Ig-like domain-containing protein

Overview
NameIg-like domain-containing protein
Smed IDSMED30019505
Length (bp)1983
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ig-like domain-containing protein (SMED30019505) t-SNE clustered cells

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30019505) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ig-like domain-containing protein (SMED30019505) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30019505) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019505

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30019505h1SMcG0010632 Contig4553newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019505h1SMcG0010632 Contig4553uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30019505h1SMcG0010632 Contig48306uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019505h1SMcG0010632 Contig48306newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019505h1SMcG0010632 Contig4553newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019505h1SMcG0010632 Contig4553uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30019505h1SMcG0010632 dd_Smed_v4_4401_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30019505h1SMcG0010632 dd_Smed_v4_4401_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019505h1SMcG0010632 dd_Smed_v4_4401_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019505h1SMcG0010632 dd_Smed_v4_4401_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019505h1SMcG0010632 dd_Smed_v4_4401_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30019505h1SMcG0010632 dd_Smed_v4_4401_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30019505h1SMcG0010632 dd_Smed_v4_4401_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: ADAMTSL3 (ADAMTS like 3 [Source:HGNC Symbol;Acc:HGNC:14633])

HSP 1 Score: 94.7449 bits (234), Expect = 2.353e-19
Identity = 81/304 (26.64%), Postives = 125/304 (41.12%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEI 1191
            W  CS  CG+G+Q   + C+             ++CR   KP    ++ C    CP        W + EW  CS +CGG G + R V C   L  G ++N     C+   +   ++ C   DCPP      W KC+   +C   GI+RR+  C      G  + +P      R  P        + PE          K   + P I   +      R  K++ L +G  A++LP+T + IKCPV  F    +QW KD        +  +R+ +++ G L I   +  D G + C AG+    +
Sbjct:  712 WGPCSATCGVGIQTRDVYCLHPG----ETPAPPEECRD-EKPH--ALQACNQFDCPPG------WHIEEWQQCSRTCGG-GTQNRRVTCRQLLTDGSFLNLSDELCQGP-KASSHKSCARTDCPPHLAVGDWSKCSV--SC-GVGIQRRKQVCQRLAAKG--RRIPLSEMMCRDLPGLPLVRSCQMPECSKIKSEMKTKLGEQGPQILSVQRVYIQTREEKRINLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQWEKDGRCL----QNSKRLGITKSGSLKIHGLAAPDIGVYRCIAGSAQETV 991          

HSP 2 Score: 59.6918 bits (143), Expect = 1.655e-8
Identity = 55/212 (25.94%), Postives = 87/212 (41.04%), Query Frame = 1
Query:  139 EEFSLPFRLRSIMNMSIMFVRYALILGSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFI-----------WKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCM 741
            + F +P  L   M   I   RY     S++ F        +W+ +  +  C+  CG G Q N   CV   L                KP+ K +K C +  CP+++  + I           W+   WT+CS SCGG G++ R   C+     G  +  + + C    +P   + C  FDC P++    W +CT    C   G+R R + C+
Sbjct:  305 QTFKIPGPL---MADFIFKTRYTAAKDSVVQFFFYQPISHQWRQTDFFP-CTVTCGGGYQLNSAECVDIRLKRVVPDHYCHYYPENVKPKPK-LKECSMDPCPSSDGFKEIMPYDHFQPLPRWEHNPWTACSVSCGG-GIQRRSFVCVEESMHGEILQVEEWKCMYAPKPKVMQTCNLFDC-PKWIAMEWSQCTV--TCGR-GLRYRVVLCI 506          

HSP 3 Score: 58.9214 bits (141), Expect = 2.955e-8
Identity = 41/135 (30.37%), Postives = 60/135 (44.44%), Query Frame = 1
Query:  445 PTNET--SEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKN-EKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDP 840
            PT E    E  W+ G W+ CS +CG  G R +  QC+++             C    +P+   E C   DCP  +FT+ W +C+   +C   G   RQ+ C  T  NGT + V    C  + +P    + CF  P
Sbjct: 1417 PTGEPPPQEPFWEPGNWSHCSATCGHLGARIQRPQCVMA----NGQEVSEALCDHLQKPLAGFEPCNIRDCPARWFTSVWSQCSV--SC-GEGYHSRQVTCKRTKANGTVQVVSPRACAPKDRPLGR-KPCFGHP 1543          

HSP 4 Score: 52.373 bits (124), Expect = 3.338e-6
Identity = 75/329 (22.80%), Postives = 126/329 (38.30%), Query Frame = 1
Query:  946 LKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYL------SRIIYF---KEDIVEGKN-----NSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKK-NSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYEN-----KVLLPNNCDLSTQPI--ETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIR-MPLLIKKCSAPPCNL 1863
            L + VG          + I+CPV   P  N+ WLK   + +        + +   G L+++  S ++EG ++C A         L +  +    H L      SRI++    K+ I++  N     N       P    W  G WS CS +CG  G + +   C +   +   E       K     +P NIR+      CP  W    +S +C+ +C   G+ +   ++ CK        +V+ P  C    +P+  + C    C  +   E  + C   C       R V  + R+   Q  S  S    R  P L + C++  C++
Sbjct: 1301 LSVVVGGIVEAALGANVTIRCPVKGVPQPNITWLKRGGSLSG------NVSLLFNGSLLLQNVSLENEGTYVCIA------TNALGKAVATSVLHLLERRWPESRIVFLQGHKKYILQATNTRTNSNDPTGEPPPQEPFWEPGNWSHCSATCGHLGARIQRPQCVMANGQEVSEALCDHLQKPLAGFEPCNIRD------CPARWFTSVWS-QCSVSC---GEGYHSRQVTCKRTKANGTVQVVSPRACAPKDRPLGRKPCFGHPCVQW---EPGNRCPGRC-----MGRAVRMQQRHTACQHNSSDSNCDDRKRPTLRRNCTSGACDV 1599          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: ADAMTSL3 (ADAMTS like 3 [Source:HGNC Symbol;Acc:HGNC:14633])

HSP 1 Score: 94.7449 bits (234), Expect = 2.418e-19
Identity = 81/304 (26.64%), Postives = 125/304 (41.12%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEI 1191
            W  CS  CG+G+Q   + C+             ++CR   KP    ++ C    CP        W + EW  CS +CGG G + R V C   L  G ++N     C+   +   ++ C   DCPP      W KC+   +C   GI+RR+  C      G  + +P      R  P        + PE          K   + P I   +      R  K++ L +G  A++LP+T + IKCPV  F    +QW KD        +  +R+ +++ G L I   +  D G + C AG+    +
Sbjct:  712 WGPCSATCGVGIQTRDVYCLHPG----ETPAPPEECRD-EKPH--ALQACNQFDCPPG------WHIEEWQQCSRTCGG-GTQNRRVTCRQLLTDGSFLNLSDELCQGP-KASSHKSCARTDCPPHLAVGDWSKCSV--SC-GVGIQRRKQVCQRLAAKG--RRIPLSEMMCRDLPGLPLVRSCQMPECSKIKSEMKTKLGEQGPQILSVQRVYIQTREEKRINLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQWEKDGRCL----QNSKRLGITKSGSLKIHGLAAPDIGVYRCIAGSAQETV 991          

HSP 2 Score: 72.0182 bits (175), Expect = 3.038e-12
Identity = 60/218 (27.52%), Postives = 97/218 (44.50%), Query Frame = 1
Query: 1318 QWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGK-CLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPI--ETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSC-RWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKHCGLRK---LCSVDHYQHFCCKTCN 1950
            +W    WS CS SCG  GY +R V C+  +    ++V   + C  K+  +P   + C     C  W  G    ++C   C+      +     C++ +     +NCD   +P     C +  C + W T  W  C+++CG  G ++R V C   R+    A   C + K   P+  + C  P C+  C D + +C   K   LCS+D Y+  CC++C 
Sbjct: 1486 RWFTSVWSQCSVSCG-EGYHSRQVTCKRTKANGTVQVVSPRACAPKD--RPLGRKPC-FGHPCVQWEPG----NRCPGRCMGRAVRMQQRHTACQHNSS---DSNCDDRKRPTLRRNCTSGACDVCWHTGPWKPCTAACGR-GFQSRKVDCIHTRSCKPVAKRHCVQKK--KPISWRHCLGPSCDRDCTDTTHYCMFVKHLNLCSLDRYKQRCCQSCQ 1689          

HSP 3 Score: 59.6918 bits (143), Expect = 1.743e-8
Identity = 55/212 (25.94%), Postives = 87/212 (41.04%), Query Frame = 1
Query:  139 EEFSLPFRLRSIMNMSIMFVRYALILGSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFI-----------WKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCM 741
            + F +P  L   M   I   RY     S++ F        +W+ +  +  C+  CG G Q N   CV   L                KP+ K +K C +  CP+++  + I           W+   WT+CS SCGG G++ R   C+     G  +  + + C    +P   + C  FDC P++    W +CT    C   G+R R + C+
Sbjct:  305 QTFKIPGPL---MADFIFKTRYTAAKDSVVQFFFYQPISHQWRQTDFFP-CTVTCGGGYQLNSAECVDIRLKRVVPDHYCHYYPENVKPKPK-LKECSMDPCPSSDGFKEIMPYDHFQPLPRWEHNPWTACSVSCGG-GIQRRSFVCVEESMHGEILQVEEWKCMYAPKPKVMQTCNLFDC-PKWIAMEWSQCTV--TCGR-GLRYRVVLCI 506          

HSP 4 Score: 58.9214 bits (141), Expect = 2.883e-8
Identity = 41/135 (30.37%), Postives = 60/135 (44.44%), Query Frame = 1
Query:  445 PTNET--SEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKN-EKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDP 840
            PT E    E  W+ G W+ CS +CG  G R +  QC+++             C    +P+   E C   DCP  +FT+ W +C+   +C   G   RQ+ C  T  NGT + V    C  + +P    + CF  P
Sbjct: 1417 PTGEPPPQEPFWEPGNWSHCSATCGHLGARIQRPQCVMA----NGQEVSEALCDHLQKPLAGFEPCNIRDCPARWFTSVWSQCSV--SC-GEGYHSRQVTCKRTKANGTVQVVSPRACAPKDRPLGR-KPCFGHP 1543          

HSP 5 Score: 52.7582 bits (125), Expect = 2.655e-6
Identity = 75/329 (22.80%), Postives = 126/329 (38.30%), Query Frame = 1
Query:  946 LKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYL------SRIIYF---KEDIVEGKN-----NSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKK-NSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYEN-----KVLLPNNCDLSTQPI--ETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIR-MPLLIKKCSAPPCNL 1863
            L + VG          + I+CPV   P  N+ WLK   + +        + +   G L+++  S ++EG ++C A         L +  +    H L      SRI++    K+ I++  N     N       P    W  G WS CS +CG  G + +   C +   +   E       K     +P NIR+      CP  W    +S +C+ +C   G+ +   ++ CK        +V+ P  C    +P+  + C    C  +   E  + C   C       R V  + R+   Q  S  S    R  P L + C++  C++
Sbjct: 1301 LSVVVGGIVEAALGANVTIRCPVKGVPQPNITWLKRGGSLSG------NVSLLFNGSLLLQNVSLENEGTYVCIA------TNALGKAVATSVLHLLERRWPESRIVFLQGHKKYILQATNTRTNSNDPTGEPPPQEPFWEPGNWSHCSATCGHLGARIQRPQCVMANGQEVSEALCDHLQKPLAGFEPCNIRD------CPARWFTSVWS-QCSVSC---GEGYHSRQVTCKRTKANGTVQVVSPRACAPKDRPLGRKPCFGHPCVQW---EPGNRCPGRC-----MGRAVRMQQRHTACQHNSSDSNCDDRKRPTLRRNCTSGACDV 1599          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: ADAMTSL1 (ADAMTS like 1 [Source:HGNC Symbol;Acc:HGNC:14632])

HSP 1 Score: 94.7449 bits (234), Expect = 2.621e-19
Identity = 81/298 (27.18%), Postives = 123/298 (41.28%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAG 1173
            WS CS  CG+G+Q   + C         E V        R+P+  T++ C    CP        W   +W  CS +CGG GV+ R+V C   +  G ++      C S  +P   + C   DCP E+  + W +C+   +C   G + R   C    K G S  V    C     PP  + S  + P   + C    +   +  P I+ ++      R  +KL   VG  A++LP T + ++CP        + W KD         +   + V+  GYL I +  P D G + C AG
Sbjct:  675 WSPCSLTCGVGLQTRDVFCSHLLSREMNETVILAD-ELCRQPKPSTVQACNRFNCPP------AWYPAQWQPCSRTCGG-GVQKREVLCKQRMADGSFLELPETFC-SASKPACQQACKKDDCPSEWLLSDWTECST--SCGE-GTQTRSAICRKMLKTGLSTVVNSTLC-----PPLPFSSSIR-PCMLATCARPGRPSTKHSPHIAAARKVYIQTRRQRKLHFVVGGFAYLLPKTAVVLRCPARRVRKPLITWEKDGQHLI----SSTHVTVAPFGYLKIHRLKPSDAGVYTCSAG 950          

HSP 2 Score: 84.7297 bits (208), Expect = 3.719e-16
Identity = 80/367 (21.80%), Postives = 152/367 (41.42%), Query Frame = 1
Query:  958 VGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLI-IKKFSPKDEGKWIC----KAGTITAEIEILTQN---------------PSDGFSHYLSRIIYFKEDI----VEGKNNSAIKYI----KPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPN-NCDLSTQPIET--CHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSC-RWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPC-NLGCMDLSKHC---GLRKLCSVDHYQHFCCKTCN 1950
            +G    + P     + CP+   P  N+ W         +       H+   G ++ +   S   +G++ C    +AG +  +  ++ Q+                + G      R +    ++      GK   A++ I    +    +W+V  WS C++SCG GG QTR V C+ ++              + + +P + + C   Q C  W        +C   C+    + +  ++ C+  + + LP+  C    +P+ T  C +  C++ W+   W+ C+++CGN G ++R V C   R + +    LCS      P   ++C+  PC N+ C D +++C      KLC +  ++  CC TC 
Sbjct: 1402 LGTQLVLDPGNSALLGCPIKGHPVPNITWFHGG--QPIVTATGLTHHILAAGQILQVANLSGGSQGEFSCLAQNEAGVLMQKASLVIQDYWWSVDRLATCSASCGNRGVQQPRLRCLLNSTEVNPAHCAGKVRPAVQPIACNRRDCPSRWMVTSWSACTRSCG-GGVQTRRVTCQKLKASGISTPVSNDMCTQVAKRPVDTQACNQ-QLCVEWAFSS--WGQCNGPCIGPHLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQSRRVECVHARTNKAVPEHLCSWGP--RPANWQRCNITPCENMECRDTTRYCEKVKQLKLCQLSQFKSRCCGTCG 1760          

HSP 3 Score: 82.4185 bits (202), Expect = 1.640e-15
Identity = 58/196 (29.59%), Postives = 104/196 (53.06%), Query Frame = 1
Query:  256 FEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQC--ILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKD 837
            ++W+  + ++ CS++CG GVQE +++C+ K    T E    + C   R+P  + +K+C L  CP        W++G+W+ CS +C G G++TRDV C  +LS      +      C+ + +P   + C  F+CPP ++   W  C+  R C   G+++R++ C     +G+   +P+  C   +  PA  ++C KD
Sbjct:  609 YDWEY-EGFTKCSESCGGGVQEAVVSCLNKQ---TREPAEENLCVTSRRP-PQLLKSCNLDPCPAR------WEIGKWSPCSLTC-GVGLQTRDVFCSHLLSREMNETVILADELCR-QPKPSTVQACNRFNCPPAWYPAQWQPCS--RTCGG-GVQKREVLCKQRMADGSFLELPETFC--SASKPACQQACKKD 786          

HSP 4 Score: 80.1073 bits (196), Expect = 1.018e-14
Identity = 130/599 (21.70%), Postives = 224/599 (37.40%), Query Frame = 1
Query:  142 EFSLPFRLRSIMNMSIMFVRYALILGSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIR---KPREKTMKTCFLGVCPTNETSEFI-----------WKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLK--LNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDL---KLKCKYENKVLLPNNCDLSTQP----IETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGC 1869
            +F +  R     + ++ F+ Y  I+               W+ +  +  CS  CG G Q     C     + +   V+   C       KP+ K ++ C L  CP ++  + I           W+   WT+CS+SCGG G+++R V C+     G   + + + C    +    + C  FDC P++    W  CT    C   G+R R + C+        + +  G C  ++KP    E     P Y+ K +   + K                 + +++L+    V +    +P       C V       ++ ++  +  +F +   +          I +   PK   +  C AG  + EI     + +DG    L       +D  E              Y W    ++ CS+SCG GG Q   V C   + R   E +    L   S +P  + +      CP  W    +S  C+ TC  VG   +D+    L  +  N+ ++  + +L  QP    ++ C+  NC   W   +W  CS +CG  G++ R V C+ R        +   + + +P      S P C   C
Sbjct:  274 DFIVKIRNSGSADSTVQFIFYQPII-------------HRWRETDFFP-CSATCGGGYQLTSAECYD---LRSNRVVADQYCHYYPENIKPKPK-LQECNLDPCPASDGYKQIMPYDLYHPLPRWEATPWTACSSSCGG-GIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPIAQPCNIFDC-PKWLAQEWSPCTV--TCGQ-GLRYRVVLCI------DHRGMHTGGCSPKTKPHIKEECIVPTPCYKPKEKLPVEAKLPW-------------FKQAQELEEGAAVSEEPSFIPEAW--SACTVTCGVGTQVRIVRCQVLLSFSQSVAD--------LPIDECEGPKPASQRACYAGPCSGEIPEFNPDETDGLFGGL-------QDFDE-------------LYDWEYEGFTKCSESCG-GGVQEAVVSCLNKQTREPAEEN----LCVTSRRPPQLLKSCNLDPCPARWEIGKWS-PCSLTC-GVGLQTRDVFCSHLLSREMNETVILAD-ELCRQPKPSTVQACNRFNCPPAWYPAQWQPCSRTCGG-GVQKREVLCKQR--------MADGSFLELPETFCSASKPACQQAC 783          

HSP 5 Score: 57.7658 bits (138), Expect = 6.573e-8
Identity = 48/194 (24.74%), Postives = 79/194 (40.72%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQ 861
            WS+C+++CG GVQ   + C +    G    VS D C ++ K R    + C   +C         W    W  C+  C G  +  +  Q       G  + ++   C +   PV  + C    C   +  + W  CT    C + G + R++ C+    N   K+VP+  C    + PA W+ C   P    +C+
Sbjct: 1554 WSACTRSCGGGVQTRRVTCQKLKASGISTPVSNDMCTQVAK-RPVDTQACNQQLC-------VEWAFSSWGQCNGPCIGPHLAVQHRQVFCQTRDGITLPSEQ--CSALPRPVSTQNCWSEACSVHWRVSLWTLCTA--TCGNYGFQSRRVECVHARTN---KAVPEHLCSWGPR-PANWQRCNITPCENMECR 1731          

HSP 6 Score: 55.4546 bits (132), Expect = 3.204e-7
Identity = 37/123 (30.08%), Postives = 58/123 (47.15%), Query Frame = 1
Query:  463 EFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEP-VKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESC 828
            ++ W V    +CS SCG  GV+   ++C+L   +   +N  H  C  +  P V+   C   DCP  +  TSW  CT  R+C   G++ R++ C     +G S  V    C   +K P   ++C
Sbjct: 1488 DYWWSVDRLATCSASCGNRGVQQPRLRCLL---NSTEVNPAH--CAGKVRPAVQPIACNRRDCPSRWMVTSWSACT--RSCGG-GVQTRRVTCQKLKASGISTPVSNDMCTQVAKRPVDTQAC 1602          

HSP 7 Score: 55.0694 bits (131), Expect = 4.466e-7
Identity = 45/161 (27.95%), Postives = 69/161 (42.86%), Query Frame = 1
Query: 1300 IKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENK----VLLPNNCDLSTQPI--ETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCR 1764
            + P   +W +G WS CS +CG+ G QTR V C  +  R   E            KP  ++ C  F   P W+  +     C+ TC   G   +  ++ CK        + LP     +++P   + C   +C   W    W+ CS+SCG  G + R+  CR
Sbjct:  663 LDPCPARWEIGKWSPCSLTCGV-GLQTRDVFCSHLLSREMNETVILADELCRQPKPSTVQACNRFNCPPAWYPAQ--WQPCSRTC---GGGVQKREVLCKQRMADGSFLELPETFCSASKPACQQACKKDDCPSEWLLSDWTECSTSCGE-GTQTRSAICR 816          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: ADAMTSL1 (ADAMTS like 1 [Source:HGNC Symbol;Acc:HGNC:14632])

HSP 1 Score: 85.5001 bits (210), Expect = 7.113e-17
Identity = 80/366 (21.86%), Postives = 152/366 (41.53%), Query Frame = 1
Query:  958 VGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLI-IKKFSPKDEGKWIC----KAGTITAEIEILTQN---------------PSDGFSHYLSRIIYFKEDI----VEGKNNSAIKYI----KPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPN-NCDLSTQPIET--CHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSC-RWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPC-NLGCMDLSKHC---GLRKLCSVDHYQHFCCKTC 1947
            +G    + P     + CP+   P  N+ W         +       H+   G ++ +   S   +G++ C    +AG +  +  ++ Q+                + G      R +    ++      GK   A++ I    +    +W+V  WS C++SCG GG QTR V C+ ++              + + +P + + C   Q C  W        +C   C+    + +  ++ C+  + + LP+  C    +P+ T  C +  C++ W+   W+ C+++CGN G ++R V C   R + +    LCS      P   ++C+  PC N+ C D +++C      KLC +  ++  CC TC
Sbjct:  103 LGTQLVLDPGNSALLGCPIKGHPVPNITWFHGG--QPIVTATGLTHHILAAGQILQVANLSGGSQGEFSCLAQNEAGVLMQKASLVIQDYWWSVDRLATCSASCGNRGVQQPRLRCLLNSTEVNPAHCAGKVRPAVQPIACNRRDCPSRWMVTSWSACTRSCG-GGVQTRRVTCQKLKASGISTPVSNDMCTQVAKRPVDTQACNQ-QLCVEWAFSS--WGQCNGPCIGPHLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQSRRVECVHARTNKAVPEHLCSWGP--RPANWQRCNITPCENMECRDTTRYCEKVKQLKLCQLSQFKSRCCGTC 460          

