTGTGAACT
TCAAGAATCATGCCGTGGATACACTAGTGATAGTGAATTATACAAAACTA
CTCAGAACAATTTGGATTCCACTAAGTGGATTCTAGTATCTCCTTCTGAA
GATTCTGTAACCAAAAATAAGAGCGCTGAATTTATCGGCCAAACTGTAAA
TGACAATGTAAAATTATATTCTGAATACCCACAACCTATCGTTAATCAAT
ATAATATTGTTTTGACAACAGCTCATTTTGTGTTCAGAGATCCTTTAGCT
ATTGAAAAATCTTGCGAAATTCTATCATACTTAGTAAGAGATCCTGCCCA
CATTACTCCAACAAATTTTGAGTCTTGTGTACATACTTTACGAGTTTTTG
CAGAAGTCTGTGTTAAATCGTCTCTAAACAAAAAGTCCTCGATTCATAAT
CGAGAATATTGTGACAGTGGGAAGTCGCCACGAGGTCGTTCTAACTACAA
TGGAAACACGAAAAAAAATATTCCAAACCCGAAAATTCATAAAGAAAGTC
ACTACAGTGACATTGATAGTGAAGATGAACTTCACTATAAGATATCTGCT
CAAATTGATAAAGGGTCTATTAATGAAAATTTATTGGATTTGATGCATAC
TCTGCATAATCGGGCAGCTAAAATTTATTTTGAATGGAATAATACTATTT
CAAATGACAGTGAACTGAATGTTCGATTATGGAAAAACTGTTGGTGTCCA
TTATTACAAGGAATGGCTAGATTATGTTGTGATATTCGACCTGAAGTTAG
AACTATTGCTATGACGTTTCTCCAGAGATCTTTACTTTCACCTGTACTCA
CGAGTCTAACAGGTGCCCAATGGGAAGACTGCTTCGCAAAAGTTTTATTT
CCACTGTTATCTAATTTCTTGGAAAATATTAAATCTCAAAGCGATTCATT
GAATTCTTTTAATCAAACTGAAAATTCTGATCCTAGAATGAGAGCAGTTC
AGATATTAACAAAAGTATTTTTGCAGCATCTTGGAGCACTTCACGAATTA
TCAACTTTCACGGCTCTCTGGTTAACGATTTTAGAGTATATGGATTCTTA
TATGAAGGCAAATAATAACTGTGACTCATTGGATGACGCAGTTCGAGAAA
GTCTTAAAAATGTTCTTCTTGTAATGTACACAGGAACACAAGATCGTGCA
ATTTTAGTAAAAAGTGAAAGTGAAGCTGGACAGCTTTTAAAACTTACTTG
TGACAGATTATACACTTTTCTTCCTGATTTAGTAGAAGAATTATTTTATG
AACCGTTATTACCTATATCGGACAAAATTGAAGAAAGCAATGAAAACATT
CAGTCTGTCGATGAAACTGAAATTTCTGAATTTAATCAAGAAATAAAATG
TGAAGAATAATACTAATAAA
back to top

protein sequence of SMED30019511-orf-1

>SMED30019511-orf-1 ID=SMED30019511-orf-1|Name=SMED30019511-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1750bp
MTSKTNAKYVVQLEITLLMTAIKRRMKGSVIRSYQEEISDPLYSNLSSLK
STLSQINDLSELKPLDFLSPFLDVISSGEMIGLITGLALTAVEKFLSFRY
IDISMTNDSDGLQIAIEAVANTVTNTKFIGTDHSSDEVILMKILRLLDTL
MHVPAGYLISDYAVCKIISSCFRICFEAQLSELLRHTAECTLERIVHLLF
TRLPELKEDTRIRKNNLTINMDLSALSSKSRLRRKIPIPSESHSDTSHPP
EDSCSDEIIVTPNTSNSKDEASEIISNDIDSEKKLDYPLTAAESNEDISV
NNEIEPLADDTDSQVLFDLTRIESNCTINFEPSGNPELSSLNIKSDNIQY
RTENGIVFKSDLSGAADNSDNENATCKGSKSEKLPLKSKTQSTTTPYGLA
CVQKLLSNLILILSPENIFHTNHVRTGLTLITAAFESGADYISKAPNVLL
SQIQNELSKNFILLLQSDRLSFFAASARVCFLMFESMRHHLKFQLEMYLS
RLISIIISDNENIPYEYREVALESIVQLWRIPSFITELYLNYDCDLYCSD
LLHELADLFCKIATPDRSVRCLMNTQVIALDALLFMINCINSRKDDLNRA
IYYDSESSETNPEKKIKLTNPMLYKKRIIKIGTEKFNNDIKDGIKYLREQ
GFCQTNQELASLFRENPRLNKTFIGEYICTRNNVGVREEYIKLFNFRGLR
LDCAIRMFLDEFRLPGEAANIQLILECFAKAYHTSNPEMVSDPDSTFVLL
YAIVMLNVDQHNPNSKKQQAPMTVEQFKRNLYEPNKKKYYGNVEEEVLNK
IYEAIKTEEIVMPSEQRGIIKDNYLWRQLLRRCLTSNATYISADYKNHSY