HSP 2 Score: 58.5362 bits (140), Expect = 2.718e-8
Identity = 48/194 (24.74%), Postives = 79/194 (40.72%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQ 861
            WS+C+++CG GVQ   + C +    G    VS D C ++ K R    + C   +C         W    W  C+  C G  +  +  Q       G  + ++   C +   PV  + C    C   +  + W  CT    C + G + R++ C+    N   K+VP+  C    + PA W+ C   P    +C+
Sbjct:  255 WSACTRSCGGGVQTRRVTCQKLKASGISTPVSNDMCTQVAK-RPVDTQACNQQLC-------VEWAFSSWGQCNGPCIGPHLAVQHRQVFCQTRDGITLPSEQ--CSALPRPVSTQNCWSEACSVHWRVSLWTLCTA--TCGNYGFQSRRVECVHARTN---KAVPEHLCSWGPR-PANWQRCNITPCENMECR 432          

HSP 3 Score: 55.4546 bits (132), Expect = 2.376e-7
Identity = 37/123 (30.08%), Postives = 58/123 (47.15%), Query Frame = 1
Query:  463 EFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEP-VKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESC 828
            ++ W V    +CS SCG  GV+   ++C+L   +   +N  H  C  +  P V+   C   DCP  +  TSW  CT  R+C   G++ R++ C     +G S  V    C   +K P   ++C
Sbjct:  189 DYWWSVDRLATCSASCGNRGVQQPRLRCLL---NSTEVNPAH--CAGKVRPAVQPIACNRRDCPSRWMVTSWSACT--RSCGG-GVQTRRVTCQKLKASGISTPVSNDMCTQVAKRPVDTQAC 303          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: ADAMTS6 (ADAM metallopeptidase with thrombospondin type 1 motif 6 [Source:HGNC Symbol;Acc:HGNC:222])

HSP 1 Score: 78.9518 bits (193), Expect = 2.059e-14
Identity = 70/233 (30.04%), Postives = 97/233 (41.63%), Query Frame = 1
Query:  115 LESLYITNEEFSLPFRLRSIMNMSIMFVRYALILGSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPA 813
            LE+L  T+E   +   L+   N+ I   RY   +       G     F W N Q WS CS  C  GVQ   + C +   +     V  + C    KP E   + C    CP        W +G+W  CS +C G G+RTR V CI  +         +  C + + PV+ E C    CPP++    W +CT    C  PG + R + C     +  SK+ P   C   SKPP 
Sbjct:  799 LEALGPTSENLIVMVLLQE-QNLGI---RYKFNVPITRTGSGDNEVGFTW-NHQPWSECSATCAGGVQRQEVVCKR---LDDNSIVQNNYCDPDSKPPEN-QRACNTEPCPPE------WFIGDWLECSKTCDG-GMRTRAVLCIRKIGPSEEETLDYSGCLT-HRPVEKEPCNNQSCPPQWVALDWSECTP--KC-GPGFKHRIVLC---KSSDLSKTFPAAQCPEESKPPV 1008          

HSP 2 Score: 57.3806 bits (137), Expect = 7.845e-8
Identity = 70/230 (30.43%), Postives = 101/230 (43.91%), Query Frame = 1
Query: 1318 QWVVGPWSICSKSCGIGGYQTRYVGC-ELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYEN--KVLLPNNCDLSTQP-------IETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIK---KCSAPPCN--LGCMDLSK--HCGLR---KLCSVDHYQHFCCKTC 1947
            +W +G W  CSK+C  GG +TR V C   I       +D   CL    ++    +E    Q CP  W+   +S +CT  C   G  FK   + CK  +  K      C   ++P       +  C  P     W T  W  CS+ CG  G + RTV C   +   QA S C +  +R P + +   KC + P +    C D++K  +C L    K CS  +++  CCKTC
Sbjct:  902 EWFIGDWLECSKTCD-GGMRTRAVLCIRKIGPSEEETLDYSGCLTHRPVE----KEPCNNQSCPPQWVALDWS-ECTPKC---GPGFKHRIVLCKSSDLSKTFPAAQCPEESKPPVRIRCSLGRCPPPR----WVTGDWGQCSAQCG-LGQQMRTVQCL--SYTGQASSDCLET-VRPPSMQQCESKCDSTPISNTEECKDVNKVAYCPLVLKFKFCSRAYFRQMCCKTC 1114          

HSP 3 Score: 55.8398 bits (133), Expect = 2.594e-7
Identity = 52/187 (27.81%), Postives = 87/187 (46.52%), Query Frame = 1
Query: 1315 YQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLK--CKYENKVLLPNNCDLSTQPIET--CHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRN-DNSQAGSLC---SKAKIRMPLLIKKCSAP 1851
            + W   PWS CS +C  GG Q + V C+ ++    ++         +S  P+N R C      P W+IG+    +C++TC    ++   L ++     E + L  + C L+ +P+E   C+N +C   W    WS C+  CG PG K R V C+  +   +   + C   SK  +R+   + +C  P
Sbjct:  842 FTWNHQPWSECSATCA-GGVQRQEVVCKRLDDNSIVQ---NNYCDPDSKPPENQRACNTEPCPPEWFIGDWL--ECSKTCDGGMRTRAVLCIRKIGPSEEETLDYSGC-LTHRPVEKEPCNNQSCPPQWVALDWSECTPKCG-PGFKHRIVLCKSSDLSKTFPAAQCPEESKPPVRIRCSLGRCPPP 1020          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: madd-4 (pep chromosome:WBcel235:I:8931035:8937718:-1 gene:WBGene00009958.1 transcript:F53B6.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:madd-4)

HSP 1 Score: 177.563 bits (449), Expect = 5.110e-47
Identity = 163/631 (25.83%), Postives = 254/631 (40.25%), Query Frame = 1
Query:  256 FEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQC--ILSLYSGGYMNAKHYDCKSEYE-PVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPA----TWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEI-------------LTQNPSDGFSHYLSRIIYFKEDIV------------------------EGKNNSAIKYIKPLFYQWVVGPWSIC-SKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLP-NNCDLSTQPIET--CHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSA----PPC----------NLGCMDLSKHCGLRKL---CSVDHYQHFCCKTCNY 1953
            ++W+    W+ CS +C  G Q+  L C+Q   + T + V + +C   R+P EK+ + C    CP        W   +++ CS SCG  G   R V+C   +S   G   +    D +  ++ P + E C    CP  + T  W +C+  R+C S G RRRQ+ C +    G ++  P   C   +KP      ++ SC + PE  S   F                         KKL L +G  A +   T I+IKCP   F  + + W K+        +    I VS  G L +     +D G + C    +   + +             L   P    +    R+   KED++                        E       KY   L  +W +G WS C  K+C + GYQ R + C++        VD   C    S++P   R C   + CP W   + +S   ++ C+    + K   + C++ N   +   +CD++ +P  T  C N NC   W+T  W +CSS CG  G++ R +SC W +    AG  C   ++R P   + C A    PPC          +  C D S+ C + KL   C     +  CC TC +
Sbjct:  118 YQWRYGD-WTQCSASCLGGKQKAALKCIQ---VSTGKSVQWSQCDARRRPPEKS-RPCNQHPCPP------FWLTSKYSDCSMSCGS-GTARRSVKCAQTVSKTDGADAHIVLRDDRCHFKKPQETETCNVVACPATWVTAQWTECS--RSCDS-GERRRQVWCEIRDSRGKTQRRPDVECDANTKPQTVEVCSFGSCSR-PELLSNRVF-------------------EQNAEQKKLTLGIGGVATLYQGTSIKIKCPAKKFDKKKIYWKKNGKKI----KNDAHIKVSANGNLRVFHARMEDAGVYECFTDRLQGNVTLNFKYRDFPASRVDLAPKPQIPSTKNRQRVQVSKEDVLREQASVLHKMNVSLIEALLTAPNDEKAREQLRKYGNELVARWDIGHWSECRQKTCHVAGYQARGISCKVTFHGEIRNVDNSICESLASVRPPETRPC-HREDCPRWEASQ-WSECSSQRCVSSMLAQKRRNVTCRFTNGTSVDIQHCDITNRPATTMDCPNQNCKAEWRTSDWGSCSSECGTGGVQLRLLSCVWISSGRPAGRNCE--QMRRPHSARACVADEPLPPCMPTASALYQRDASCQDQSRFCDIIKLFHSCDSLEVRQKCCSTCTF 705          

HSP 2 Score: 66.6254 bits (161), Expect = 3.896e-11
Identity = 58/211 (27.49%), Postives = 93/211 (44.08%), Query Frame = 1
Query:  238 GPTRGKFEWQNSQL----WSSCSKACGIGVQENLLACVQKTLIGTYE-KVSYDKCRRIRKPREKTMKTCFLGVCPTNETSE-------FIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCM--VTTKNGTSKSVPKGNCYIRSKPPATWESC 828
            G      +WQ  +L    WS+CS  CG GV    + CV    I +   K+   +C+   +P  K  ++C +  CP  E S+       + W+ G+WT CS SC G G +   ++CI  + +G  +     D +    P K+  C    CPP + T+ +  C+   +C S G  RR + C   V+  +G    +   +     K P   E+C
Sbjct:   32 GSMDNHNDWQAPRLVAGEWSTCSSTCGTGVMSRTVECVAVNPISSAPIKLPMSECQDQEQP--KLFESCEVRSCPLQEDSKLSEDEAPYQWRYGDWTQCSASCLG-GKQKAALKCI-QVSTGKSVQWSQCDAR-RRPPEKSRPCNQHPCPPFWLTSKYSDCSM--SCGS-GTARRSVKCAQTVSKTDGADAHIVLRDDRCHFKKPQETETC 234          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: madd-4 (pep chromosome:WBcel235:I:8931035:8942287:-1 gene:WBGene00009958.1 transcript:F53B6.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:madd-4)

HSP 1 Score: 176.792 bits (447), Expect = 4.402e-46
Identity = 163/631 (25.83%), Postives = 254/631 (40.25%), Query Frame = 1
Query:  256 FEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQC--ILSLYSGGYMNAKHYDCKSEYE-PVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPA----TWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEI-------------LTQNPSDGFSHYLSRIIYFKEDIV------------------------EGKNNSAIKYIKPLFYQWVVGPWSIC-SKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLP-NNCDLSTQPIET--CHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSA----PPC----------NLGCMDLSKHCGLRKL---CSVDHYQHFCCKTCNY 1953
            ++W+    W+ CS +C  G Q+  L C+Q   + T + V + +C   R+P EK+ + C    CP        W   +++ CS SCG  G   R V+C   +S   G   +    D +  ++ P + E C    CP  + T  W +C+  R+C S G RRRQ+ C +    G ++  P   C   +KP      ++ SC + PE  S   F                         KKL L +G  A +   T I+IKCP   F  + + W K+        +    I VS  G L +     +D G + C    +   + +             L   P    +    R+   KED++                        E       KY   L  +W +G WS C  K+C + GYQ R + C++        VD   C    S++P   R C   + CP W   + +S   ++ C+    + K   + C++ N   +   +CD++ +P  T  C N NC   W+T  W +CSS CG  G++ R +SC W +    AG  C   ++R P   + C A    PPC          +  C D S+ C + KL   C     +  CC TC +
Sbjct:  452 YQWRYGD-WTQCSASCLGGKQKAALKCIQ---VSTGKSVQWSQCDARRRPPEKS-RPCNQHPCPP------FWLTSKYSDCSMSCGS-GTARRSVKCAQTVSKTDGADAHIVLRDDRCHFKKPQETETCNVVACPATWVTAQWTECS--RSCDS-GERRRQVWCEIRDSRGKTQRRPDVECDANTKPQTVEVCSFGSCSR-PELLSNRVF-------------------EQNAEQKKLTLGIGGVATLYQGTSIKIKCPAKKFDKKKIYWKKNGKKI----KNDAHIKVSANGNLRVFHARMEDAGVYECFTDRLQGNVTLNFKYRDFPASRVDLAPKPQIPSTKNRQRVQVSKEDVLREQASVLHKMNVSLIEALLTAPNDEKAREQLRKYGNELVARWDIGHWSECRQKTCHVAGYQARGISCKVTFHGEIRNVDNSICESLASVRPPETRPC-HREDCPRWEASQ-WSECSSQRCVSSMLAQKRRNVTCRFTNGTSVDIQHCDITNRPATTMDCPNQNCKAEWRTSDWGSCSSECGTGGVQLRLLSCVWISSGRPAGRNCE--QMRRPHSARACVADEPLPPCMPTASALYQRDASCQDQSRFCDIIKLFHSCDSLEVRQKCCSTCTF 1039          

HSP 2 Score: 66.6254 bits (161), Expect = 4.472e-11
Identity = 63/234 (26.92%), Postives = 102/234 (43.59%), Query Frame = 1
Query:  169 SIMNMSIMFVRYALILGSLLGFCGPTRGKFEWQNSQL----WSSCSKACGIGVQENLLACVQKTLIGTYE-KVSYDKCRRIRKPREKTMKTCFLGVCPTNETSE-------FIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCM--VTTKNGTSKSVPKGNCYIRSKPPATWESC 828
            SI   S+ +   A + G+  G         +WQ  +L    WS+CS  CG GV    + CV    I +   K+   +C+   +P  K  ++C +  CP  E S+       + W+ G+WT CS SC G G +   ++CI  + +G  +     D +    P K+  C    CPP + T+ +  C+   +C S G  RR + C   V+  +G    +   +     K P   E+C
Sbjct:  346 SIATNSLDWNDRAYLDGNTFG---SMDNHNDWQAPRLVAGEWSTCSSTCGTGVMSRTVECVAVNPISSAPIKLPMSECQDQEQP--KLFESCEVRSCPLQEDSKLSEDEAPYQWRYGDWTQCSASCLG-GKQKAALKCI-QVSTGKSVQWSQCDAR-RRPPEKSRPCNQHPCPPFWLTSKYSDCSM--SCGS-GTARRSVKCAQTVSKTDGADAHIVLRDDRCHFKKPQETETC 568          

HSP 3 Score: 51.6026 bits (122), Expect = 1.714e-6
Identity = 53/226 (23.45%), Postives = 91/226 (40.27%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWK-------------------------VGEWTSCSTSCGGEGVRTRDVQCI-LSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTT-------------SWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDP 840
            WS C+ +CG GV+   +ACV  +            C    +PR++T  TC+ G+  +  T+   W                           GEW++CS++C G GV +R V+C+ ++  S   +     +C+ + +P   E C    CP +  +               W +C+   +C   G ++  + C+  +   T KSV    C  R +PP     C + P
Sbjct:  303 WSKCTASCGQGVRRRHVACVGGS-----------DCDEGGRPRQET--TCYAGIPCSIATNSLDWNDRAYLDGNTFGSMDNHNDWQAPRLVAGEWSTCSSTC-GTGVMSRTVECVAVNPISSAPIKLPMSECQDQEQPKLFESCEVRSCPLQEDSKLSEDEAPYQWRYGDWTQCSA--SCLG-GKQKAALKCIQVS---TGKSVQWSQCDARRRPPEKSRPCNQHP 508          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: madd-4 (pep chromosome:WBcel235:I:8931035:8942287:-1 gene:WBGene00009958.1 transcript:F53B6.2c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:madd-4)

HSP 1 Score: 176.407 bits (446), Expect = 5.420e-46
Identity = 165/631 (26.15%), Postives = 257/631 (40.73%), Query Frame = 1
Query:  256 FEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQC--ILSLYSGGYMNAKHYDCKSEYE-PVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPA----TWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEI-------------LTQNPSDGFSHYLSRIIYFKEDIVEGK-------NNSAI-----------------KYIKPLFYQWVVGPWSIC-SKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLP-NNCDLSTQPIET--CHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSA----PPC----------NLGCMDLSKHCGLRKL---CSVDHYQHFCCKTCNY 1953
            ++W+    W+ CS +C  G Q+  L C+Q   + T + V + +C   R+P EK+ + C    CP        W   +++ CS SCG  G   R V+C   +S   G   +    D +  ++ P + E C    CP  + T  W +C+  R+C S G RRRQ+ C +    G ++  P   C   +KP      ++ SC + PE  S   F                         KKL L +G  A +   T I+IKCP   F  + + W K+        +    I VS  G L +     +D G + C    +   + +             L   P    +    R+   KED++  +       N S I                 KY   L  +W +G WS C  K+C + GYQ R + C++        VD   C    S++P   R C   + CP W   + +S   ++ C+    + K   + C++ N   +   +CD++ +P  T  C N NC   W+T  W +CSS CG  G++ R +SC W +    AG  C   ++R P   + C A    PPC          +  C D S+ C + KL   C     +  CC TC +
Sbjct:  450 YQWRYGD-WTQCSASCLGGKQKAALKCIQ---VSTGKSVQWSQCDARRRPPEKS-RPCNQHPCPP------FWLTSKYSDCSMSCGS-GTARRSVKCAQTVSKTDGADAHIVLRDDRCHFKKPQETETCNVVACPATWVTAQWTECS--RSCDS-GERRRQVWCEIRDSRGKTQRRPDVECDANTKPQTVEVCSFGSCSR-PELLSNRVF-------------------EQNAEQKKLTLGIGGVATLYQGTSIKIKCPAKKFDKKKIYWKKNGKKI----KNDAHIKVSANGNLRVFHARMEDAGVYECFTDRLQGNVTLNFKYRDFPASRVDLAPKPQIPSTKNRQRVQVSKEDVLREQASVLHKMNVSLIEALLTAPNDEKAREQLRKYGNELVARWDIGHWSECRQKTCHVAGYQARGISCKVTFHGEIRNVDNSICESLASVRPPETRPC-HREDCPRWEASQ-WSECSSQRCVSSMLAQKRRNVTCRFTNGTSVDIQHCDITNRPATTMDCPNQNCKAEWRTSDWGSCSSECGTGGVQLRLLSCVWISSGRPAGRNCE--QMRRPHSARACVADEPLPPCMPTASALYQRDASCQDQSRFCDIIKLFHSCDSLEVRQKCCSTCTF 1037          

HSP 2 Score: 66.6254 bits (161), Expect = 4.869e-11
Identity = 63/234 (26.92%), Postives = 102/234 (43.59%), Query Frame = 1
Query:  169 SIMNMSIMFVRYALILGSLLGFCGPTRGKFEWQNSQL----WSSCSKACGIGVQENLLACVQKTLIGTYE-KVSYDKCRRIRKPREKTMKTCFLGVCPTNETSE-------FIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCM--VTTKNGTSKSVPKGNCYIRSKPPATWESC 828
            SI   S+ +   A + G+  G         +WQ  +L    WS+CS  CG GV    + CV    I +   K+   +C+   +P  K  ++C +  CP  E S+       + W+ G+WT CS SC G G +   ++CI  + +G  +     D +    P K+  C    CPP + T+ +  C+   +C S G  RR + C   V+  +G    +   +     K P   E+C
Sbjct:  344 SIATNSLDWNDRAYLDGNTFG---SMDNHNDWQAPRLVAGEWSTCSSTCGTGVMSRTVECVAVNPISSAPIKLPMSECQDQEQP--KLFESCEVRSCPLQEDSKLSEDEAPYQWRYGDWTQCSASCLG-GKQKAALKCI-QVSTGKSVQWSQCDAR-RRPPEKSRPCNQHPCPPFWLTSKYSDCSM--SCGS-GTARRSVKCAQTVSKTDGADAHIVLRDDRCHFKKPQETETC 566          

HSP 3 Score: 51.6026 bits (122), Expect = 1.758e-6
Identity = 53/226 (23.45%), Postives = 91/226 (40.27%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWK-------------------------VGEWTSCSTSCGGEGVRTRDVQCI-LSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTT-------------SWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDP 840
            WS C+ +CG GV+   +ACV  +            C    +PR++T  TC+ G+  +  T+   W                           GEW++CS++C G GV +R V+C+ ++  S   +     +C+ + +P   E C    CP +  +               W +C+   +C   G ++  + C+  +   T KSV    C  R +PP     C + P
Sbjct:  301 WSKCTASCGQGVRRRHVACVGGS-----------DCDEGGRPRQET--TCYAGIPCSIATNSLDWNDRAYLDGNTFGSMDNHNDWQAPRLVAGEWSTCSSTC-GTGVMSRTVECVAVNPISSAPIKLPMSECQDQEQPKLFESCEVRSCPLQEDSKLSEDEAPYQWRYGDWTQCSA--SCLG-GKQKAALKCIQVS---TGKSVQWSQCDARRRPPEKSRPCNQHP 506          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: mig-6 (Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840])

HSP 1 Score: 60.4622 bits (145), Expect = 4.087e-9
Identity = 49/185 (26.49%), Postives = 79/185 (42.70%), Query Frame = 1
Query:  139 EEFSLPFRLRSIMNMSIMFVRYALILGSLLGFCGPTRGKFEWQNS-QLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTK 690
            E  S    L   + ++++F + +        F  P   + ++      W+ CS +CG GVQ   L C+     G   +V  D C      + +  K+C    C      E  W  G+W SCS++CG +G + R V C     +G  +  +  +C  E  PVK + C  F C PE+    W  C++
Sbjct:  302 ETLSAQGPLSEELTVALLFRKGSRDTAIKYEFSIPLEEEVDYMYKFDNWTPCSVSCGKGVQTRNLYCIDGKNKG---RVEDDLCEENNATKPEFEKSCETVDC------EAEWFTGDWESCSSTCGDQGQQYRVVYCHQVFANGRRVTVEDGNCTVERPPVK-QTCNRFAC-PEWQAGPWSACSE 475          

HSP 2 Score: 59.6918 bits (143), Expect = 8.008e-9
Identity = 43/139 (30.94%), Postives = 65/139 (46.76%), Query Frame = 1
Query:  445 PTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMN---AKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQS 852
            P  E  ++++K   WT CS SC G+GV+TR++ CI     G   +    ++   K E+E    + C   DC  E+FT  W  C+    C   G + R + C     NG   +V  GNC +   P     + F  PE+Q+
Sbjct:  336 PLEEEVDYMYKFDNWTPCSVSC-GKGVQTRNLYCIDGKNKGRVEDDLCEENNATKPEFE----KSCETVDCEAEWFTGDWESCSST--CGDQGQQYRVVYCHQVFANGRRVTVEDGNCTVERPPVKQTCNRFACPEWQA 467          

HSP 3 Score: 52.373 bits (124), Expect = 1.378e-6
Identity = 47/170 (27.65%), Postives = 71/170 (41.76%), Query Frame = 1
Query: 1150 GKW-ICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPIE 1656
            G+W +C     T E   +T   S G ++ L + +      +     S      P  Y+W V  WS C+  CG  G++TR V C + +      VD G C    + KP+    C   +KC   W    +S +CT  C   G   +D    C   +K  +P  CD + +P E
Sbjct:  532 GEWNLCTRCNDTEETREVTCKDSQGRAYPLEKCLVDNSTEIPTDTRSCATQ-PPCEYEWTVSEWSKCTTECGH-GHKTRRVICAIHQNGGLEVVDEGHC---QAEKPEGKTNCTNEEKCTGTWYTSSWS-ECTAEC---GGGSQDRVAVCLNYDKKPVPEWCDEAVKPSE 692          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: mig-6 (Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840])

HSP 1 Score: 60.4622 bits (145), Expect = 4.087e-9
Identity = 49/185 (26.49%), Postives = 79/185 (42.70%), Query Frame = 1
Query:  139 EEFSLPFRLRSIMNMSIMFVRYALILGSLLGFCGPTRGKFEWQNS-QLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTK 690
            E  S    L   + ++++F + +        F  P   + ++      W+ CS +CG GVQ   L C+     G   +V  D C      + +  K+C    C      E  W  G+W SCS++CG +G + R V C     +G  +  +  +C  E  PVK + C  F C PE+    W  C++
Sbjct:  302 ETLSAQGPLSEELTVALLFRKGSRDTAIKYEFSIPLEEEVDYMYKFDNWTPCSVSCGKGVQTRNLYCIDGKNKG---RVEDDLCEENNATKPEFEKSCETVDC------EAEWFTGDWESCSSTCGDQGQQYRVVYCHQVFANGRRVTVEDGNCTVERPPVK-QTCNRFAC-PEWQAGPWSACSE 475          

HSP 2 Score: 59.6918 bits (143), Expect = 8.008e-9
Identity = 43/139 (30.94%), Postives = 65/139 (46.76%), Query Frame = 1
Query:  445 PTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMN---AKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQS 852
            P  E  ++++K   WT CS SC G+GV+TR++ CI     G   +    ++   K E+E    + C   DC  E+FT  W  C+    C   G + R + C     NG   +V  GNC +   P     + F  PE+Q+
Sbjct:  336 PLEEEVDYMYKFDNWTPCSVSC-GKGVQTRNLYCIDGKNKGRVEDDLCEENNATKPEFE----KSCETVDCEAEWFTGDWESCSST--CGDQGQQYRVVYCHQVFANGRRVTVEDGNCTVERPPVKQTCNRFACPEWQA 467          

HSP 3 Score: 52.373 bits (124), Expect = 1.378e-6
Identity = 47/170 (27.65%), Postives = 71/170 (41.76%), Query Frame = 1
Query: 1150 GKW-ICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPIE 1656
            G+W +C     T E   +T   S G ++ L + +      +     S      P  Y+W V  WS C+  CG  G++TR V C + +      VD G C    + KP+    C   +KC   W    +S +CT  C   G   +D    C   +K  +P  CD + +P E
Sbjct:  532 GEWNLCTRCNDTEETREVTCKDSQGRAYPLEKCLVDNSTEIPTDTRSCATQ-PPCEYEWTVSEWSKCTTECGH-GHKTRRVICAIHQNGGLEVVDEGHC---QAEKPEGKTNCTNEEKCTGTWYTSSWS-ECTAEC---GGGSQDRVAVCLNYDKKPVPEWCDEAVKPSE 692          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: nolo (gene:FBgn0051619 transcript:FBtr0339131)

HSP 1 Score: 91.2781 bits (225), Expect = 1.527e-18
Identity = 93/310 (30.00%), Postives = 135/310 (43.55%), Query Frame = 1
Query:  274 QLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGG--YMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEI 1197
            Q ++SCS +C  GV+E ++ CV++        VS   C    KP E  ++TC    CP        W   ++T CS SCG  G++TR+VQCI  +  GG   M   +  C  +  P   + C   DCP  +    W KC+    C   G + R++ C            P+  C   S  PA  + C   P            +  KP I   +   I H     K+ L VG    V   T+++IKCPV  +    ++W KD+      R+ K    VS+KG L I   + +D G + C AG  +AEI I
Sbjct:  632 QGYTSCSASCLGGVEELIINCVRED---NGRVVSPFLCSPETKP-EARVRTCNDRPCPPR------WNYSDYTPCSKSCG-IGIKTREVQCIHEVTRGGDNTMVVPNSMCP-QPPPADRQYCNVLDCPVRWEVGEWSKCS--HTCGY-GFKDRKVECKQIMAQEHKIERPESMCP--SAKPADKKPCNVKP---------CPPEDPKPVIQINNSTHIQHDPKKTKITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKWSKDHKPLQRSRKYK----VSKKGALRILDITFRDAGVYSCHAGLSSAEISI 911          

HSP 2 Score: 57.7658 bits (138), Expect = 3.427e-8
Identity = 32/89 (35.96%), Postives = 51/89 (57.30%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQC 546
            WS+CS+ CG G +E ++ C +++  G   +V+   C   R P+  T +TC +  CP        W+V +WT CS SC G+G++ R V+C
Sbjct:  320 WSTCSRLCGHGYRERMVVCAEES-NGIKTRVADIMC---RTPKPPTQETCIIEECPH-------WEVEDWTGCSVSC-GQGIQMRGVEC 396          

HSP 3 Score: 54.299 bits (129), Expect = 3.523e-7
Identity = 56/187 (29.95%), Postives = 85/187 (45.45%), Query Frame = 1
Query: 1303 KPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDL---STQPI--ETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAK-IRMPLLIKKCS 1845
            +PLF  W + P S CS +CG G   +R +      R    +VD   C   N  +P+   E      CP  WI + +S  C+  C   G  +++  + C  E+  +     D+   + +P   ETC    C   W+ E W+ CS SCG  GI+ R V C+     S  GSL +K   +  P  +++CS
Sbjct:  251 QPLF-NWEMAPMSQCSVTCGSGYKMSRPI---CRNRLTNADVDDTLCSVTN--RPEASVEQCNTHSCPPRWIADDWS-TCSRLC---GHGYRERMVVCAEESNGIKTRVADIMCRTPKPPTQETCIIEECP-HWEVEDWTGCSVSCGQ-GIQMRGVECK-----STDGSLSAKCDPLTKPGSMQQCS 420          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: nolo (gene:FBgn0051619 transcript:FBtr0339132)

HSP 1 Score: 90.8929 bits (224), Expect = 1.637e-18
Identity = 93/310 (30.00%), Postives = 135/310 (43.55%), Query Frame = 1
Query:  274 QLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGG--YMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEI 1197
            Q ++SCS +C  GV+E ++ CV++        VS   C    KP E  ++TC    CP        W   ++T CS SCG  G++TR+VQCI  +  GG   M   +  C  +  P   + C   DCP  +    W KC+    C   G + R++ C            P+  C   S  PA  + C   P            +  KP I   +   I H     K+ L VG    V   T+++IKCPV  +    ++W KD+      R+ K    VS+KG L I   + +D G + C AG  +AEI I
Sbjct:  625 QGYTSCSASCLGGVEELIINCVRED---NGRVVSPFLCSPETKP-EARVRTCNDRPCPPR------WNYSDYTPCSKSCG-IGIKTREVQCIHEVTRGGDNTMVVPNSMCP-QPPPADRQYCNVLDCPVRWEVGEWSKCS--HTCGY-GFKDRKVECKQIMAQEHKIERPESMCP--SAKPADKKPCNVKP---------CPPEDPKPVIQINNSTHIQHDPKKTKITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKWSKDHKPLQRSRKYK----VSKKGALRILDITFRDAGVYSCHAGLSSAEISI 904          

HSP 2 Score: 85.5001 bits (210), Expect = 8.961e-17
Identity = 70/277 (25.27%), Postives = 117/277 (42.24%), Query Frame = 1
Query: 1210 PSDGFSHYLSRIIYFKEDIVEGKNNSAIKYI--KPLFYQWVVGPWSICSKSCGIGG--YQTRYVGCELIERRYFIE---------VDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPI--ETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLG--------CMDLSKHCGLRK---LCSVDHYQHFCCKTCNYK*N 1962
            P     H    + + + +     + +A+  +      Y+W++G WS CS+ CG  G   Q R V C+   +              VD  +C       P+  + C   + CP W  G+ ++      C     + +  ++ C+Y N     + CD   +P   + C+N  C   W+ E WS C++ CG  GIK R + C W      AG++C K + R P ++K C +P C           C D S++C   +   LC +  Y+  CC +C  + N
Sbjct: 1070 PEADVPHVPPHMPHARWETGAAASTTAVPSLPNDGFVYRWMLGEWSQCSQECGAAGSGLQRRTVSCQRAAKATSSGSTSDTENNVVDNSECFAHGLELPEFFQSCG-NEACPQWSKGD-WTPCQRSHCHGRNTAMQRREVTCRYPNGTEG-SICDEYERPAMRQECYNERCEGVWRVEPWSECNAPCGRKGIKYRILQCVWYGSRRPAGNVC-KHQPR-PAVMKVCKSPACQAQLSSSPAQLCRDSSRYCRNARAMGLCRLHRYKLKCCGSCEQQPN 1341          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: nolo (gene:FBgn0051619 transcript:FBtr0085901)

HSP 1 Score: 90.8929 bits (224), Expect = 1.683e-18
Identity = 93/310 (30.00%), Postives = 135/310 (43.55%), Query Frame = 1
Query:  274 QLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGG--YMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEI 1197
            Q ++SCS +C  GV+E ++ CV++        VS   C    KP E  ++TC    CP        W   ++T CS SCG  G++TR+VQCI  +  GG   M   +  C  +  P   + C   DCP  +    W KC+    C   G + R++ C            P+  C   S  PA  + C   P            +  KP I   +   I H     K+ L VG    V   T+++IKCPV  +    ++W KD+      R+ K    VS+KG L I   + +D G + C AG  +AEI I
Sbjct:  632 QGYTSCSASCLGGVEELIINCVRED---NGRVVSPFLCSPETKP-EARVRTCNDRPCPPR------WNYSDYTPCSKSCG-IGIKTREVQCIHEVTRGGDNTMVVPNSMCP-QPPPADRQYCNVLDCPVRWEVGEWSKCS--HTCGY-GFKDRKVECKQIMAQEHKIERPESMCP--SAKPADKKPCNVKP---------CPPEDPKPVIQINNSTHIQHDPKKTKITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKWSKDHKPLQRSRKYK----VSKKGALRILDITFRDAGVYSCHAGLSSAEISI 911          

HSP 2 Score: 85.1149 bits (209), Expect = 1.057e-16
Identity = 70/277 (25.27%), Postives = 117/277 (42.24%), Query Frame = 1
Query: 1210 PSDGFSHYLSRIIYFKEDIVEGKNNSAIKYI--KPLFYQWVVGPWSICSKSCGIGG--YQTRYVGCELIERRYFIE---------VDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPI--ETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLG--------CMDLSKHCGLRK---LCSVDHYQHFCCKTCNYK*N 1962
            P     H    + + + +     + +A+  +      Y+W++G WS CS+ CG  G   Q R V C+   +              VD  +C       P+  + C   + CP W  G+ ++      C     + +  ++ C+Y N     + CD   +P   + C+N  C   W+ E WS C++ CG  GIK R + C W      AG++C K + R P ++K C +P C           C D S++C   +   LC +  Y+  CC +C  + N
Sbjct: 1077 PEADVPHVPPHMPHARWETGAAASTTAVPSLPNDGFVYRWMLGEWSQCSQECGAAGSGLQRRTVSCQRAAKATSSGSTSDTENNVVDNSECFAHGLELPEFFQSCG-NEACPQWSKGD-WTPCQRSHCHGRNTAMQRREVTCRYPNGTEG-SICDEYERPAMRQECYNERCEGVWRVEPWSECNAPCGRKGIKYRILQCVWYGSRRPAGNVC-KHQPR-PAVMKVCKSPACQAQLSSSPAQLCRDSSRYCRNARAMGLCRLHRYKLKCCGSCEQQPN 1348          

HSP 3 Score: 57.3806 bits (137), Expect = 4.771e-8
Identity = 32/89 (35.96%), Postives = 51/89 (57.30%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQC 546
            WS+CS+ CG G +E ++ C +++  G   +V+   C   R P+  T +TC +  CP        W+V +WT CS SC G+G++ R V+C
Sbjct:  320 WSTCSRLCGHGYRERMVVCAEES-NGIKTRVADIMC---RTPKPPTQETCIIEECPH-------WEVEDWTGCSVSC-GQGIQMRGVEC 396          

HSP 4 Score: 53.9138 bits (128), Expect = 4.457e-7
Identity = 56/187 (29.95%), Postives = 85/187 (45.45%), Query Frame = 1
Query: 1303 KPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDL---STQPI--ETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAK-IRMPLLIKKCS 1845
            +PLF  W + P S CS +CG G   +R +      R    +VD   C   N  +P+   E      CP  WI + +S  C+  C   G  +++  + C  E+  +     D+   + +P   ETC    C   W+ E W+ CS SCG  GI+ R V C+     S  GSL +K   +  P  +++CS
Sbjct:  251 QPLF-NWEMAPMSQCSVTCGSGYKMSRPI---CRNRLTNADVDDTLCSVTN--RPEASVEQCNTHSCPPRWIADDWS-TCSRLC---GHGYRERMVVCAEESNGIKTRVADIMCRTPKPPTQETCIIEECP-HWEVEDWTGCSVSCGQ-GIQMRGVECK-----STDGSLSAKCDPLTKPGSMQQCS 420          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: nolo (gene:FBgn0051619 transcript:FBtr0301000)

HSP 1 Score: 90.8929 bits (224), Expect = 1.774e-18
Identity = 93/310 (30.00%), Postives = 135/310 (43.55%), Query Frame = 1
Query:  274 QLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGG--YMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEI 1197
            Q ++SCS +C  GV+E ++ CV++        VS   C    KP E  ++TC    CP        W   ++T CS SCG  G++TR+VQCI  +  GG   M   +  C  +  P   + C   DCP  +    W KC+    C   G + R++ C            P+  C   S  PA  + C   P            +  KP I   +   I H     K+ L VG    V   T+++IKCPV  +    ++W KD+      R+ K    VS+KG L I   + +D G + C AG  +AEI I
Sbjct:  632 QGYTSCSASCLGGVEELIINCVRED---NGRVVSPFLCSPETKP-EARVRTCNDRPCPPR------WNYSDYTPCSKSCG-IGIKTREVQCIHEVTRGGDNTMVVPNSMCP-QPPPADRQYCNVLDCPVRWEVGEWSKCS--HTCGY-GFKDRKVECKQIMAQEHKIERPESMCP--SAKPADKKPCNVKP---------CPPEDPKPVIQINNSTHIQHDPKKTKITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKWSKDHKPLQRSRKYK----VSKKGALRILDITFRDAGVYSCHAGLSSAEISI 911          

HSP 2 Score: 86.6557 bits (213), Expect = 3.516e-17
Identity = 86/361 (23.82%), Postives = 144/361 (39.89%), Query Frame = 1
Query:  988 TRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEI----------EILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYI--KPLFYQWVVGPWSICSKSCGIGG--YQTRYVGCELIERRYFIE---------VDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPI--ETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLG--------CMDLSKHCGLRK---LCSVDHYQHFCCKTCNYK*N 1962
            TR  +  P       NLQ  KD+     ++    +  +   G    K F  +DE + +  A  +  E+          E     P     H    + + + +     + +A+  +      Y+W++G WS CS+ CG  G   Q R V C+   +              VD  +C       P+  + C   + CP W  G+ ++      C     + +  ++ C+Y N     + CD   +P   + C+N  C   W+ E WS C++ CG  GIK R + C W      AG++C K + R P ++K C +P C           C D S++C   +   LC +  Y+  CC +C  + N
Sbjct: 1034 TRTLLAMPYFQALLSNLQRFKDSRGQHLLQGEALKFGIDLSG----KDFD-QDESERV-PAEQLPPEVLHSPSDPEYHEPSKSGPEADVPHVPPHMPHARWETGAAASTTAVPSLPNDGFVYRWMLGEWSQCSQECGAAGSGLQRRTVSCQRAAKATSSGSTSDTENNVVDNSECFAHGLELPEFFQSCG-NEACPQWSKGD-WTPCQRSHCHGRNTAMQRREVTCRYPNGTEG-SICDEYERPAMRQECYNERCEGVWRVEPWSECNAPCGRKGIKYRILQCVWYGSRRPAGNVC-KHQPR-PAVMKVCKSPACQAQLSSSPAQLCRDSSRYCRNARAMGLCRLHRYKLKCCGSCEQQPN 1383          

HSP 3 Score: 57.3806 bits (137), Expect = 4.556e-8
Identity = 32/89 (35.96%), Postives = 51/89 (57.30%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQC 546
            WS+CS+ CG G +E ++ C +++  G   +V+   C   R P+  T +TC +  CP        W+V +WT CS SC G+G++ R V+C
Sbjct:  320 WSTCSRLCGHGYRERMVVCAEES-NGIKTRVADIMC---RTPKPPTQETCIIEECPH-------WEVEDWTGCSVSC-GQGIQMRGVEC 396          

HSP 4 Score: 54.299 bits (129), Expect = 3.906e-7
Identity = 56/187 (29.95%), Postives = 85/187 (45.45%), Query Frame = 1
Query: 1303 KPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDL---STQPI--ETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAK-IRMPLLIKKCS 1845
            +PLF  W + P S CS +CG G   +R +      R    +VD   C   N  +P+   E      CP  WI + +S  C+  C   G  +++  + C  E+  +     D+   + +P   ETC    C   W+ E W+ CS SCG  GI+ R V C+     S  GSL +K   +  P  +++CS
Sbjct:  251 QPLF-NWEMAPMSQCSVTCGSGYKMSRPI---CRNRLTNADVDDTLCSVTN--RPEASVEQCNTHSCPPRWIADDWS-TCSRLC---GHGYRERMVVCAEESNGIKTRVADIMCRTPKPPTQETCIIEECP-HWEVEDWTGCSVSCGQ-GIQMRGVECK-----STDGSLSAKCDPLTKPGSMQQCS 420          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: nolo (gene:FBgn0051619 transcript:FBtr0085902)

HSP 1 Score: 90.8929 bits (224), Expect = 1.878e-18
Identity = 93/310 (30.00%), Postives = 135/310 (43.55%), Query Frame = 1
Query:  274 QLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGG--YMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEI 1197
            Q ++SCS +C  GV+E ++ CV++        VS   C    KP E  ++TC    CP        W   ++T CS SCG  G++TR+VQCI  +  GG   M   +  C  +  P   + C   DCP  +    W KC+    C   G + R++ C            P+  C   S  PA  + C   P            +  KP I   +   I H     K+ L VG    V   T+++IKCPV  +    ++W KD+      R+ K    VS+KG L I   + +D G + C AG  +AEI I
Sbjct:  632 QGYTSCSASCLGGVEELIINCVRED---NGRVVSPFLCSPETKP-EARVRTCNDRPCPPR------WNYSDYTPCSKSCG-IGIKTREVQCIHEVTRGGDNTMVVPNSMCP-QPPPADRQYCNVLDCPVRWEVGEWSKCS--HTCGY-GFKDRKVECKQIMAQEHKIERPESMCP--SAKPADKKPCNVKP---------CPPEDPKPVIQINNSTHIQHDPKKTKITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKWSKDHKPLQRSRKYK----VSKKGALRILDITFRDAGVYSCHAGLSSAEISI 911          

HSP 2 Score: 57.3806 bits (137), Expect = 4.422e-8
Identity = 32/89 (35.96%), Postives = 51/89 (57.30%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQC 546
            WS+CS+ CG G +E ++ C +++  G   +V+   C   R P+  T +TC +  CP        W+V +WT CS SC G+G++ R V+C
Sbjct:  320 WSTCSRLCGHGYRERMVVCAEES-NGIKTRVADIMC---RTPKPPTQETCIIEECPH-------WEVEDWTGCSVSC-GQGIQMRGVEC 396          

HSP 3 Score: 54.299 bits (129), Expect = 3.979e-7
Identity = 56/187 (29.95%), Postives = 85/187 (45.45%), Query Frame = 1
Query: 1303 KPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDL---STQPI--ETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAK-IRMPLLIKKCS 1845
            +PLF  W + P S CS +CG G   +R +      R    +VD   C   N  +P+   E      CP  WI + +S  C+  C   G  +++  + C  E+  +     D+   + +P   ETC    C   W+ E W+ CS SCG  GI+ R V C+     S  GSL +K   +  P  +++CS
Sbjct:  251 QPLF-NWEMAPMSQCSVTCGSGYKMSRPI---CRNRLTNADVDDTLCSVTN--RPEASVEQCNTHSCPPRWIADDWS-TCSRLC---GHGYRERMVVCAEESNGIKTRVADIMCRTPKPPTQETCIIEECP-HWEVEDWTGCSVSCGQ-GIQMRGVECK-----STDGSLSAKCDPLTKPGSMQQCS 420          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: adamtsl3 (ADAMTS-like 3 [Source:ZFIN;Acc:ZDB-GENE-121030-8])