ELFNLVWKSAVNAFVYVFEVEMDSVINTSMTIGLYQCASIAAYYNLCEIM
DKIIIYISKYTIFSSSQETIEAFGKNEKTKLAAKSMFQIAQKHGDILRDG
WKNLLDCLLCLFKAKLLPKNLTEVDDFISKDKTILLIEEDKSLTKAEAPS
VISHWFFSLTSSDYSSGQRNQEDELTKNEALSVINKCSIPALIEETRFLK
EASLTEFINALINGTRVGDENLINTIHHRQTLKSNPSATISCDNSSWPSG
RDEQSRVFCLELMMRVLLHNSDRINSFLSLIHDHFYTILIGSVIHDFLLE
RTVVACLRLAIQLLRKQEDVDQVFTCLEILALTKTSVLKHVNLHVVCGLH
DLIYMHAANIPSEKDWKLLLTMIEICGGGTKLDPIYKAEIVNRLRKKQIT
SLTKSSKSNNDELSKLSDYDSIHKEIYNSVDDIPNKLLEHSDQSCELQES
CRGYTSDSELYKTTQNNLDSTKWILVSPSEDSVTKNKSAEFIGQTVNDNV
KLYSEYPQPIVNQYNIVLTTAHFVFRDPLAIEKSCEILSYLVRDPAHITP
TNFESCVHTLRVFAEVCVKSSLNKKSSIHNREYCDSGKSPRGRSNYNGNT
KKNIPNPKIHKESHYSDIDSEDELHYKISAQIDKGSINENLLDLMHTLHN
RAAKIYFEWNNTISNDSELNVRLWKNCWCPLLQGMARLCCDIRPEVRTIA
MTFLQRSLLSPVLTSLTGAQWEDCFAKVLFPLLSNFLENIKSQSDSLNSF
NQTENSDPRMRAVQILTKVFLQHLGALHELSTFTALWLTILEYMDSYMKA
NNNCDSLDDAVRESLKNVLLVMYTGTQDRAILVKSESEAGQLLKLTCDRL
YTFLPDLVEELFYEPLLPISDKIEESNENIQSVDETEISEFNQEIKCEE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR035999Sec7_dom_sf
IPR000904Sec7_dom
IPR032691Sec7_N
IPR023394Sec7_C_sf
Vocabulary: molecular function
TermDefinition
GO:0005086ARF guanyl-nucleotide exchange factor activity
Vocabulary: biological process
TermDefinition
GO:0032012regulation of ARF protein signal transduction
GO:0043547positive regulation of GTPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000904Sec7 domainSMARTSM00222sec7_5coord: 622..810
e-value: 1.9E-59
score: 213.5
IPR000904Sec7 domainPFAMPF01369Sec7coord: 625..810
e-value: 3.4E-56
score: 189.8
IPR000904Sec7 domainPROSITEPS50190SEC7coord: 625..808
score: 30.165
IPR000904Sec7 domainCDDcd00171Sec7coord: 625..810
e-value: 2.07089E-54
score: 186.274
IPR023394Sec7, C-terminal domain superfamilyGENE3DG3DSA:1.10.1000.11coord: 697..824
e-value: 4.7E-36
score: 125.2
IPR032691Guanine nucleotide exchange factor, N-terminalPFAMPF12783Sec7_Ncoord: 401..550
e-value: 3.2E-21
score: 75.9
NoneNo IPR availableGENE3DG3DSA:1.10.220.20coord: 610..696
e-value: 3.7E-15
score: 57.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1433..1466
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1440..1454
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 368..389
NoneNo IPR availablePANTHERPTHR10663GUANYL-NUCLEOTIDE EXCHANGE FACTORcoord: 9..1712
NoneNo IPR availablePANTHERPTHR10663:SF316GOLGI-SPECIFIC BREFELDIN A-RESISTANCE GUANINE NUCLEOTIDE EXCHANGE FACTOR 1coord: 9..1712
IPR035999Sec7 domain superfamilySUPERFAMILYSSF48425Sec7 domaincoord: 623..813