HSP 1 Score: 102.834 bits (255), Expect = 5.574e-22
Identity = 93/318 (29.25%), Postives = 143/318 (44.97%), Query Frame = 1
Query:  220 SLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCP-PEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKA 1170
            SLL  C P      W+ S +W+ CS +CG+G+Q   ++CV+       E +S   C   ++P E  ++ C    CP +      W+  EW  CS SCG  G + R V C   L +G Y   +  DC S  +P  +  C   DC  P      W KC+    C   G++RR+  C   T +G   ++ + +C     PP    SC   P  + K        K++ P +   K      R  K+L   +G  A++LP T + IKCPV +FP   ++W KD         + +R+ +++ G L I     +D G + C A
Sbjct:  694 SLLRICNPQPCPSRWEVS-VWNLCSVSCGVGLQTRSVSCVRSVAGNRTESLSSKDCVE-KRPNE--LQACNQVACPPS------WEAEEWQQCSHSCG-RGSQWRKVYCKQRLATGSYRRLRDEDC-SGPKPDVHRICTNADCLLPRLEGGEWSKCSV--TC-GKGVQRREPVCRRQTASGQLVTLDRTSCSDLPLPPLI-RSCRMSPCNKHK------HSKKRCPQVIGLKRIYIQNRPEKRLSFTIGGRAYLLPKTTVIIKCPVRHFPKAQIRWEKDGDELT----SSKRLSITKSGALRIYNLEAEDIGVYRCWA 985          

HSP 2 Score: 89.3521 bits (220), Expect = 7.952e-18
Identity = 104/371 (28.03%), Postives = 164/371 (44.20%), Query Frame = 1
Query:  946 LKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGT-----ITAEIEILTQNP----------SDGFSHYLSRIIYFKEDIVEGKNNS--AIKYI-KP--------LFY---QWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEV-DGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCK-YENKVLLPNNCDLSTQP--IETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWR-NDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKHCGL---RKLCSVDHYQHFCCKTC 1947
            +   VG +A+V P   + I CPV+      ++W  +N T A       R+ V  +  L I   +    G++ C+  T     +TA I +L+Q            S    +  +++   K    EG+ +S  A  Y+ KP        L +    WV   WS CS SCG G ++ R V C+ +E    ++V    +C  + S +P++ +EC   Q C   WI  P+  KC   CL    + +   + C+ + N       CD   +P  +  C +  C + WK   W TC+ +CG+ G ++R V C  R N  +     C  A  R P+  + C+   C   C D + +C      KLCSVD Y+  CC+TC
Sbjct: 1395 MASQVGTSAYVRPGDTLRIGCPVVPGHRRPIRWRFENRTLAAAAGGLYRLLVGGR-VLEINTHTGSFSGRYQCQTQTNNQQQLTAWIHLLSQEFEWRLGDWSTCSSSCGNRGTQMKKIKCVSSEGRESSHAACHYLPKPSSQTRPCNLLHCPPSWVSTVWSRCSSSCGRG-FRERRVSCQQVEASGSVKVLPSSEC--EGSPRPEDRQECS-SQAC-VEWISGPWG-KCAGRCLGPAMATQTRTVSCRLFSNST--SKTCDPKERPSAVRNCSSEMCDVHWKVFPWRTCTVACGS-GFQSRRVECVHRQNKKTLPDQHC--AWQRRPVTWQHCNITSCGSECKDRTHYCPAVKRLKLCSVDLYRQRCCQTC 1753          

HSP 3 Score: 65.855 bits (159), Expect = 1.393e-10
Identity = 54/196 (27.55%), Postives = 86/196 (43.88%), Query Frame = 1
Query:  196 VRYALILGSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRI---RKPREKTMKTCFLGVCPTNETSEFI-----------WKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCM 741
            V+YA    +++ F      +++W+ +  +  CS  CG G Q N   CV    I     V+   C       KP  K +K C +  CP ++  + +           W+   WTSCS SCGG G + R + C+     G  +  + + C     P+  + C  FDC P++    W +CT    C  PG+R R + C+
Sbjct:  321 VKYAGPKDTVIQFMFYQPIRYQWRETDFFP-CSVTCGGGYQLNSADCVD---IRYNRSVAEHLCHSFPENTKPTPK-LKECNMEPCPESDGFKEVMPYDHFQPLPRWEQNPWTSCSVSCGG-GSQERSIVCVEEDVHGQIVQVEDWKCTHSPRPISKQNCNTFDC-PQWMAMEWSQCTV--TC-GPGLRYRVVLCV 506          

HSP 4 Score: 65.855 bits (159), Expect = 1.625e-10
Identity = 34/117 (29.06%), Postives = 59/117 (50.43%), Query Frame = 1
Query:  457 TSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKP 807
            + EF W++G+W++CS+SCG  G + + ++C+ S        A HY  K   +      C    CPP + +T W +C+   +C   G R R+++C     +G+ K +P   C    +P
Sbjct: 1484 SQEFEWRLGDWSTCSSSCGNRGTQMKKIKCVSSEGRESSHAACHYLPKPSSQ---TRPCNLLHCPPSWVSTVWSRCSS--SCGR-GFRERRVSCQQVEASGSVKVLPSSECEGSPRP 1594          

HSP 5 Score: 57.7658 bits (138), Expect = 4.475e-8
Identity = 55/196 (28.06%), Postives = 91/196 (46.43%), Query Frame = 1
Query: 1303 KPLFYQWVVGPWSICSKSCGIGGYQTRYVGC-ELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYE-----NKVLLPNNCDLSTQPIE-TCHNPNCTL-FWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSL--CSKAKIRMPLLIKKCSAPPCN 1860
            +P   +W V  W++CS SCG+ G QTR V C   +       +    C++K   +P+ ++ C     CP  W  E +  +C+ +C   G+  +  K+ CK        + L   +C      +   C N +C L   +  +WS CS +CG  G++ R   CR +  + Q  +L   S + + +P LI+ C   PCN
Sbjct:  702 QPCPSRWEVSVWNLCSVSCGV-GLQTRSVSCVRSVAGNRTESLSSKDCVEK---RPNELQACNQV-ACPPSWEAEEW-QQCSHSC---GRGSQWRKVYCKQRLATGSYRRLRDEDCSGPKPDVHRICTNADCLLPRLEGGEWSKCSVTCGK-GVQRREPVCRRQTASGQLVTLDRTSCSDLPLPPLIRSCRMSPCN 887          

HSP 6 Score: 53.1434 bits (126), Expect = 1.239e-6
Identity = 48/188 (25.53%), Postives = 76/188 (40.43%), Query Frame = 1
Query:  271 SQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGV--RTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESC 828
            S +WS CS +CG G +E  ++C Q    G+ + +   +C     PR +  + C    C         W  G W  C+  C G  +  +TR V C L      + N+    C  +  P     C    C   +    W  CT    C S G + R++ C+        K++P  +C  + + P TW+ C
Sbjct: 1550 STVWSRCSSSCGRGFRERRVSCQQVEASGSVKVLPSSECE--GSPRPEDRQECSSQAC-------VEWISGPWGKCAGRCLGPAMATQTRTVSCRL------FSNSTSKTCDPKERPSAVRNCSSEMCDVHWKVFPWRTCTVA--CGS-GFQSRRVECV---HRQNKKTLPDQHCAWQRR-PVTWQHC 1715          

HSP 7 Score: 53.1434 bits (126), Expect = 1.304e-6
Identity = 55/190 (28.95%), Postives = 83/190 (43.68%), Query Frame = 1
Query:  253 KFEWQNSQLWSSCSKACG-IGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGI--RRRQINCMVTTKNGTSKSVPKGNCYIRSKPPA 813
            +FEW+    WS+CS +CG  G Q   + CV         + S+  C  + KP  +T + C L  CP +      W    W+ CS+SC G G R R V C     SG        +C+    P   ++C    C  E+ +  W KC     C  P +  + R ++C + + N TSK+     C  + +P A
Sbjct: 1486 EFEWRLGD-WSTCSSSCGNRGTQMKKIKCVSS----EGRESSHAACHYLPKPSSQT-RPCNLLHCPPS------WVSTVWSRCSSSC-GRGFRERRVSCQQVEASGSVKVLPSSECEGSPRPEDRQECSSQAC-VEWISGPWGKCAG--RCLGPAMATQTRTVSCRLFS-NSTSKT-----CDPKERPSA 1653          

HSP 8 Score: 51.2174 bits (121), Expect = 5.309e-6
Identity = 37/118 (31.36%), Postives = 54/118 (45.76%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKC 633
            W+SCS +CG G QE  + CV++ + G   +V   KC     PR  + + C    CP        W   EW+ C+ +C G G+R R V C+   Y+G +       C    +P   E C
Sbjct:  427 WTSCSVSCGGGSQERSIVCVEEDVHGQIVQVEDWKC--THSPRPISKQNCNTFDCPQ-------WMAMEWSQCTVTC-GPGLRYRVVLCV--DYNGQHAGG----CNPHLKPHIKEDC 528          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: adamts14 (ADAM metallopeptidase with thrombospondin type 1 motif, 14 [Source:ZFIN;Acc:ZDB-GENE-130530-852])

HSP 1 Score: 75.485 bits (184), Expect = 1.206e-13
Identity = 54/161 (33.54%), Postives = 82/161 (50.93%), Query Frame = 1
Query:  256 FEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINC 738
            +EW   + WS CSK CG GVQ     C +K+       V  + C   +KP+    +      C TN  S+ +W + EW +CS SCG +G +TR VQC+  L++     A H    +E +P+    C    CP ++ T +W +C+   +C   GIR+RQ+ C
Sbjct:  482 YEWA-LKSWSQCSKTCGGGVQYTKYGCRRKS---DARLVHRNFCEVNKKPKPIRKR------CNTNSCSQPLWVLEEWGACSKSCGTQGFQTRVVQCMQPLHN-NTNRAVHAKYCTEEKPLTRRACNASACPSQWRTGAWSQCSV--SC-GEGIRQRQVIC 628          

HSP 2 Score: 63.929 bits (154), Expect = 4.674e-10
Identity = 93/363 (25.62%), Postives = 148/363 (40.77%), Query Frame = 1
Query: 1018 NFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKK---FSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCE-----LIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPT-WWIGEPYSHKCTETCLDVGKSFKDLKLKC-----KYENKVLLPNNCDLSTQPI--ETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQ--------------------AGSLCSKAKI----------RMPL-LIKKCSAPPCNLGCMDLSKHCGLRKL---CSVDHYQHFCCKTCNYK 1956
            N  S ++  +K+ +T +FI  AK    ++ K ++   +   +S  D  + +   G +   I +L    ++     LS      ED++    N+ +   +   Y+W +  WS CSK+CG GG Q    GC       +  R F EV+          KP  IR+      C    W+ E +   C+++C   G  F+   ++C        N+ +    C    +P+    C+   C   W+T  WS CS SCG  GI+ R V CR  + +S                     A +L S   +          ++P   + K S  PC LG  D S  C +  L   CS+  YQ  CC++CN K
Sbjct:  381 NDTSPHVIAVKNQVTGSFILNAKGE-EITSKSFIENGQEWEYSVTDGRETLKCVGPLHEAIVVLVVPQAEDTKISLSYKYIIHEDLLPVITNNNVLLAELDTYEWALKSWSQCSKTCG-GGVQYTKYGCRRKSDARLVHRNFCEVN---------KKPKPIRKRCNTNSCSQPLWVLEEWG-ACSKSCGTQG--FQTRVVQCMQPLHNNTNRAVHAKYC-TEEKPLTRRACNASACPSQWRTGAWSQCSVSCGE-GIRQRQVICRPADSSSAPCDANKPENVSICRLQPCAGAPTLPSPTNVSLDNSTTEEEKLPENTLDKMSNEPC-LG--DKSIFCQMEVLARYCSIPGYQKLCCESCNRK 724          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: adamts3 (ADAM metallopeptidase with thrombospondin type 1 motif, 3 [Source:ZFIN;Acc:ZDB-GENE-110223-1])

HSP 1 Score: 73.559 bits (179), Expect = 5.658e-13
Identity = 71/247 (28.74%), Postives = 108/247 (43.72%), Query Frame = 1
Query: 1252 FKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPT-WWIGEPYSHKCTETCLDVGKSFKDLK-LKCKYE--NKVLLPNNCDLSTQPIE-TCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCS--KAKIRMPLLIKKCSAPPCNLGCMDLSKHCGLRKLCSVDHYQHFCCKTCNYK*NAFA 1971
              ED V   NN+ I+      Y+W +  WS CS+ C  GG+Q    GC   ++     V  G C    + KP  IR     Q C    WI E + H CT+TC  +G   + ++ ++  +E  N+ +    C+     +   C+   C   W+T  WS CS SCG  G+  R V+CR        G  C+  K + + P   + C   PC        +   L + CS+  Y   CC++C+ +   FA
Sbjct:  818 IHEDSVPLNNNNVIQEDT---YEWALKSWSQCSRPCA-GGFQYTKYGCR--KKGDNKMVHRGYC--DVNKKPKPIRRMCNLQDCTQPQWITEEWEH-CTKTCGSLGYQIRTVRCVQFLHEGTNRSIHSKYCNGEKPEMRRACNRVACPAQWRTGAWSECSVSCGE-GVSRRLVTCR-------IGDQCTGEKPESQKPCRPRPCHDEPCGGDKSIFCQMEVLARYCSIPGYNKLCCESCSRRSGTFA 1047          

HSP 2 Score: 57.3806 bits (137), Expect = 5.172e-8
Identity = 45/163 (27.61%), Postives = 72/163 (44.17%), Query Frame = 1
Query:  256 FEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMV 744
            +EW   + WS CS+ C  G Q     C +K   G  + V    C   +KP+    + C L  C     ++  W   EW  C+ +CG  G + R V+C+  L+ G   +     C  E +P     C    CP ++ T +W +C+   +C   G+ RR + C +
Sbjct:  836 YEWA-LKSWSQCSRPCAGGFQYTKYGCRKK---GDNKMVHRGYCDVNKKPK-PIRRMCNLQDC-----TQPQWITEEWEHCTKTCGSLGYQIRTVRCVQFLHEGTNRSIHSKYCNGE-KPEMRRACNRVACPAQWRTGAWSECSV--SC-GEGVSRRLVTCRI 984          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: adamts6 (ADAM metallopeptidase with thrombospondin type 1 motif, 6 [Source:ZFIN;Acc:ZDB-GENE-091113-9])

HSP 1 Score: 72.7886 bits (177), Expect = 1.070e-12
Identity = 63/235 (26.81%), Postives = 95/235 (40.43%), Query Frame = 1
Query:  133 TNEEFSLPFRLRSIMNMSIMFVRYALILGSLLGF--------CGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPA 813
            T+E  SL     ++ N+ +M +     LG    F         G     F W +   WS CS  C  G Q+  + C +   +     V    C +  KP     + C    CP        W +G+W+ C  +C G G+RTR V CI  +        +   C + + P++ E C    CPP++ T  W +CT    C  PG + R + C     +  +K+ P   C   SKPP 
Sbjct:  792 TDEPESLEALGATMENLVVMVLLQEQNLGIQYKFNVPIQRTGSGDNEVGFSWHHLP-WSECSATCAGGSQKQEVVCKR---LDDNSVVQNSYCDQDSKP-PGNQRRCNTEPCPPE------WFIGDWSECGKTCDG-GIRTRTVLCIRKINPAEEETLEDSHCLT-HRPIEQESCNNQSCPPQWVTLDWSECTP--KC-GPGFKHRIVLC---KSSDLTKTFPAALCSDHSKPPV 1007          

HSP 2 Score: 60.077 bits (144), Expect = 8.580e-9
Identity = 56/188 (29.79%), Postives = 91/188 (48.40%), Query Frame = 1
Query: 1315 YQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVG---KSFKDLKLKCKYENKVLLPNNCDLSTQPIE--TCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRN-DNSQAGSLC---SKAKIRMPLLIKKCSAP 1851
            + W   PWS CS +C  GG Q + V C+ ++    ++        ++S  P N R C      P W+IG+    +C +TC D G   ++   ++     E + L  ++C L+ +PIE  +C+N +C   W T  WS C+  CG PG K R V C+  +   +   +LC   SK  +R+   + +C  P
Sbjct:  841 FSWHHLPWSECSATCA-GGSQKQEVVCKRLDDNSVVQ---NSYCDQDSKPPGNQRRCNTEPCPPEWFIGD--WSECGKTC-DGGIRTRTVLCIRKINPAEEETLEDSHC-LTHRPIEQESCNNQSCPPQWVTLDWSECTPKCG-PGFKHRIVLCKSSDLTKTFPAALCSDHSKPPVRIRCSLGRCPPP 1019          

HSP 3 Score: 56.9954 bits (136), Expect = 8.051e-8
Identity = 68/227 (29.96%), Postives = 96/227 (42.29%), Query Frame = 1
Query: 1318 QWVVGPWSICSKSCGIGGYQTRYVGC-ELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYEN--KVLLPNNC-DLSTQPIETCHNPNCTLF------WKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLG--CMDLSK--HCGLR---KLCSVDHYQHFCCKTC 1947
            +W +G WS C K+C  GG +TR V C   I       ++   CL    ++    +E    Q CP  W+   +S +CT  C   G  FK   + CK  +  K      C D S  P+       C+L       W   +W  CS+ CG  G + RTV C        +  L S     M     KC + P + G  C D++K  +C L    K CS  +++  CCKTC
Sbjct:  901 EWFIGDWSECGKTCD-GGIRTRTVLCIRKINPAEEETLEDSHCLTHRPIE----QESCNNQSCPPQWVTLDWS-ECTPKC---GPGFKHRIVLCKSSDLTKTFPAALCSDHSKPPVRI----RCSLGRCPPPRWIPGEWGQCSAQCG-LGQQMRTVQCLSYTGQPSSECLDSLRPNTMQQCESKCDSTPISGGDECKDVNKVAYCPLVLKFKFCSRAYFRQMCCKTC 1113          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: ADAMTS7 (ADAM metallopeptidase with thrombospondin type 1 motif 7 [Source:NCBI gene;Acc:560364])

HSP 1 Score: 72.4034 bits (176), Expect = 1.595e-12
Identity = 56/180 (31.11%), Postives = 86/180 (47.78%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCG-YFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPAT 816
            W+ CS  CG G+Q  ++ CV+KT  G  E+     C    +P +K   +C  G+CP       IW  G+W  CS+SCG  G+R R V CI SL        +  +C+   +P     C     CP ++ T SW +C+   +C + G+R R + C   T +         +C  ++KP +T
Sbjct:  834 WTECSATCGTGMQRQIVHCVEKT-SGIVEE---HYCDASMRPDDK-QTSCNKGLCPA------IWWAGDWQKCSSSCGEMGLRKRTVLCIRSLGLDEQRALQPAECQHLPKPESIIPCNTQVSCPADWTTGSWSECSV--SCAT-GLRIRDVTCRWNTGS---------DCDPKAKPNST 990          

HSP 2 Score: 71.633 bits (174), Expect = 2.642e-12
Identity = 74/246 (30.08%), Postives = 111/246 (45.12%), Query Frame = 1
Query: 1189 IEILTQ--NPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPT-WWIGEPYSHKCTETCLDVGKS------FKDLKLKCKYENKVLLPNNCDLSTQP--IETCHNP-NCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLC---SKAKIRMPLLIKKCSAPPCNLGCMDLS 1881
            I++L Q  NP   + + +SR     + +++  N +A+ Y     +QW+ G W+ CS +CG  G Q + V C  +E+   I V+   C    SM+PD+ +       CP  WW G+    KC+ +C ++G         + L L    E + L P  C    +P  I  C+   +C   W T  WS CS SC   G++ R V+CRW       GS C   +K    MP   + C   P N    D S
Sbjct:  793 IQLLFQETNPGVRYEYTISR-----DTLLDSSNGTAVSY-----FQWIYGAWTECSATCGT-GMQRQIVHC--VEKTSGI-VEEHYC--DASMRPDDKQTSCNKGLCPAIWWAGD--WQKCSSSCGEMGLRKRTVLCIRSLGLD---EQRALQPAECQHLPKPESIIPCNTQVSCPADWTTGSWSECSVSCAT-GLRIRDVTCRW-----NTGSDCDPKAKPNSTMPCYAQDC---PINTDISDWS 1008          

HSP 3 Score: 52.373 bits (124), Expect = 2.156e-6
Identity = 39/131 (29.77%), Postives = 60/131 (45.80%), Query Frame = 1
Query:  256 FEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDC 648
             +W  S  W  CS+ CG G Q+ L+ C +             +C    +P   ++++C   V P N+     W  G W  CS SCGG G++ R V+C+ +       N +H DC+ +  P   +KC   DC
Sbjct: 1499 LDWYTSS-WGQCSEMCGGGEQQRLVTCPETG-----------RCDEDLQP--SSIQSC--NVHPCNQ-----WITGSWGQCSVSCGG-GIQRRLVKCVNTKAELEDEN-EHVDCEHDPRPNNTKKCNVHDC 1606          

HSP 4 Score: 51.2174 bits (121), Expect = 4.638e-6
Identity = 52/183 (28.42%), Postives = 76/183 (41.53%), Query Frame = 1
Query: 1318 QWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLST--QPIETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCN 1860
             W  G WS CS SCG+G    R V C            G +     + +P   R C L + C  W IGE    KC++ C  VG   ++++     + + L P +C  ++   P+    N +  L W T  W  CS  CG  G + R V+C       + G      +   P  I+ C+  PCN
Sbjct: 1391 HWNKGNWSACSTSCGLGAIW-RTVSCS----------SGDESDCDLATRPVPARRCYL-RPCSAWNIGE--WSKCSKNC-GVGVKVREIQCHDTRDQRSLRPFHCQATSPRPPVRIPCNIHSCLDWYTSSWGQCSEMCGG-GEQQRLVTC------PETGRCDEDLQ---PSSIQSCNVHPCN 1548          

HSP 5 Score: 50.0618 bits (118), Expect = 9.977e-6
Identity = 47/179 (26.26%), Postives = 77/179 (43.02%), Query Frame = 1
Query:  217 GSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTK 753
            G ++    P+     W N   WS+CS +CG+G     ++C            S D+       R    + C+L  C         W +GEW+ CS +C G GV+ R++QC         +   H    S   PV+   C    C  +++T+SW +C++M  C   G ++R + C  T +
Sbjct: 1377 GLVMASLSPSASPAHW-NKGNWSACSTSCGLGAIWRTVSC-----------SSGDESDCDLATRPVPARRCYLRPCSA-------WNIGEWSKCSKNC-GVGVKVREIQC-HDTRDQRSLRPFHCQATSPRPPVR-IPCNIHSC-LDWYTSSWGQCSEM--CGG-GEQQRLVTCPETGR 1529          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: vash1 (vasohibin 1 [Source:Xenbase;Acc:XB-GENE-956494])

HSP 1 Score: 100.523 bits (249), Expect = 3.789e-21
Identity = 87/305 (28.52%), Postives = 137/305 (44.92%), Query Frame = 1
Query:  268 NSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKP-PATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXH-HMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGT 1176
            N+  WS CS  CG+G+Q   + C   +  G     S  +C    KP    ++ C    CP        W   +W  CS +CGG GV+ R V C   L  G ++      C+ + +P  ++ CG  DCPP+  T  W KC+    C S GI+RR++ C+  T  G    +P  + +    P PA   SC     +   CQ K  K         +S  +++   R  K++   +G  A++LP T + IKCPV       ++W KD+    + +    ++ V++ G L I     +D G + C A +
Sbjct:  687 NTGSWSRCSATCGVGIQTRDVYCSSVSESGNN---SEQECG-AEKP--SAIQPCNQIDCPP------AWHTEDWQQCSRTCGG-GVQIRRVTCKQLLADGSFLKLGDELCQMQ-KPGSHKPCGKADCPPQLTTGEWSKCSA--KC-SVGIQRRKMICLKITAKG--HLIPINDSHCHGLPSPALVRSC-----HMGVCQSKTSKLGDPESPEILSIHRVYIQTRQEKRINFTIGSRAYLLPKTSVVIKCPVRGIQKSLIKWEKDDQPLKYSK----KLGVTKSGSLKIHNLEAQDIGVYKCIANS 963          

HSP 2 Score: 96.2857 bits (238), Expect = 8.421e-20
Identity = 99/387 (25.58%), Postives = 159/387 (41.09%), Query Frame = 1
Query:  958 VGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAG-----TITAEIEILTQNPSDGFSHYLSRIIYFKE-----------------------DIVEGK--NNSAIKYIKPLFYQ------------WVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEV-DGGKCLKKN---SMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPN-NCDLSTQPI-----ETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSC-RWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKHCGL---RKLCSVDHYQHFCCKTCN 1950
            VG T        + ++CPV  FP   L WLK    YA    +     +   G L++   S  +EG + C A      T+   +  L++  +   +    +  Y  E                         V+G   N+S  +++ PL  +            W  G WS CS SCG G +Q R V C+  +    I+V   G C   +   + KP +   CV        WI +P+  +C   C+  G   +  ++ C++ N   LP  +CD   + +     +TC +  C ++W+T  W  C+++CGN G ++R V C   +N  + A   C     R P   + C A  C   C D + +C      KLC +D Y+  CC++CN
Sbjct: 1277 VGGTVMARRGVNVMVQCPVKGFPQPKLTWLKKE--YALANNS----FLLSNGSLLLTNVSDGNEGTYFCIATNALGKTVAMSVLRLSEFKTRAMNSPRGKAGYQLEYGDWTQCSSTCGNNGTQSSTQHCVNVKGHRVNDSWCEHLHPLVIRSQACNRKDCPARWFPGAWSDCSTSCGTG-FQQRQVICQQTKLDGSIKVLPSGSCQYADRPVTQKPCSSDACVD-------WIPQPWG-QCLNQCIGQGMGLQHRQVLCQHHNGTTLPEASCDRKKRYLFHGTRKTCPSEMCDVYWRTGPWRPCTAACGN-GFQSRKVDCMHKKNSKAVADQYC--VWKRRPTTWQHCKATSCG-KCKDTTHYCTFVKHLKLCHIDLYKQRCCESCN 1644          

HSP 3 Score: 66.2402 bits (160), Expect = 1.626e-10
Identity = 51/194 (26.29%), Postives = 85/194 (43.81%), Query Frame = 1
Query:  139 EEFSLPFRLRSIMNMSIMFVRYALILGSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFI-----------WKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCT 687
            E   +P  LR+     I+ ++YA    S++ F        +W+ +  +  C+  CG G Q N   CV   L  T            +KP+ K +K C +  CP+++  + I           W+   WT+CS SCGG G++ R + C+     G  +  + + C    +P   + C  FDC P++    W +CT
Sbjct:  284 EILKIPGPLRADF---IIKIKYAAPKDSIVQFYFYQPISHQWRQTDFFP-CTVTCGGGYQLNSAECVDIRLNRTVNDHYCHYYPENKKPKPK-LKECNMEPCPSSDGFKEIMPYDHFQPLPRWEHNPWTACSVSCGG-GIQRRSIVCVEETMHGEILQVEEWKCMYAPKPTIMQTCNLFDC-PKWMAMEWSQCT 470          

HSP 4 Score: 55.4546 bits (132), Expect = 2.976e-7
Identity = 32/89 (35.96%), Postives = 48/89 (53.93%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQC 546
            W++CS +CG G+Q   + CV++T+ G   +V   KC  +  P+   M+TC L  CP        W   EW+ C+ +C G G+R R V C
Sbjct:  406 WTACSVSCGGGIQRRSIVCVEETMHGEILQVEEWKC--MYAPKPTIMQTCNLFDCPK-------WMAMEWSQCTVTC-GRGLRYRVVLC 484          

HSP 5 Score: 53.5286 bits (127), Expect = 1.193e-6
Identity = 42/171 (24.56%), Postives = 76/171 (44.44%), Query Frame = 1
Query:  343 KTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEY----EP--VKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKD 837
            KT+  +  ++S  K R +  PR K               + +  + G+WT CS++CG  G ++    C+         N K +     +     P  ++++ C   DCP  +F  +W  C+   +C + G ++RQ+ C  T  +G+ K +P G+C    + P T + C  D
Sbjct: 1347 KTVAMSVLRLSEFKTRAMNSPRGK---------------AGYQLEYGDWTQCSSTCGNNGTQSSTQHCV---------NVKGHRVNDSWCEHLHPLVIRSQACNRKDCPARWFPGAWSDCST--SCGT-GFQQRQVICQQTKLDGSIKVLPSGSCQYADR-PVTQKPCSSD 1489          

HSP 6 Score: 52.7582 bits (125), Expect = 2.337e-6
Identity = 48/186 (25.81%), Postives = 73/186 (39.25%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSP---GIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESC 828
            WS CS +CG G Q+  + C Q  L G+ + +    C+   +P   T K C    C         W    W  C   C G+G+  +  Q +   ++G  +     D K  Y      K     CP E     W +    R C +    G + R+++CM       SK+V    C  + + P TW+ C
Sbjct: 1439 WSDCSTSCGTGFQQRQVICQQTKLDGSIKVLPSGSCQYADRP--VTQKPCSSDAC-------VDWIPQPWGQCLNQCIGQGMGLQHRQVLCQHHNGTTLPEASCDRKKRYLFHGTRK----TCPSEMCDVYW-RTGPWRPCTAACGNGFQSRKVDCM---HKKNSKAVADQYCVWKRR-PTTWQHC 1606          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: vash1 (vasohibin 1 [Source:Xenbase;Acc:XB-GENE-956494])

HSP 1 Score: 100.138 bits (248), Expect = 5.072e-21
Identity = 81/304 (26.64%), Postives = 134/304 (44.08%), Query Frame = 1
Query:  268 NSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKP-PATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGT 1176
            N+  WS CS  CG+G+Q   + C   +  G   +      +     +   ++ C    CP        W   +W  CS +CGG GV+ R V C   L  G ++      C+ + +P  ++ CG  DCPP+  T  W KC+    C S GI+RR++ C+  T  G    +P  + +    P PA   SC     + +K    +++   + P I          R  K++   +G  A++LP T + IKCPV       ++W KD+    +     +++ V++ G L I     +D G + C A +
Sbjct:  626 NTGSWSRCSATCGVGIQTRDVYCSSVSESGNNSE------QECGAEKPSAIQPCNQIDCPP------AWHTEDWQQCSRTCGG-GVQIRRVTCKQLLADGSFLKLGDELCQMQ-KPGSHKPCGKADCPPQLTTGEWSKCSA--KC-SVGIQRRKMICLKITAKG--HLIPINDSHCHGLPSPALVRSC-----HMAKQHNPNRETSPESPEILSIHRVYIQTRQEKRINFTIGSRAYLLPKTSVVIKCPVRGIQKSLIKWEKDDQPLKY----SKKLGVTKSGSLKIHNLEAQDIGVYKCIANS 901          

HSP 2 Score: 77.7962 bits (190), Expect = 4.000e-14
Identity = 84/354 (23.73%), Postives = 146/354 (41.24%), Query Frame = 1
Query: 1000 IKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWIC----KAGTITAEIEILTQNP-------------SDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQ------------WVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEV-DGGKCLKKN---SMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPIETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRW-RNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKHCGL---RKLCSVDHYQHFCCKTCN 1950
            + CPV       + W         I   + R+ VS +  L I   S +  G++ C     + T++A + +  Q+              ++G        +  K   V   N+S  +++ PL  +            W  G WS CS SCG G +Q R V C+  +    I+V   G C   +   + KP +   CV        WI +P+  +C   C+  G   +  ++ C++ N   LP     ++   +TC +  C ++W+T  W  C+++CGN G ++R V C   +N  + A   C   +       ++ S        +D + +C      KLC +D Y+  CC++CN
Sbjct: 1260 VGCPVQTSHRNTIHWFLGTQPIEGIEGFQYRVLVSGR-VLEIYPLSEQSVGEYRCWTSNNSKTMSAWVNVTLQSKLLATLLHCSSTCGNNGTQSSTQHCVNVKGHRV---NDSWCEHLHPLVIRSQACNRKDCPARWFPGAWSDCSTSCGTG-FQQRQVICQQTKLDGSIKVLPSGSCQYADRPVTQKPCSSDACVD-------WIPQPWG-QCLNQCIGQGMGLQHRQVLCQHHNGTTLPE----ASSARKTCPSEMCDVYWRTGPWRPCTAACGN-GFQSRKVDCMHKKNSKAVADQYCVWKRRPTTWQARQHSHN------LDTTHYCTFVKHLKLCHIDLYKQRCCESCN 1589          

HSP 3 Score: 67.781 bits (164), Expect = 4.844e-11
Identity = 50/183 (27.32%), Postives = 81/183 (44.26%), Query Frame = 1
Query:  139 EEFSLPFRLRSIMNMSIMFVRYALILGSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCT 687
            E   +P  LR+     I+ ++YA    S++ F        +W+ +  +  C+  CG G Q N   CV   L  T            +KP+ K +K C +  CP+       W+   WT+CS SCGG G++ R + C+     G  +  + + C    +P   + C  FDC P++    W +CT
Sbjct:  240 EILKIPGPLRADF---IIKIKYAAPKDSIVQFYFYQPISHQWRQTDFFP-CTVTCGGGYQLNSAECVDIRLNRTVNDHYCHYYPENKKPKPK-LKECNMEPCPSR------WEHNPWTACSVSCGG-GIQRRSIVCVEETMHGEILQVEEWKCMYAPKPTIMQTCNLFDC-PKWMAMEWSQCT 409          

HSP 4 Score: 55.8398 bits (133), Expect = 2.293e-7
Identity = 32/89 (35.96%), Postives = 48/89 (53.93%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQC 546
            W++CS +CG G+Q   + CV++T+ G   +V   KC  +  P+   M+TC L  CP        W   EW+ C+ +C G G+R R V C
Sbjct:  345 WTACSVSCGGGIQRRSIVCVEETMHGEILQVEEWKC--MYAPKPTIMQTCNLFDCPK-------WMAMEWSQCTVTC-GRGLRYRVVLC 423          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: ADAMTSL1 (ADAMTS like 1 [Source:NCBI gene;Acc:100494603])

HSP 1 Score: 94.7449 bits (234), Expect = 2.409e-19
Identity = 86/305 (28.20%), Postives = 124/305 (40.66%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSY--DKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKN-----GTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAG 1173
            WS+CS  CG+G+Q   + C       T E V    D CR   +P+   ++ C    CP        W   EW  CS +CGG G+ TR+V C   L  G  +      C S  +P   + C   DCP E+  T W +C+    C   G + +   C    K      G S   P  N  +R   P +  +C +      +            P I+  +      R  KKL+  VG  A++LP T + ++CPV  F    + W KD         + E + V+  GY+ I    P D G + C AG
Sbjct:  656 WSTCSLTCGVGLQTRDVFCSHLISRETNETVVLGDDFCR---QPKPTLVQACNRFDCPP------AWYSSEWKQCSQTCGG-GIHTREVLCKQRLSDGSILELPETFCSSS-KPPSQDLCENEDCPGEWHITDWSQCSV--TC-GEGTQIQNAVCRKKLKTGQYIVGNSSMCPSINLLVR---PCSLATCTRSKHGHKQ-----------SPQITGLRKLYIQTRRQKKLQFVVGGYAYLLPKTSLVLRCPVRRFRKPQIIWEKDGKHLI----SSEHVTVAPHGYIKIHNLRPSDTGIYTCMAG 928          

HSP 2 Score: 78.1814 bits (191), Expect = 3.069e-14
Identity = 55/188 (29.26%), Postives = 100/188 (53.19%), Query Frame = 1
Query:  256 FEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQC--ILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPA 813
            ++W+  + ++ CS++CG G+QE ++ C+ K    T   V    C   R+P    +K+C +  CP        W++G W++CS +CG  G++TRDV C  ++S  +   +      C+ + +P   + C  FDCPP ++++ W +C++   C   GI  R++ C     +G+   +P+  C   SKPP+
Sbjct:  590 YDWE-YEGFTECSESCGGGLQEAIVVCLNKQ---TRVTVGESLCVASRRP-PPLLKSCNMEACPPR------WEIGNWSTCSLTCG-VGLQTRDVFCSHLISRETNETVVLGDDFCR-QPKPTLVQACNRFDCPPAWYSSEWKQCSQ--TCGG-GIHTREVLCKQRLSDGSILELPETFCS-SSKPPS 760          

HSP 3 Score: 77.0258 bits (188), Expect = 8.147e-14
Identity = 59/215 (27.44%), Postives = 98/215 (45.58%), Query Frame = 1
Query: 1318 QWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPIETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSC-RWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPC-NLGCMDLSKHC---GLRKLCSVDHYQHFCCKTC 1947
            +W+V  WS CS+SCG GG+QTR V C+ +                 S +P + + C   Q C   W   P+  +C   C+    + +  ++ CK  +  +              C    C++ W+   W+ C+++CGN G ++R V C   R + S    LCS      P+  ++C+  PC N+ C D +++C      KLC +  ++  CC TC
Sbjct: 1397 RWMVTSWSSCSQSCG-GGFQTRRVTCQKLTSMGLPVAVANDACTVFSKRPVDSQSCSR-QLC-VEWTTSPWG-QCHGPCIGPRMALQHRQVYCKTRDGTI-------------NCWADICSVHWRVSAWTLCTATCGNYGFQSRRVECVHHRTNKSVPDHLCSWRS--RPINWQRCNITPCENIDCRDTTRYCEKVKQLKLCQLAQFRSRCCGTC 1592          

HSP 4 Score: 62.003 bits (149), Expect = 2.795e-9
Identity = 62/256 (24.22%), Postives = 107/256 (41.80%), Query Frame = 1
Query:   97 IMNAIQLESLYITNEEFSL-----PFRLRSIMNMSIMFVR--YALILGSLLGFCG-PTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCR-RIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEP-VKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFK 834
            +  + QL+ L    E+ +      P  L+S+++   + V   Y L L   +   G P +G      S +  S      + ++  LL   Q   +    K    + R  I+ P E  ++  FL +     + E+ W    +T CS SCG  G++   ++C+L       +N  +  C  +  P +K   C   DCP  +  TSW  C++  +C   G + R++ C   T  G   +V    C + SK P   +SC +
Sbjct: 1209 VAESTQLQILGKRAEQLASFCSGSPMSLQSVLHFPNIKVGNIYDLHLSLFICLTGCPLKGHIMPNISWIHESQPLGTNVRLRHELLENGQILRLTNISKDHQGEYRCIIKNPSESVIQRAFLSI---QASREYQWSAVGFTPCSASCGNRGIQHPQLRCVLDKEE---VNISY--CLEKPRPSIKPTACNRRDCPARWMVTSWSSCSQ--SCGG-GFQTRRVTCQKLTSMGLPVAVANDACTVFSKRPVDSQSCSR 1453          

HSP 5 Score: 60.077 bits (144), Expect = 1.354e-8
Identity = 65/211 (30.81%), Postives = 92/211 (43.60%), Query Frame = 1
Query: 1318 QWVVGPWSICSKSCGIGGYQTRYVGC-ELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKY---ENKVL-LPNNCDLSTQP--IETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKH--------CGLRKL 1905
            +W +G WS CS +CG+ G QTR V C  LI R     V  G    +   KP  ++ C  F   P W+  E    +C++TC   G      ++ CK    +  +L LP     S++P   + C N +C   W    WS CS +CG  G + +   CR +    Q     S     + LL++     PC+L     SKH         GLRKL
Sbjct:  650 RWEIGNWSTCSLTCGV-GLQTRDVFCSHLISRETNETVVLGDDFCRQP-KPTLVQACNRFDCPPAWYSSE--WKQCSQTC---GGGIHTREVLCKQRLSDGSILELPETFCSSSKPPSQDLCENEDCPGEWHITDWSQCSVTCGE-GTQIQNAVCRKKLKTGQYIVGNSSMCPSINLLVR-----PCSLATCTRSKHGHKQSPQITGLRKL 847          

HSP 6 Score: 57.3806 bits (137), Expect = 7.641e-8
Identity = 58/219 (26.48%), Postives = 92/219 (42.01%), Query Frame = 1
Query:  262 WQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCI--LSLYSGGYMNAK----------HYDCKSEYE--PVKN-----------EKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMV-TTKNGTSKSVPKGNCYIRSKPPATWESCFKDP 840
            W+N+  W++CS +CG G+Q   ++CV++ + G    V   KC  +  P+   ++ C +  CP        W   EW+ C+ +C G G+R R V CI    +++GG  +            H  C    E  PV+            E+       P F    W  C+   +C   GI+ R + C V  T   T   +P   C      PAT ++C+  P
Sbjct:  361 WENTP-WTACSSSCGGGIQSRTVSCVEEDIHGQISSVEEWKC--MYTPKMPIVQPCNIFDCPK-------WLAQEWSPCTVTC-GHGLRYRVVLCIDHRGIHTGGCSSKTKPHIKEECTVHIPCYKAKEKLPVEAKLPWYKQAQELEEVTAVSEEPSFIPEPWSPCSV--SC-GVGIQHRTVKCQVLLTFAQTIADLPLEEC--EGTKPATQQTCYSGP 563          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: ADAMTSL1 (ADAMTS like 1 [Source:NCBI gene;Acc:100494603])

HSP 1 Score: 94.3597 bits (233), Expect = 2.959e-19
Identity = 86/305 (28.20%), Postives = 124/305 (40.66%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSY--DKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKN-----GTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAG 1173
            WS+CS  CG+G+Q   + C       T E V    D CR   +P+   ++ C    CP        W   EW  CS +CGG G+ TR+V C   L  G  +      C S  +P   + C   DCP E+  T W +C+    C   G + +   C    K      G S   P  N  +R   P +  +C +      +            P I+  +      R  KKL+  VG  A++LP T + ++CPV  F    + W KD         + E + V+  GY+ I    P D G + C AG
Sbjct:  686 WSTCSLTCGVGLQTRDVFCSHLISRETNETVVLGDDFCR---QPKPTLVQACNRFDCPP------AWYSSEWKQCSQTCGG-GIHTREVLCKQRLSDGSILELPETFCSSS-KPPSQDLCENEDCPGEWHITDWSQCSV--TC-GEGTQIQNAVCRKKLKTGQYIVGNSSMCPSINLLVR---PCSLATCTRSKHGHKQ-----------SPQITGLRKLYIQTRRQKKLQFVVGGYAYLLPKTSLVLRCPVRRFRKPQIIWEKDGKHLI----SSEHVTVAPHGYIKIHNLRPSDTGIYTCMAG 958          

HSP 2 Score: 77.411 bits (189), Expect = 4.849e-14
Identity = 55/188 (29.26%), Postives = 100/188 (53.19%), Query Frame = 1
Query:  256 FEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQC--ILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPA 813
            ++W+  + ++ CS++CG G+QE ++ C+ K    T   V    C   R+P    +K+C +  CP        W++G W++CS +CG  G++TRDV C  ++S  +   +      C+ + +P   + C  FDCPP ++++ W +C++   C   GI  R++ C     +G+   +P+  C   SKPP+
Sbjct:  620 YDWEY-EGFTECSESCGGGLQEAIVVCLNKQ---TRVTVGESLCVASRRP-PPLLKSCNMEACPPR------WEIGNWSTCSLTCG-VGLQTRDVFCSHLISRETNETVVLGDDFCR-QPKPTLVQACNRFDCPPAWYSSEWKQCSQ--TCGG-GIHTREVLCKQRLSDGSILELPETFCS-SSKPPS 790          

HSP 3 Score: 75.485 bits (184), Expect = 2.388e-13
Identity = 59/216 (27.31%), Postives = 99/216 (45.83%), Query Frame = 1
Query: 1318 QWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLL-PNNCDLSTQPIETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSC-RWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKHC---GLRKLCSVDHYQHFCCKTCN 1950
            +W+V  WS CS+SCG GG+QTR V C+ +                 S +P + + C   Q C   W   P+  +C   C+    + +  ++ CK  +  ++ P  C       + C    C++ W+   W+ C+++CGN G ++R V C   R + S    LCS      P+  ++C+  P    C D +++C      KLC +  ++  CC TC 
Sbjct: 1135 RWMVTSWSSCSQSCG-GGFQTRRVTCQKLTSMGLPVAVANDACTVFSKRPVDSQSCSR-QLC-VEWTTSPWG-QCHGPCIGPRMALQHRQVYCKTRDGTIVSPEQC-------QNCWADICSVHWRVSAWTLCTATCGNYGFQSRRVECVHHRTNKSVPDHLCSWRS--RPINWQRCNITP--FDCRDTTRYCEKVKQLKLCQLAQFRSRCCGTCG 1335          

HSP 4 Score: 59.6918 bits (143), Expect = 1.795e-8
Identity = 65/211 (30.81%), Postives = 92/211 (43.60%), Query Frame = 1
Query: 1318 QWVVGPWSICSKSCGIGGYQTRYVGC-ELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKY---ENKVL-LPNNCDLSTQPI--ETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKH--------CGLRKL 1905
            +W +G WS CS +CG+ G QTR V C  LI R     V  G    +   KP  ++ C  F   P W+  E    +C++TC   G      ++ CK    +  +L LP     S++P   + C N +C   W    WS CS +CG  G + +   CR +    Q     S     + LL++     PC+L     SKH         GLRKL
Sbjct:  680 RWEIGNWSTCSLTCGV-GLQTRDVFCSHLISRETNETVVLGDDFCRQP-KPTLVQACNRFDCPPAWYSSE--WKQCSQTC---GGGIHTREVLCKQRLSDGSILELPETFCSSSKPPSQDLCENEDCPGEWHITDWSQCSVTCGE-GTQIQNAVCRKKLKTGQYIVGNSSMCPSINLLVR-----PCSLATCTRSKHGHKQSPQITGLRKL 877          

HSP 5 Score: 56.6102 bits (135), Expect = 1.322e-7
Identity = 58/219 (26.48%), Postives = 92/219 (42.01%), Query Frame = 1
Query:  262 WQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCI--LSLYSGGYMNAK----------HYDCKSEYE--PVKN-----------EKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMV-TTKNGTSKSVPKGNCYIRSKPPATWESCFKDP 840
            W+N+  W++CS +CG G+Q   ++CV++ + G    V   KC  +  P+   ++ C +  CP        W   EW+ C+ +C G G+R R V CI    +++GG  +            H  C    E  PV+            E+       P F    W  C+   +C   GI+ R + C V  T   T   +P   C      PAT ++C+  P
Sbjct:  391 WENTP-WTACSSSCGGGIQSRTVSCVEEDIHGQISSVEEWKC--MYTPKMPIVQPCNIFDCPK-------WLAQEWSPCTVTC-GHGLRYRVVLCIDHRGIHTGGCSSKTKPHIKEECTVHIPCYKAKEKLPVEAKLPWYKQAQELEEVTAVSEEPSFIPEPWSPCSV--SC-GVGIQHRTVKCQVLLTFAQTIADLPLEEC--EGTKPATQQTCYSGP 593          

HSP 6 Score: 52.7582 bits (125), Expect = 2.301e-6
Identity = 39/140 (27.86%), Postives = 63/140 (45.00%), Query Frame = 1
Query:  418 MKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEP-VKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFK 834
            +  C   VC    + E+ W    +T CS SCG  G++   ++C+L       +N  +  C  +  P +K   C   DCP  +  TSW  C++  +C   G + R++ C   T  G   +V    C + SK P   +SC +
Sbjct: 1062 IMICVAFVC--TASREYQWSAVGFTPCSASCGNRGIQHPQLRCVLDKEE---VNISY--CLEKPRPSIKPTACNRRDCPARWMVTSWSSCSQ--SCGG-GFQTRRVTCQKLTSMGLPVAVANDACTVFSKRPVDSQSCSR 1191          

HSP 7 Score: 51.9878 bits (123), Expect = 3.646e-6
Identity = 48/187 (25.67%), Postives = 75/187 (40.11%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDP 840
            WSSCS++CG G Q   + C + T +G    V+ D C    K R    ++C   +C         W    W  C   C G  +  +  Q       G  ++           P + + C    C   +  ++W  CT    C + G + R++ C+    + T+KSVP   C  RS+ P  W+ C   P
Sbjct: 1141 WSSCSQSCGGGFQTRRVTCQKLTSMGLPVAVANDACTVFSK-RPVDSQSCSRQLC-------VEWTTSPWGQCHGPCIGPRMALQHRQVYCKTRDGTIVS-----------PEQCQNCWADICSVHWRVSAWTLCTA--TCGNYGFQSRRVECV---HHRTNKSVPDHLCSWRSR-PINWQRCNITP 1302          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: ADAMTSL1 (ADAMTS like 1 [Source:NCBI gene;Acc:100494603])

HSP 1 Score: 94.3597 bits (233), Expect = 3.262e-19
Identity = 86/305 (28.20%), Postives = 124/305 (40.66%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSY--DKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKN-----GTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAG 1173
            WS+CS  CG+G+Q   + C       T E V    D CR   +P+   ++ C    CP        W   EW  CS +CGG G+ TR+V C   L  G  +      C S  +P   + C   DCP E+  T W +C+    C   G + +   C    K      G S   P  N  +R   P +  +C +      +            P I+  +      R  KKL+  VG  A++LP T + ++CPV  F    + W KD         + E + V+  GY+ I    P D G + C AG
Sbjct:  664 WSTCSLTCGVGLQTRDVFCSHLISRETNETVVLGDDFCR---QPKPTLVQACNRFDCPP------AWYSSEWKQCSQTCGG-GIHTREVLCKQRLSDGSILELPETFCSSS-KPPSQDLCENEDCPGEWHITDWSQCSV--TC-GEGTQIQNAVCRKKLKTGQYIVGNSSMCPSINLLVR---PCSLATCTRSKHGHKQ-----------SPQITGLRKLYIQTRRQKKLQFVVGGYAYLLPKTSLVLRCPVRRFRKPQIIWEKDGKHLI----SSEHVTVAPHGYIKIHNLRPSDTGIYTCMAG 936          

HSP 2 Score: 86.2705 bits (212), Expect = 1.171e-16
Identity = 63/218 (28.90%), Postives = 105/218 (48.17%), Query Frame = 1
Query: 1318 QWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLL-PNNCDLSTQPIET--CHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSC-RWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPC-NLGCMDLSKHC---GLRKLCSVDHYQHFCCKTC 1947
            +W+V  WS CS+SCG GG+QTR V C+ +                 S +P + + C   Q C   W   P+  +C   C+    + +  ++ CK  +  ++ P  C    +P+ T  C    C++ W+   W+ C+++CGN G ++R V C   R + S    LCS      P+  ++C+  PC N+ C D +++C      KLC +  ++  CC TC
Sbjct: 1535 RWMVTSWSSCSQSCG-GGFQTRRVTCQKLTSMGLPVAVANDACTVFSKRPVDSQSCSR-QLC-VEWTTSPWG-QCHGPCIGPRMALQHRQVYCKTRDGTIVSPEQCQALPRPLNTQNCWADICSVHWRVSAWTLCTATCGNYGFQSRRVECVHHRTNKSVPDHLCSWRS--RPINWQRCNITPCENIDCRDTTRYCEKVKQLKLCQLAQFRSRCCGTC 1746          

HSP 3 Score: 78.5666 bits (192), Expect = 2.710e-14
Identity = 55/188 (29.26%), Postives = 100/188 (53.19%), Query Frame = 1
Query:  256 FEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQC--ILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPA 813
            ++W+  + ++ CS++CG G+QE ++ C+ K    T   V    C   R+P    +K+C +  CP        W++G W++CS +CG  G++TRDV C  ++S  +   +      C+ + +P   + C  FDCPP ++++ W +C++   C   GI  R++ C     +G+   +P+  C   SKPP+
Sbjct:  598 YDWE-YEGFTECSESCGGGLQEAIVVCLNKQ---TRVTVGESLCVASRRP-PPLLKSCNMEACPPR------WEIGNWSTCSLTCG-VGLQTRDVFCSHLISRETNETVVLGDDFCR-QPKPTLVQACNRFDCPPAWYSSEWKQCSQ--TCGG-GIHTREVLCKQRLSDGSILELPETFCS-SSKPPS 768          

HSP 4 Score: 60.077 bits (144), Expect = 1.284e-8
Identity = 65/211 (30.81%), Postives = 92/211 (43.60%), Query Frame = 1
Query: 1318 QWVVGPWSICSKSCGIGGYQTRYVGC-ELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKY---ENKVL-LPNNCDLSTQP--IETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKH--------CGLRKL 1905
            +W +G WS CS +CG+ G QTR V C  LI R     V  G    +   KP  ++ C  F   P W+  E    +C++TC   G      ++ CK    +  +L LP     S++P   + C N +C   W    WS CS +CG  G + +   CR +    Q     S     + LL++     PC+L     SKH         GLRKL
Sbjct:  658 RWEIGNWSTCSLTCGV-GLQTRDVFCSHLISRETNETVVLGDDFCRQP-KPTLVQACNRFDCPPAWYSSE--WKQCSQTC---GGGIHTREVLCKQRLSDGSILELPETFCSSSKPPSQDLCENEDCPGEWHITDWSQCSVTCGE-GTQIQNAVCRKKLKTGQYIVGNSSMCPSINLLVR-----PCSLATCTRSKHGHKQSPQITGLRKL 855          

HSP 5 Score: 59.6918 bits (143), Expect = 1.549e-8
Identity = 41/148 (27.70%), Postives = 68/148 (45.95%), Query Frame = 1
Query:  394 IRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEP-VKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFK 834
            I+ P E  ++  FL +     + E+ W    +T CS SCG  G++   ++C+L       +N  +  C  +  P +K   C   DCP  +  TSW  C++  +C   G + R++ C   T  G   +V    C + SK P   +SC +
Sbjct: 1455 IKNPSESVIQRAFLSI---QASREYQWSAVGFTPCSASCGNRGIQHPQLRCVLDKEE---VNISY--CLEKPRPSIKPTACNRRDCPARWMVTSWSSCSQ--SCGG-GFQTRRVTCQKLTSMGLPVAVANDACTVFSKRPVDSQSCSR 1591          

HSP 6 Score: 59.3066 bits (142), Expect = 2.371e-8
Identity = 49/187 (26.20%), Postives = 79/187 (42.25%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDP 840
            WSSCS++CG G Q   + C + T +G    V+ D C    K R    ++C   +C         W    W  C   C G  +  +  Q       G  ++ +   C++   P+  + C    C   +  ++W  CT    C + G + R++ C+    + T+KSVP   C  RS+ P  W+ C   P
Sbjct: 1541 WSSCSQSCGGGFQTRRVTCQKLTSMGLPVAVANDACTVFSK-RPVDSQSCSRQLC-------VEWTTSPWGQCHGPCIGPRMALQHRQVYCKTRDGTIVSPEQ--CQALPRPLNTQNCWADICSVHWRVSAWTLCTA--TCGNYGFQSRRVECV---HHRTNKSVPDHLCSWRSR-PINWQRCNITP 1711          

HSP 7 Score: 57.3806 bits (137), Expect = 7.491e-8
Identity = 58/219 (26.48%), Postives = 92/219 (42.01%), Query Frame = 1
Query:  262 WQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCI--LSLYSGGYMNAK----------HYDCKSEYE--PVKN-----------EKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMV-TTKNGTSKSVPKGNCYIRSKPPATWESCFKDP 840
            W+N+  W++CS +CG G+Q   ++CV++ + G    V   KC  +  P+   ++ C +  CP        W   EW+ C+ +C G G+R R V CI    +++GG  +            H  C    E  PV+            E+       P F    W  C+   +C   GI+ R + C V  T   T   +P   C      PAT ++C+  P
Sbjct:  369 WENTP-WTACSSSCGGGIQSRTVSCVEEDIHGQISSVEEWKC--MYTPKMPIVQPCNIFDCPK-------WLAQEWSPCTVTC-GHGLRYRVVLCIDHRGIHTGGCSSKTKPHIKEECTVHIPCYKAKEKLPVEAKLPWYKQAQELEEVTAVSEEPSFIPEPWSPCSV--SC-GVGIQHRTVKCQVLLTFAQTIADLPLEEC--EGTKPATQQTCYSGP 571          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Adamtsl1 (ADAMTS-like 1 [Source:MGI Symbol;Acc:MGI:1924989])

HSP 1 Score: 100.138 bits (248), Expect = 3.565e-21
Identity = 92/356 (25.84%), Postives = 149/356 (41.85%), Query Frame = 1
Query:  223 LLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTN-----ETSEFI--------------------------WKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEI 1197
            LLG        ++W+  + ++ CS++CG GVQE +++C+ K    T E    + C   R+P  + +K+C L  CP +     E +E +                          W   +W  CS +CGG G++ RDV C   +  G ++      C S  +P  ++ C   DCP E+  + W +C+   +C   G + R   C    K G S  V    C     PP  + S  + P   + C    +   +  P I+ ++      R  +KL   VG  A++LP T + ++CP   F    + W KD         +   + V+  GYL I +  P D G + C AG    +  I
Sbjct:  598 LLGGLQDLDELYDWEY-EGFTKCSESCGGGVQEAVVSCLNKQ---TRELADENLCVTSRRP-PQLLKSCNLDPCPASHLLSREMNEVVVLADELCHHPKPSTVQACNRFNCPPAWYPAQWQLCSRTCGG-GIQKRDVLCKQRMADGSFLELPETFC-SASKPTSHQGCKKDDCPSEWLLSEWSECSV--SCGE-GTQTRSAICQRVLKTGVSTVVNSTLC-----PPLPFSSSIR-PCMLATCARPGRPSTKHSPHIAAARNIYIQTRRQRKLHFVVGGFAYLLPKTTVVLRCPTRRFRKPLITWEKDGQHSI----SSAHVTVAPFGYLKIHRLKPSDAGIYTCSAGPAREQFVI 933          

HSP 2 Score: 83.9593 bits (206), Expect = 3.684e-16
Identity = 81/367 (22.07%), Postives = 155/367 (42.23%), Query Frame = 1
Query:  958 VGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLI-IKKFSPKDEGKWIC----KAGTITAEIEILTQN---------------PSDGFSHYLSRIIYFKEDI----VEGKNNSAIKYI----KPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPN-NCDLSTQPIET--CHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSC-RWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPC-NLGCMDLSKHCG---LRKLCSVDHYQHFCCKTCN 1950
            +G    + P     + CP+   P+ N+ W ++    A         H+   G ++ +   S   +G++ C    +AGT+  +  ++ Q+                + G      R +    ++      GK   A++ +    +    +W+V  WS C++SCG GG QTR V C+ ++              + + +P + + C   Q C  W        +C   C+    + +  ++ C+  + + LP+  C    +P+ T  C +  C++ W+   W+ C+++CGN G ++R V C   R + +    LCS      P   ++C+  PC N  C D +++C      KLC +  ++  CC TC 
Sbjct: 1385 LGTQLVLDPGNSALLGCPIKGHPTPNITWFQNGQPIATAPGLTH--HIWGAGQILRVANLSGGPQGEFSCLAQNEAGTLLQKASLVIQDYWWSVDRLATCSASCGNRGIHQPRLRCLLNTTEVDPEHCTGKPRPAVQPVACNRRDCPSRWMVTSWSACTRSCG-GGVQTRRVTCQKLKASGISTPVSNDMCSQLAKRPVDTQACNQ-QLCVEWAFSS--WGQCNGPCIGPRLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQSRRVECVHVRTNKAVPEHLCSWGP--RPANWQRCNVTPCENTECRDTTRYCEKVRQLKLCQLGQFRSRCCGTCG 1743          

HSP 3 Score: 58.151 bits (139), Expect = 3.344e-8
Identity = 48/194 (24.74%), Postives = 80/194 (41.24%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQ 861
            WS+C+++CG GVQ   + C +    G    VS D C ++ K R    + C   +C         W    W  C+  C G  +  +  Q       G  + ++   C +   PV  + C    C   +  + W  CT    C + G + R++ C+    N   K+VP+  C    + PA W+ C   P   ++C+
Sbjct: 1537 WSACTRSCGGGVQTRRVTCQKLKASGISTPVSNDMCSQLAK-RPVDTQACNQQLC-------VEWAFSSWGQCNGPCIGPRLAVQHRQVFCQTRDGITLPSEQ--CSALPRPVSTQNCWSEACSVHWRVSLWTLCTA--TCGNYGFQSRRVECVHVRTN---KAVPEHLCSWGPR-PANWQRCNVTPCENTECR 1714          

HSP 4 Score: 54.299 bits (129), Expect = 5.192e-7
Identity = 55/241 (22.82%), Postives = 96/241 (39.83%), Query Frame = 1
Query:  274 QLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEF-------------------IWKVGEWTSCSTSCGG---EGV------RTRDVQ----CILSLYSGGYMNAKHYD-CKSEY--------------------EPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKD 837
            + WS+C+  CG+G Q  ++ C  + L+   + V+         P+  + + C+ G C   ET EF                    W+   +T CS SCGG   E V      +TR++     C+ S      + + + D C + +                    +P   + C  F+CPP ++   W  C+  R C   GI++R + C     +G+   +P+  C   +  P + + C KD
Sbjct:  529 EAWSACTVTCGVGTQVRIIRC--QVLLPFSQSVADLPADECEGPKPASQRACYAGPC-NGETPEFNPDNGDGLLGGLQDLDELYDWEYEGFTKCSESCGGGVQEAVVSCLNKQTRELADENLCVTSRRPPQLLKSCNLDPCPASHLLSREMNEVVVLADELCHHPKPSTVQACNRFNCPPAWYPAQWQLCS--RTCGG-GIQKRDVLCKQRMADGSFLELPETFC--SASKPTSHQGCKKD 761          

HSP 5 Score: 54.299 bits (129), Expect = 5.750e-7
Identity = 53/213 (24.88%), Postives = 84/213 (39.44%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCI--LSLYSGGYMNAKHYDCKSE-------YEPVKN----------------EKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTS-KSVPKGNCYIRSKPPATWESCFKDP 840
            W++CS +CG G+Q   ++CV++ + G    V   KC  +  P+   ++ C +  CP        W   EW+ C+ +C G+G+R R V CI    +++GG         K E       Y+P +                 E+       P F   +W  CT        G + R I C V      S   +P   C      PA+  +C+  P
Sbjct:  385 WTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEEWKC--MYTPKMPVVQPCNIFDCPK-------WLAQEWSPCTVTC-GQGLRYRVVLCIDHRGMHTGGCSAKTKPHIKEECIIPTPCYKPREKLPIEAKLPWFKQAQELEEGAAVSEEPSFIPEAWSACTVTCGV---GTQVRIIRCQVLLPFSQSVADLPADEC--EGPKPASQRACYAGP 582          

HSP 6 Score: 53.9138 bits (128), Expect = 6.646e-7
Identity = 53/212 (25.00%), Postives = 88/212 (41.51%), Query Frame = 1
Query:  262 WQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIR---KPREKTMKTCFLGVCPTNETSEFI-----------WKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSK 855
            W+ +  +  CS  CG G Q     C     + +   V+   C       KP+ K ++ C L  CP ++  + I           W+   WT+CS+SCGG G+++R V C+     G   + + + C    +    + C  FDC P++    W  CT    C   G+R R + C+        + +  G C  ++KP    E     P Y+ +
Sbjct:  301 WRETDFFP-CSATCGGGYQLTSAECYD---LRSNRVVADQYCHYYPENVKPKPK-LQECNLDPCPASDGYKQIMPYDLYHPLPRWEATPWTACSSSCGG-GIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPVVQPCNIFDC-PKWLAQEWSPCTV--TCGQ-GLRYRVVLCI------DHRGMHTGGCSAKTKPHIKEECIIPTPCYKPR 496          

HSP 7 Score: 53.5286 bits (127), Expect = 9.502e-7
Identity = 35/123 (28.46%), Postives = 58/123 (47.15%), Query Frame = 1
Query:  463 EFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEP-VKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESC 828
            ++ W V    +CS SCG  G+    ++C+L+      ++ +H  C  +  P V+   C   DCP  +  TSW  CT  R+C   G++ R++ C     +G S  V    C   +K P   ++C
Sbjct: 1471 DYWWSVDRLATCSASCGNRGIHQPRLRCLLNTTE---VDPEH--CTGKPRPAVQPVACNRRDCPSRWMVTSWSACT--RSCGG-GVQTRRVTCQKLKASGISTPVSNDMCSQLAKRPVDTQAC 1585          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Adamtsl1 (ADAMTS-like 1 [Source:MGI Symbol;Acc:MGI:1924989])

HSP 1 Score: 97.8265 bits (242), Expect = 1.992e-20
Identity = 82/306 (26.80%), Postives = 126/306 (41.18%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEI 1197
            WS CS  CG+G+Q   + C    L     +V          P+  T++ C    CP        W   +W  CS +CGG G++ RDV C   +  G ++      C S  +P  ++ C   DCP E+  + W +C+   +C   G + R   C    K G S  V    C     PP  + S  + P   + C    +   +  P I+ ++      R  +KL   VG  A++LP T + ++CP   F    + W KD         +   + V+  GYL I +  P D G + C AG    +  I
Sbjct:  658 WSPCSLTCGVGLQTRDVVC-SHLLSREMNEVVVLADELCHHPKPSTVQACNRFNCPP------AWYPAQWQLCSRTCGG-GIQKRDVLCKQRMADGSFLELPETFC-SASKPTSHQGCKKDDCPSEWLLSEWSECSV--SCGE-GTQTRSAICQRVLKTGVSTVVNSTLC-----PPLPFSSSIR-PCMLATCARPGRPSTKHSPHIAAARNIYIQTRRQRKLHFVVGGFAYLLPKTTVVLRCPTRRFRKPLITWEKDGQHSI----SSAHVTVAPFGYLKIHRLKPSDAGIYTCSAGPAREQFVI 941          

HSP 2 Score: 84.7297 bits (208), Expect = 2.148e-16
Identity = 81/366 (22.13%), Postives = 155/366 (42.35%), Query Frame = 1
Query:  958 VGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLI-IKKFSPKDEGKWIC----KAGTITAEIEILTQN---------------PSDGFSHYLSRIIYFKEDI----VEGKNNSAIKYI----KPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPN-NCDLSTQPIET--CHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSC-RWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPC-NLGCMDLSKHCG---LRKLCSVDHYQHFCCKTC 1947
            +G    + P     + CP+   P+ N+ W ++    A         H+   G ++ +   S   +G++ C    +AGT+  +  ++ Q+                + G      R +    ++      GK   A++ +    +    +W+V  WS C++SCG GG QTR V C+ ++              + + +P + + C   Q C  W        +C   C+    + +  ++ C+  + + LP+  C    +P+ T  C +  C++ W+   W+ C+++CGN G ++R V C   R + +    LCS      P   ++C+  PC N  C D +++C      KLC +  ++  CC TC
Sbjct: 1393 LGTQLVLDPGNSALLGCPIKGHPTPNITWFQNGQPIATAPGLTH--HIWGAGQILRVANLSGGPQGEFSCLAQNEAGTLLQKASLVIQDYWWSVDRLATCSASCGNRGIHQPRLRCLLNTTEVDPEHCTGKPRPAVQPVACNRRDCPSRWMVTSWSACTRSCG-GGVQTRRVTCQKLKASGISTPVSNDMCSQLAKRPVDTQACNQ-QLCVEWAFSS--WGQCNGPCIGPRLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQSRRVECVHVRTNKAVPEHLCSWGP--RPANWQRCNVTPCENTECRDTTRYCEKVRQLKLCQLGQFRSRCCGTC 1750          

HSP 3 Score: 58.9214 bits (141), Expect = 2.223e-8
Identity = 48/194 (24.74%), Postives = 80/194 (41.24%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQ 861
            WS+C+++CG GVQ   + C +    G    VS D C ++ K R    + C   +C         W    W  C+  C G  +  +  Q       G  + ++   C +   PV  + C    C   +  + W  CT    C + G + R++ C+    N   K+VP+  C    + PA W+ C   P   ++C+
Sbjct: 1545 WSACTRSCGGGVQTRRVTCQKLKASGISTPVSNDMCSQLAK-RPVDTQACNQQLC-------VEWAFSSWGQCNGPCIGPRLAVQHRQVFCQTRDGITLPSEQ--CSALPRPVSTQNCWSEACSVHWRVSLWTLCTA--TCGNYGFQSRRVECVHVRTN---KAVPEHLCSWGPR-PANWQRCNVTPCENTECR 1722          

HSP 4 Score: 55.4546 bits (132), Expect = 2.314e-7
Identity = 52/201 (25.87%), Postives = 84/201 (41.79%), Query Frame = 1
Query:  262 WQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCR---RIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSK 855
            W+ +  +  CS  CG G Q     C     + +   V+   C       KP+ K ++ C L  CP        W+   WT+CS+SCGG G+++R V C+     G   + + + C    +    + C  FDC P++    W  CT    C   G+R R + C+        + +  G C  ++KP    E     P Y+ +
Sbjct:  301 WRETDFFP-CSATCGGGYQLTSAECYD---LRSNRVVADQYCHYYPENVKPKPK-LQECNLDPCPAR------WEATPWTACSSSCGG-GIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPVVQPCNIFDC-PKWLAQEWSPCTV--TCGQ-GLRYRVVLCI------DHRGMHTGGCSAKTKPHIKEECIIPTPCYKPR 479          

HSP 5 Score: 54.6842 bits (130), Expect = 3.922e-7
Identity = 46/161 (28.57%), Postives = 70/161 (43.48%), Query Frame = 1
Query: 1300 IKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENK----VLLPNNCDLSTQPI--ETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCR 1764
            + P   +W +G WS CS +CG+ G QTR V C  +  R   EV        +  KP  ++ C  F   P W+  +     C+ TC   G   +   + CK        + LP     +++P   + C   +C   W   +WS CS SCG  G + R+  C+
Sbjct:  646 LDPCPARWEIGKWSPCSLTCGV-GLQTRDVVCSHLLSREMNEVVVLADELCHHPKPSTVQACNRFNCPPAWYPAQ--WQLCSRTC---GGGIQKRDVLCKQRMADGSFLELPETFCSASKPTSHQGCKKDDCPSEWLLSEWSECSVSCGE-GTQTRSAICQ 799          

HSP 6 Score: 54.299 bits (129), Expect = 5.561e-7
Identity = 53/213 (24.88%), Postives = 84/213 (39.44%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCI--LSLYSGGYMNAKHYDCKSE-------YEPVKN----------------EKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTS-KSVPKGNCYIRSKPPATWESCFKDP 840
            W++CS +CG G+Q   ++CV++ + G    V   KC  +  P+   ++ C +  CP        W   EW+ C+ +C G+G+R R V CI    +++GG         K E       Y+P +                 E+       P F   +W  CT        G + R I C V      S   +P   C      PA+  +C+  P
Sbjct:  368 WTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEEWKC--MYTPKMPVVQPCNIFDCPK-------WLAQEWSPCTVTC-GQGLRYRVVLCIDHRGMHTGGCSAKTKPHIKEECIIPTPCYKPREKLPIEAKLPWFKQAQELEEGAAVSEEPSFIPEAWSACTVTCGV---GTQVRIIRCQVLLPFSQSVADLPADEC--EGPKPASQRACYAGP 565          

HSP 7 Score: 53.9138 bits (128), Expect = 8.227e-7
Identity = 35/123 (28.46%), Postives = 58/123 (47.15%), Query Frame = 1
Query:  463 EFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEP-VKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESC 828
            ++ W V    +CS SCG  G+    ++C+L+      ++ +H  C  +  P V+   C   DCP  +  TSW  CT  R+C   G++ R++ C     +G S  V    C   +K P   ++C
Sbjct: 1479 DYWWSVDRLATCSASCGNRGIHQPRLRCLLNTTE---VDPEH--CTGKPRPAVQPVACNRRDCPSRWMVTSWSACT--RSCGG-GVQTRRVTCQKLKASGISTPVSNDMCSQLAKRPVDTQAC 1593          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Adamtsl3 (ADAMTS-like 3 [Source:MGI Symbol;Acc:MGI:3028499])

HSP 1 Score: 90.8929 bits (224), Expect = 3.248e-18
Identity = 78/307 (25.41%), Postives = 130/307 (42.35%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXH-HMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEI 1197
            W +CS  CG+G+Q   + C+       + +         R+ +   ++ C    CP +      W + EW  CS +CGG G + R V C   L  G ++N     C+   +   ++ C   DCPP+     W KC+        G +RR+  C   T  G   SV +  C  R  P        + P   SK +   K K  +     +   +++   R  K++ L VG  A++L +T + IKCPV  F    +QW KD        +  +++ +++ G L I   +  D G + C AG+    + +
Sbjct:  725 WGACSATCGVGIQTRDVYCL-------HPEEFPAPPEECREEKPHALRACNQFDCPPS------WHIEEWQQCSRTCGG-GTQNRRVTCRQLLTDGSFLNLSDELCQGP-KASSHKSCARTDCPPQLAAGDWSKCSVTCGV---GFQRRKQVCQKLTAKGRRVSVAETLC--RDLPGLPLVRPCQMP-ICSKAKLGTKTKLGERGPQILGVRRVYIQTREEKRINLTVGSRAYLLLNTSVIIKCPVRRFQKSLIQWEKD----GHCLKNSKQLGITKSGSLKIHSLAAPDIGVYRCIAGSAQETVVL 1006          

HSP 2 Score: 71.2478 bits (173), Expect = 3.580e-12
Identity = 94/418 (22.49%), Postives = 150/418 (35.89%), Query Frame = 1
Query:  946 LKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLK------DNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKA------GTITAEIEILTQNPSDGFSHYL----SRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKK-NSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYEN-----KVLLPNNCDLSTQP-------IETC------------------------------HNP---------------NCTLF-----WKTEKWSTCSSSCGNPGIKARTVSCRWRND-NSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKHCGLRK---LCSVDHYQHFCCKTCN 1950
            L + VG T        + I CPV   P  N+ WLK      DN++  F             G L+++  S ++EG +IC A         T+ + +L +    G + +     +R++      +   N +     +  F  W  G W+ CS +CG  G++ +   C +   +   E   G   K     +  NIR+C      P  W    +S +C+ +C   G+ F   ++ CK        +V+ P  C    +P       I  C                              HN                NCTL      W+   W  C++ CG  G ++R V C         A   C + K   P   + C  P C+  C D + +C   K   LCS+  Y+  CC++C 
Sbjct: 1315 LSVVVGGTVEAALQANVTIHCPVKGVPQPNVTWLKTGGSLSDNVSLLF------------NGSLLLQSASLENEGTYICTATNALGKAVATSGLRLLERREPGGKAAFPKVQKTRVLQAPRSRINSNNLTGKSLPQEHF--WEPGNWTHCSATCGPLGFRLQRPRCVMASGQEVSEALCGPHRKPLAGFQSCNIRDC------PARWFTSMWS-ECSASC---GEGFHSRQVTCKQTKANGTVQVVSPRACAPKDRPLGRKPCSIRPCVQQAIDPGNQCPGRCMGHATRMQHHHTACSHNSSSSDCEDGRRPAFGRNCTLGPCEACWRVGPWKPCTAVCGR-GFQSRKVDCIHTGSCKIVADRYCVQVK---PAAWRHCLGPSCDRNCTDTTHYCMFVKHLNLCSLAVYRQRCCQSCQ 1704          

HSP 3 Score: 61.6178 bits (148), Expect = 2.862e-9
Identity = 45/169 (26.63%), Postives = 79/169 (46.75%), Query Frame = 1
Query:  256 FEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGT 762
            ++W+ +  ++ C+  C  G QE +  C+      T++ V+   C  + +P   + + C +  CP        W +G W +CS +CG  G++TRDV C+          A   +C+ E +P     C  FDCPP +    W +C+  R C   G + R++ C     +G+
Sbjct:  659 YDWEYAG-FTPCTATCLGGHQEAIAVCLHTQ---THQTVNDSLCDTVHRPPPMS-QACNMEPCPPR------WHMGSWGACSATCG-VGIQTRDVYCLHPEEF----PAPPEECREE-KPHALRACNQFDCPPSWHIEEWQQCS--RTCGG-GTQNRRVTCRQLLTDGS 807          

HSP 4 Score: 60.077 bits (144), Expect = 8.744e-9
Identity = 41/143 (28.67%), Postives = 64/143 (44.76%), Query Frame = 1
Query:  382 KCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKN-EKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKP 807
            K R ++ PR +       G    +   E  W+ G WT CS +CG  G R +  +C+++  SG         C    +P+   + C   DCP  +FT+ W +C+   +C   G   RQ+ C  T  NGT + V    C  + +P
Sbjct: 1415 KTRVLQAPRSRINSNNLTG---KSLPQEHFWEPGNWTHCSATCGPLGFRLQRPRCVMA--SG--QEVSEALCGPHRKPLAGFQSCNIRDCPARWFTSMWSECSA--SC-GEGFHSRQVTCKQTKANGTVQVVSPRACAPKDRP 1547          

HSP 5 Score: 51.9878 bits (123), Expect = 2.587e-6
Identity = 30/90 (33.33%), Postives = 46/90 (51.11%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCI 549
            W++CS +CG G+Q     CV++++     +V   KC  +  P+   M+ C L  CP        W   EW+ C+ +C G G+R R V CI
Sbjct:  439 WTACSVSCGGGIQRRSFVCVEESMHAEILQVEEWKC--MYAPKPTVMQACNLFDCPK-------WVAMEWSQCTVTC-GRGLRYRVVLCI 518          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Adamts6 (a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 [Source:MGI Symbol;Acc:MGI:1347348])

HSP 1 Score: 77.7962 bits (190), Expect = 2.908e-14
Identity = 70/233 (30.04%), Postives = 99/233 (42.49%), Query Frame = 1
Query:  115 LESLYITNEEFSLPFRLRSIMNMSIMFVRYALILGSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPA 813
            LE+L  T+E   +   L+   N+ I   RY   +  +    G     F W   Q W+ CS  C  GVQ   + C +   +     V  + C    KP E   + C    CP        W +G+W  CS +C G G+RTR V CI  +         + DC + + PV+ E C    CPP++    W +CT    C S G + R + C     +  SK+ P   C   SKPPA
Sbjct:  799 LEALGPTSENLIVMVLLQE-QNLGI---RYKFNVPIVRTGSGDNEVGFMW-TYQPWAECSATCAGGVQRQEVVCKR---LDDNSIVQNNFCDPDSKPPEN-QRACNTEPCPPE------WFIGDWLECSKTCDG-GMRTRAVLCIRKVGPSEEETLDYGDCLT-HRPVEKESCNNQSCPPQWVALDWSECTP--KCGS-GFKHRIVLC---KSSDLSKTFPAAQCPEESKPPA 1008          

HSP 2 Score: 60.077 bits (144), Expect = 8.576e-9
Identity = 70/235 (29.79%), Postives = 103/235 (43.83%), Query Frame = 1
Query: 1303 KPLFYQWVVGPWSICSKSCGIGGYQTRYVGC-ELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYEN--KVLLPNNCDLSTQP-------IETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIK---KCSAPPCNLG--CMDLSK--HCGLR---KLCSVDHYQHFCCKTC 1947
            +P   +W +G W  CSK+C  GG +TR V C   +       +D G CL    ++    +E    Q CP  W+   +S +CT  C   G  FK   + CK  +  K      C   ++P       +  C  P     W T  W  CS+ CG  G + RTV C   +   QA   C +  +R P + +   KC + P +    C D++K  +C L    K CS  +++  CCKTC
Sbjct:  897 EPCPPEWFIGDWLECSKTCD-GGMRTRAVLCIRKVGPSEEETLDYGDCLTHRPVE----KESCNNQSCPPQWVALDWS-ECTPKC---GSGFKHRIVLCKSSDLSKTFPAAQCPEESKPPARIRCSLGRCPPPR----WVTGDWGQCSAQCG-LGQQMRTVQCL--SYTGQASVDCPET-VRPPSMQQCDSKCDSTPLSSTEECKDVNKVAYCPLVLKFKFCSRAYFRQMCCKTC 1114          

HSP 3 Score: 55.8398 bits (133), Expect = 1.956e-7
Identity = 44/154 (28.57%), Postives = 75/154 (48.70%), Query Frame = 1
Query: 1315 YQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLK--CKYENKVLLPNNCDLSTQPIE--TCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCR 1764
            + W   PW+ CS +C  GG Q + V C+ ++    ++         +S  P+N R C      P W+IG+    +C++TC    ++   L ++     E + L   +C L+ +P+E  +C+N +C   W    WS C+  CG+ G K R V C+
Sbjct:  842 FMWTYQPWAECSATCA-GGVQRQEVVCKRLDDNSIVQ---NNFCDPDSKPPENQRACNTEPCPPEWFIGDWL--ECSKTCDGGMRTRAVLCIRKVGPSEEETLDYGDC-LTHRPVEKESCNNQSCPPQWVALDWSECTPKCGS-GFKHRIVLCK 987          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Adamts6 (a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 [Source:MGI Symbol;Acc:MGI:1347348])

HSP 1 Score: 77.7962 bits (190), Expect = 2.908e-14
Identity = 70/233 (30.04%), Postives = 99/233 (42.49%), Query Frame = 1
Query:  115 LESLYITNEEFSLPFRLRSIMNMSIMFVRYALILGSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPA 813
            LE+L  T+E   +   L+   N+ I   RY   +  +    G     F W   Q W+ CS  C  GVQ   + C +   +     V  + C    KP E   + C    CP        W +G+W  CS +C G G+RTR V CI  +         + DC + + PV+ E C    CPP++    W +CT    C S G + R + C     +  SK+ P   C   SKPPA
Sbjct:  799 LEALGPTSENLIVMVLLQE-QNLGI---RYKFNVPIVRTGSGDNEVGFMW-TYQPWAECSATCAGGVQRQEVVCKR---LDDNSIVQNNFCDPDSKPPEN-QRACNTEPCPPE------WFIGDWLECSKTCDG-GMRTRAVLCIRKVGPSEEETLDYGDCLT-HRPVEKESCNNQSCPPQWVALDWSECTP--KCGS-GFKHRIVLC---KSSDLSKTFPAAQCPEESKPPA 1008          

HSP 2 Score: 60.077 bits (144), Expect = 8.576e-9
Identity = 70/235 (29.79%), Postives = 103/235 (43.83%), Query Frame = 1
Query: 1303 KPLFYQWVVGPWSICSKSCGIGGYQTRYVGC-ELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYEN--KVLLPNNCDLSTQP-------IETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIK---KCSAPPCNLG--CMDLSK--HCGLR---KLCSVDHYQHFCCKTC 1947
            +P   +W +G W  CSK+C  GG +TR V C   +       +D G CL    ++    +E    Q CP  W+   +S +CT  C   G  FK   + CK  +  K      C   ++P       +  C  P     W T  W  CS+ CG  G + RTV C   +   QA   C +  +R P + +   KC + P +    C D++K  +C L    K CS  +++  CCKTC
Sbjct:  897 EPCPPEWFIGDWLECSKTCD-GGMRTRAVLCIRKVGPSEEETLDYGDCLTHRPVE----KESCNNQSCPPQWVALDWS-ECTPKC---GSGFKHRIVLCKSSDLSKTFPAAQCPEESKPPARIRCSLGRCPPPR----WVTGDWGQCSAQCG-LGQQMRTVQCL--SYTGQASVDCPET-VRPPSMQQCDSKCDSTPLSSTEECKDVNKVAYCPLVLKFKFCSRAYFRQMCCKTC 1114          

HSP 3 Score: 55.8398 bits (133), Expect = 1.956e-7
Identity = 44/154 (28.57%), Postives = 75/154 (48.70%), Query Frame = 1
Query: 1315 YQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLK--CKYENKVLLPNNCDLSTQPIE--TCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCR 1764
            + W   PW+ CS +C  GG Q + V C+ ++    ++         +S  P+N R C      P W+IG+    +C++TC    ++   L ++     E + L   +C L+ +P+E  +C+N +C   W    WS C+  CG+ G K R V C+
Sbjct:  842 FMWTYQPWAECSATCA-GGVQRQEVVCKRLDDNSIVQ---NNFCDPDSKPPENQRACNTEPCPPEWFIGDWL--ECSKTCDGGMRTRAVLCIRKVGPSEEETLDYGDC-LTHRPVEKESCNNQSCPPQWVALDWSECTPKCGS-GFKHRIVLCK 987          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P90884|MADD4_CAEEL (Protein madd-4 OS=Caenorhabditis elegans OX=6239 GN=madd-4 PE=1 SV=5)

HSP 1 Score: 176.792 bits (447), Expect = 5.600e-45
Identity = 163/631 (25.83%), Postives = 254/631 (40.25%), Query Frame = 1
Query:  256 FEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQC--ILSLYSGGYMNAKHYDCKSEYE-PVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPA----TWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEI-------------LTQNPSDGFSHYLSRIIYFKEDIV------------------------EGKNNSAIKYIKPLFYQWVVGPWSIC-SKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLP-NNCDLSTQPIET--CHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSA----PPC----------NLGCMDLSKHCGLRKL---CSVDHYQHFCCKTCNY 1953
            ++W+    W+ CS +C  G Q+  L C+Q   + T + V + +C   R+P EK+ + C    CP        W   +++ CS SCG  G   R V+C   +S   G   +    D +  ++ P + E C    CP  + T  W +C+  R+C S G RRRQ+ C +    G ++  P   C   +KP      ++ SC + PE  S   F                         KKL L +G  A +   T I+IKCP   F  + + W K+        +    I VS  G L +     +D G + C    +   + +             L   P    +    R+   KED++                        E       KY   L  +W +G WS C  K+C + GYQ R + C++        VD   C    S++P   R C   + CP W   + +S   ++ C+    + K   + C++ N   +   +CD++ +P  T  C N NC   W+T  W +CSS CG  G++ R +SC W +    AG  C   ++R P   + C A    PPC          +  C D S+ C + KL   C     +  CC TC +
Sbjct:  452 YQWRYGD-WTQCSASCLGGKQKAALKCIQ---VSTGKSVQWSQCDARRRPPEKS-RPCNQHPCPP------FWLTSKYSDCSMSCGS-GTARRSVKCAQTVSKTDGADAHIVLRDDRCHFKKPQETETCNVVACPATWVTAQWTECS--RSCDS-GERRRQVWCEIRDSRGKTQRRPDVECDANTKPQTVEVCSFGSCSR-PELLSNRVF-------------------EQNAEQKKLTLGIGGVATLYQGTSIKIKCPAKKFDKKKIYWKKNGKKI----KNDAHIKVSANGNLRVFHARMEDAGVYECFTDRLQGNVTLNFKYRDFPASRVDLAPKPQIPSTKNRQRVQVSKEDVLREQASVLHKMNVSLIEALLTAPNDEKAREQLRKYGNELVARWDIGHWSECRQKTCHVAGYQARGISCKVTFHGEIRNVDNSICESLASVRPPETRPC-HREDCPRWEASQ-WSECSSQRCVSSMLAQKRRNVTCRFTNGTSVDIQHCDITNRPATTMDCPNQNCKAEWRTSDWGSCSSECGTGGVQLRLLSCVWISSGRPAGRNCE--QMRRPHSARACVADEPLPPCMPTASALYQRDASCQDQSRFCDIIKLFHSCDSLEVRQKCCSTCTF 1039          

HSP 2 Score: 66.6254 bits (161), Expect = 5.688e-10
Identity = 63/234 (26.92%), Postives = 102/234 (43.59%), Query Frame = 1
Query:  169 SIMNMSIMFVRYALILGSLLGFCGPTRGKFEWQNSQL----WSSCSKACGIGVQENLLACVQKTLIGTYE-KVSYDKCRRIRKPREKTMKTCFLGVCPTNETSE-------FIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCM--VTTKNGTSKSVPKGNCYIRSKPPATWESC 828
            SI   S+ +   A + G+  G         +WQ  +L    WS+CS  CG GV    + CV    I +   K+   +C+   +P  K  ++C +  CP  E S+       + W+ G+WT CS SC G G +   ++CI  + +G  +     D +    P K+  C    CPP + T+ +  C+   +C S G  RR + C   V+  +G    +   +     K P   E+C
Sbjct:  346 SIATNSLDWNDRAYLDGNTFG---SMDNHNDWQAPRLVAGEWSTCSSTCGTGVMSRTVECVAVNPISSAPIKLPMSECQDQEQP--KLFESCEVRSCPLQEDSKLSEDEAPYQWRYGDWTQCSASCLG-GKQKAALKCI-QVSTGKSVQWSQCDAR-RRPPEKSRPCNQHPCPPFWLTSKYSDCSM--SCGS-GTARRSVKCAQTVSKTDGADAHIVLRDDRCHFKKPQETETC 568          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BLI0|ATL1_MOUSE (ADAMTS-like protein 1 OS=Mus musculus OX=10090 GN=Adamtsl1 PE=2 SV=2)

HSP 1 Score: 100.138 bits (248), Expect = 2.494e-20
Identity = 92/356 (25.84%), Postives = 149/356 (41.85%), Query Frame = 1
Query:  223 LLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTN-----ETSEFI--------------------------WKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEI 1197
            LLG        ++W+  + ++ CS++CG GVQE +++C+ K    T E    + C   R+P  + +K+C L  CP +     E +E +                          W   +W  CS +CGG G++ RDV C   +  G ++      C S  +P  ++ C   DCP E+  + W +C+   +C   G + R   C    K G S  V    C     PP  + S  + P   + C    +   +  P I+ ++      R  +KL   VG  A++LP T + ++CP   F    + W KD         +   + V+  GYL I +  P D G + C AG    +  I
Sbjct:  598 LLGGLQDLDELYDWEY-EGFTKCSESCGGGVQEAVVSCLNKQ---TRELADENLCVTSRRP-PQLLKSCNLDPCPASHLLSREMNEVVVLADELCHHPKPSTVQACNRFNCPPAWYPAQWQLCSRTCGG-GIQKRDVLCKQRMADGSFLELPETFC-SASKPTSHQGCKKDDCPSEWLLSEWSECSV--SCGE-GTQTRSAICQRVLKTGVSTVVNSTLC-----PPLPFSSSIR-PCMLATCARPGRPSTKHSPHIAAARNIYIQTRRQRKLHFVVGGFAYLLPKTTVVLRCPTRRFRKPLITWEKDGQHSI----SSAHVTVAPFGYLKIHRLKPSDAGIYTCSAGPAREQFVI 933          

HSP 2 Score: 83.9593 bits (206), Expect = 2.577e-15
Identity = 81/367 (22.07%), Postives = 155/367 (42.23%), Query Frame = 1
Query:  958 VGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLI-IKKFSPKDEGKWIC----KAGTITAEIEILTQN---------------PSDGFSHYLSRIIYFKEDI----VEGKNNSAIKYI----KPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPN-NCDLSTQPIET--CHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSC-RWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPC-NLGCMDLSKHCG---LRKLCSVDHYQHFCCKTCN 1950
            +G    + P     + CP+   P+ N+ W ++    A         H+   G ++ +   S   +G++ C    +AGT+  +  ++ Q+                + G      R +    ++      GK   A++ +    +    +W+V  WS C++SCG GG QTR V C+ ++              + + +P + + C   Q C  W        +C   C+    + +  ++ C+  + + LP+  C    +P+ T  C +  C++ W+   W+ C+++CGN G ++R V C   R + +    LCS      P   ++C+  PC N  C D +++C      KLC +  ++  CC TC 
Sbjct: 1385 LGTQLVLDPGNSALLGCPIKGHPTPNITWFQNGQPIATAPGLTH--HIWGAGQILRVANLSGGPQGEFSCLAQNEAGTLLQKASLVIQDYWWSVDRLATCSASCGNRGIHQPRLRCLLNTTEVDPEHCTGKPRPAVQPVACNRRDCPSRWMVTSWSACTRSCG-GGVQTRRVTCQKLKASGISTPVSNDMCSQLAKRPVDTQACNQ-QLCVEWAFSS--WGQCNGPCIGPRLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQSRRVECVHVRTNKAVPEHLCSWGP--RPANWQRCNVTPCENTECRDTTRYCEKVRQLKLCQLGQFRSRCCGTCG 1743          

HSP 3 Score: 58.151 bits (139), Expect = 2.339e-7
Identity = 48/194 (24.74%), Postives = 80/194 (41.24%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQ 861
            WS+C+++CG GVQ   + C +    G    VS D C ++ K R    + C   +C         W    W  C+  C G  +  +  Q       G  + ++   C +   PV  + C    C   +  + W  CT    C + G + R++ C+    N   K+VP+  C    + PA W+ C   P   ++C+
Sbjct: 1537 WSACTRSCGGGVQTRRVTCQKLKASGISTPVSNDMCSQLAK-RPVDTQACNQQLC-------VEWAFSSWGQCNGPCIGPRLAVQHRQVFCQTRDGITLPSEQ--CSALPRPVSTQNCWSEACSVHWRVSLWTLCTA--TCGNYGFQSRRVECVHVRTN---KAVPEHLCSWGPR-PANWQRCNVTPCENTECR 1714          

HSP 4 Score: 54.299 bits (129), Expect = 4.022e-6
Identity = 53/213 (24.88%), Postives = 84/213 (39.44%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCI--LSLYSGGYMNAKHYDCKSE-------YEPVKN----------------EKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTS-KSVPKGNCYIRSKPPATWESCFKDP 840
            W++CS +CG G+Q   ++CV++ + G    V   KC  +  P+   ++ C +  CP        W   EW+ C+ +C G+G+R R V CI    +++GG         K E       Y+P +                 E+       P F   +W  CT        G + R I C V      S   +P   C      PA+  +C+  P
Sbjct:  385 WTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEEWKC--MYTPKMPVVQPCNIFDCPK-------WLAQEWSPCTVTC-GQGLRYRVVLCIDHRGMHTGGCSAKTKPHIKEECIIPTPCYKPREKLPIEAKLPWFKQAQELEEGAAVSEEPSFIPEAWSACTVTCGV---GTQVRIIRCQVLLPFSQSVADLPADEC--EGPKPASQRACYAGP 582          

HSP 5 Score: 53.9138 bits (128), Expect = 4.649e-6
Identity = 53/212 (25.00%), Postives = 88/212 (41.51%), Query Frame = 1
Query:  262 WQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIR---KPREKTMKTCFLGVCPTNETSEFI-----------WKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSK 855
            W+ +  +  CS  CG G Q     C     + +   V+   C       KP+ K ++ C L  CP ++  + I           W+   WT+CS+SCGG G+++R V C+     G   + + + C    +    + C  FDC P++    W  CT    C   G+R R + C+        + +  G C  ++KP    E     P Y+ +
Sbjct:  301 WRETDFFP-CSATCGGGYQLTSAECYD---LRSNRVVADQYCHYYPENVKPKPK-LQECNLDPCPASDGYKQIMPYDLYHPLPRWEATPWTACSSSCGG-GIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPVVQPCNIFDC-PKWLAQEWSPCTV--TCGQ-GLRYRVVLCI------DHRGMHTGGCSAKTKPHIKEECIIPTPCYKPR 496          

HSP 6 Score: 53.5286 bits (127), Expect = 6.646e-6
Identity = 35/123 (28.46%), Postives = 58/123 (47.15%), Query Frame = 1
Query:  463 EFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEP-VKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESC 828
            ++ W V    +CS SCG  G+    ++C+L+      ++ +H  C  +  P V+   C   DCP  +  TSW  CT  R+C   G++ R++ C     +G S  V    C   +K P   ++C
Sbjct: 1471 DYWWSVDRLATCSASCGNRGIHQPRLRCLLNTTE---VDPEH--CTGKPRPAVQPVACNRRDCPSRWMVTSWSACT--RSCGG-GVQTRRVTCQKLKASGISTPVSNDMCSQLAKRPVDTQAC 1585          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P82987|ATL3_HUMAN (ADAMTS-like protein 3 OS=Homo sapiens OX=9606 GN=ADAMTSL3 PE=1 SV=4)

HSP 1 Score: 94.7449 bits (234), Expect = 1.161e-18
Identity = 81/304 (26.64%), Postives = 125/304 (41.12%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEI 1191
            W  CS  CG+G+Q   + C+             ++CR   KP    ++ C    CP        W + EW  CS +CGG G + R V C   L  G ++N     C+   +   ++ C   DCPP      W KC+   +C   GI+RR+  C      G  + +P      R  P        + PE          K   + P I   +      R  K++ L +G  A++LP+T + IKCPV  F    +QW KD        +  +R+ +++ G L I   +  D G + C AG+    +
Sbjct:  712 WGPCSATCGVGIQTRDVYCLHPG----ETPAPPEECRD-EKPH--ALQACNQFDCPPG------WHIEEWQQCSRTCGG-GTQNRRVTCRQLLTDGSFLNLSDELCQGP-KASSHKSCARTDCPPHLAVGDWSKCSV--SC-GVGIQRRKQVCQRLAAKG--RRIPLSEMMCRDLPGLPLVRSCQMPECSKIKSEMKTKLGEQGPQILSVQRVYIQTREEKRINLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQWEKDGRCL----QNSKRLGITKSGSLKIHGLAAPDIGVYRCIAGSAQETV 991          

HSP 2 Score: 72.0182 bits (175), Expect = 1.459e-11
Identity = 60/218 (27.52%), Postives = 97/218 (44.50%), Query Frame = 1
Query: 1318 QWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGK-CLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPI--ETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSC-RWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKHCGLRK---LCSVDHYQHFCCKTCN 1950
            +W    WS CS SCG  GY +R V C+  +    ++V   + C  K+  +P   + C     C  W  G    ++C   C+      +     C++ +     +NCD   +P     C +  C + W T  W  C+++CG  G ++R V C   R+    A   C + K   P+  + C  P C+  C D + +C   K   LCS+D Y+  CC++C 
Sbjct: 1486 RWFTSVWSQCSVSCG-EGYHSRQVTCKRTKANGTVQVVSPRACAPKD--RPLGRKPC-FGHPCVQWEPG----NRCPGRCMGRAVRMQQRHTACQHNSS---DSNCDDRKRPTLRRNCTSGACDVCWHTGPWKPCTAACGR-GFQSRKVDCIHTRSCKPVAKRHCVQKK--KPISWRHCLGPSCDRDCTDTTHYCMFVKHLNLCSLDRYKQRCCQSCQ 1689          

HSP 3 Score: 59.6918 bits (143), Expect = 8.372e-8
Identity = 55/212 (25.94%), Postives = 87/212 (41.04%), Query Frame = 1
Query:  139 EEFSLPFRLRSIMNMSIMFVRYALILGSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFI-----------WKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCM 741
            + F +P  L   M   I   RY     S++ F        +W+ +  +  C+  CG G Q N   CV   L                KP+ K +K C +  CP+++  + I           W+   WT+CS SCGG G++ R   C+     G  +  + + C    +P   + C  FDC P++    W +CT    C   G+R R + C+
Sbjct:  305 QTFKIPGPL---MADFIFKTRYTAAKDSVVQFFFYQPISHQWRQTDFFP-CTVTCGGGYQLNSAECVDIRLKRVVPDHYCHYYPENVKPKPK-LKECSMDPCPSSDGFKEIMPYDHFQPLPRWEHNPWTACSVSCGG-GIQRRSFVCVEESMHGEILQVEEWKCMYAPKPKVMQTCNLFDC-PKWIAMEWSQCTV--TCGR-GLRYRVVLCI 506          

HSP 4 Score: 58.9214 bits (141), Expect = 1.384e-7
Identity = 41/135 (30.37%), Postives = 60/135 (44.44%), Query Frame = 1
Query:  445 PTNET--SEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKN-EKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDP 840
            PT E    E  W+ G W+ CS +CG  G R +  QC+++             C    +P+   E C   DCP  +FT+ W +C+   +C   G   RQ+ C  T  NGT + V    C  + +P    + CF  P
Sbjct: 1417 PTGEPPPQEPFWEPGNWSHCSATCGHLGARIQRPQCVMA----NGQEVSEALCDHLQKPLAGFEPCNIRDCPARWFTSVWSQCSV--SC-GEGYHSRQVTCKRTKANGTVQVVSPRACAPKDRPLGR-KPCFGHP 1543          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8N6G6|ATL1_HUMAN (ADAMTS-like protein 1 OS=Homo sapiens OX=9606 GN=ADAMTSL1 PE=1 SV=4)

HSP 1 Score: 94.7449 bits (234), Expect = 1.259e-18
Identity = 81/298 (27.18%), Postives = 123/298 (41.28%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAG 1173
            WS CS  CG+G+Q   + C         E V        R+P+  T++ C    CP        W   +W  CS +CGG GV+ R+V C   +  G ++      C S  +P   + C   DCP E+  + W +C+   +C   G + R   C    K G S  V    C     PP  + S  + P   + C    +   +  P I+ ++      R  +KL   VG  A++LP T + ++CP        + W KD         +   + V+  GYL I +  P D G + C AG
Sbjct:  675 WSPCSLTCGVGLQTRDVFCSHLLSREMNETVILAD-ELCRQPKPSTVQACNRFNCPP------AWYPAQWQPCSRTCGG-GVQKREVLCKQRMADGSFLELPETFC-SASKPACQQACKKDDCPSEWLLSDWTECST--SCGE-GTQTRSAICRKMLKTGLSTVVNSTLC-----PPLPFSSSIR-PCMLATCARPGRPSTKHSPHIAAARKVYIQTRRQRKLHFVVGGFAYLLPKTAVVLRCPARRVRKPLITWEKDGQHLI----SSTHVTVAPFGYLKIHRLKPSDAGVYTCSAG 950          

HSP 2 Score: 84.7297 bits (208), Expect = 1.786e-15
Identity = 80/367 (21.80%), Postives = 152/367 (41.42%), Query Frame = 1
Query:  958 VGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLI-IKKFSPKDEGKWIC----KAGTITAEIEILTQN---------------PSDGFSHYLSRIIYFKEDI----VEGKNNSAIKYI----KPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPN-NCDLSTQPIET--CHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSC-RWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPC-NLGCMDLSKHC---GLRKLCSVDHYQHFCCKTCN 1950
            +G    + P     + CP+   P  N+ W         +       H+   G ++ +   S   +G++ C    +AG +  +  ++ Q+                + G      R +    ++      GK   A++ I    +    +W+V  WS C++SCG GG QTR V C+ ++              + + +P + + C   Q C  W        +C   C+    + +  ++ C+  + + LP+  C    +P+ T  C +  C++ W+   W+ C+++CGN G ++R V C   R + +    LCS      P   ++C+  PC N+ C D +++C      KLC +  ++  CC TC 
Sbjct: 1402 LGTQLVLDPGNSALLGCPIKGHPVPNITWFHGG--QPIVTATGLTHHILAAGQILQVANLSGGSQGEFSCLAQNEAGVLMQKASLVIQDYWWSVDRLATCSASCGNRGVQQPRLRCLLNSTEVNPAHCAGKVRPAVQPIACNRRDCPSRWMVTSWSACTRSCG-GGVQTRRVTCQKLKASGISTPVSNDMCTQVAKRPVDTQACNQ-QLCVEWAFSS--WGQCNGPCIGPHLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQSRRVECVHARTNKAVPEHLCSWGP--RPANWQRCNITPCENMECRDTTRYCEKVKQLKLCQLSQFKSRCCGTCG 1760          

HSP 3 Score: 82.4185 bits (202), Expect = 7.876e-15
Identity = 58/196 (29.59%), Postives = 104/196 (53.06%), Query Frame = 1
Query:  256 FEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQC--ILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKD 837
            ++W+  + ++ CS++CG GVQE +++C+ K    T E    + C   R+P  + +K+C L  CP        W++G+W+ CS +C G G++TRDV C  +LS      +      C+ + +P   + C  F+CPP ++   W  C+  R C   G+++R++ C     +G+   +P+  C   +  PA  ++C KD
Sbjct:  609 YDWEY-EGFTKCSESCGGGVQEAVVSCLNKQ---TREPAEENLCVTSRRP-PQLLKSCNLDPCPAR------WEIGKWSPCSLTC-GVGLQTRDVFCSHLLSREMNETVILADELCR-QPKPSTVQACNRFNCPPAWYPAQWQPCS--RTCGG-GVQKREVLCKQRMADGSFLELPETFC--SASKPACQQACKKD 786          

HSP 4 Score: 80.1073 bits (196), Expect = 4.888e-14
Identity = 130/599 (21.70%), Postives = 224/599 (37.40%), Query Frame = 1
Query:  142 EFSLPFRLRSIMNMSIMFVRYALILGSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIR---KPREKTMKTCFLGVCPTNETSEFI-----------WKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLK--LNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDL---KLKCKYENKVLLPNNCDLSTQP----IETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGC 1869
            +F +  R     + ++ F+ Y  I+               W+ +  +  CS  CG G Q     C     + +   V+   C       KP+ K ++ C L  CP ++  + I           W+   WT+CS+SCGG G+++R V C+     G   + + + C    +    + C  FDC P++    W  CT    C   G+R R + C+        + +  G C  ++KP    E     P Y+ K +   + K                 + +++L+    V +    +P       C V       ++ ++  +  +F +   +          I +   PK   +  C AG  + EI     + +DG    L       +D  E              Y W    ++ CS+SCG GG Q   V C   + R   E +    L   S +P  + +      CP  W    +S  C+ TC  VG   +D+    L  +  N+ ++  + +L  QP    ++ C+  NC   W   +W  CS +CG  G++ R V C+ R        +   + + +P      S P C   C
Sbjct:  274 DFIVKIRNSGSADSTVQFIFYQPII-------------HRWRETDFFP-CSATCGGGYQLTSAECYD---LRSNRVVADQYCHYYPENIKPKPK-LQECNLDPCPASDGYKQIMPYDLYHPLPRWEATPWTACSSSCGG-GIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPIAQPCNIFDC-PKWLAQEWSPCTV--TCGQ-GLRYRVVLCI------DHRGMHTGGCSPKTKPHIKEECIVPTPCYKPKEKLPVEAKLPW-------------FKQAQELEEGAAVSEEPSFIPEAW--SACTVTCGVGTQVRIVRCQVLLSFSQSVAD--------LPIDECEGPKPASQRACYAGPCSGEIPEFNPDETDGLFGGL-------QDFDE-------------LYDWEYEGFTKCSESCG-GGVQEAVVSCLNKQTREPAEEN----LCVTSRRPPQLLKSCNLDPCPARWEIGKWS-PCSLTC-GVGLQTRDVFCSHLLSREMNETVILAD-ELCRQPKPSTVQACNRFNCPPAWYPAQWQPCSRTCGG-GVQKREVLCKQR--------MADGSFLELPETFCSASKPACQQAC 783          

HSP 5 Score: 57.7658 bits (138), Expect = 3.156e-7
Identity = 48/194 (24.74%), Postives = 79/194 (40.72%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQ 861
            WS+C+++CG GVQ   + C +    G    VS D C ++ K R    + C   +C         W    W  C+  C G  +  +  Q       G  + ++   C +   PV  + C    C   +  + W  CT    C + G + R++ C+    N   K+VP+  C    + PA W+ C   P    +C+
Sbjct: 1554 WSACTRSCGGGVQTRRVTCQKLKASGISTPVSNDMCTQVAK-RPVDTQACNQQLC-------VEWAFSSWGQCNGPCIGPHLAVQHRQVFCQTRDGITLPSEQ--CSALPRPVSTQNCWSEACSVHWRVSLWTLCTA--TCGNYGFQSRRVECVHARTN---KAVPEHLCSWGPR-PANWQRCNITPCENMECR 1731          

HSP 6 Score: 55.4546 bits (132), Expect = 1.539e-6
Identity = 37/123 (30.08%), Postives = 58/123 (47.15%), Query Frame = 1
Query:  463 EFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEP-VKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESC 828
            ++ W V    +CS SCG  GV+   ++C+L   +   +N  H  C  +  P V+   C   DCP  +  TSW  CT  R+C   G++ R++ C     +G S  V    C   +K P   ++C
Sbjct: 1488 DYWWSVDRLATCSASCGNRGVQQPRLRCLL---NSTEVNPAH--CAGKVRPAVQPIACNRRDCPSRWMVTSWSACT--RSCGG-GVQTRRVTCQKLKASGISTPVSNDMCTQVAKRPVDTQAC 1602          

HSP 7 Score: 55.0694 bits (131), Expect = 2.145e-6
Identity = 45/161 (27.95%), Postives = 69/161 (42.86%), Query Frame = 1
Query: 1300 IKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENK----VLLPNNCDLSTQPI--ETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCR 1764
            + P   +W +G WS CS +CG+ G QTR V C  +  R   E            KP  ++ C  F   P W+  +     C+ TC   G   +  ++ CK        + LP     +++P   + C   +C   W    W+ CS+SCG  G + R+  CR
Sbjct:  663 LDPCPARWEIGKWSPCSLTCGV-GLQTRDVFCSHLLSREMNETVILADELCRQPKPSTVQACNRFNCPPAWYPAQ--WQPCSRTC---GGGVQKREVLCKQRMADGSFLELPETFCSASKPACQQACKKDDCPSEWLLSDWTECSTSCGE-GTQTRSAICR 816          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9UKP5|ATS6_HUMAN (A disintegrin and metalloproteinase with thrombospondin motifs 6 OS=Homo sapiens OX=9606 GN=ADAMTS6 PE=2 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 9.887e-14
Identity = 70/233 (30.04%), Postives = 97/233 (41.63%), Query Frame = 1
Query:  115 LESLYITNEEFSLPFRLRSIMNMSIMFVRYALILGSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPA 813
            LE+L  T+E   +   L+   N+ I   RY   +       G     F W N Q WS CS  C  GVQ   + C +   +     V  + C    KP E   + C    CP        W +G+W  CS +C G G+RTR V CI  +         +  C + + PV+ E C    CPP++    W +CT    C  PG + R + C     +  SK+ P   C   SKPP 
Sbjct:  799 LEALGPTSENLIVMVLLQE-QNLGI---RYKFNVPITRTGSGDNEVGFTW-NHQPWSECSATCAGGVQRQEVVCKR---LDDNSIVQNNYCDPDSKPPEN-QRACNTEPCPPE------WFIGDWLECSKTCDG-GMRTRAVLCIRKIGPSEEETLDYSGCLT-HRPVEKEPCNNQSCPPQWVALDWSECTP--KC-GPGFKHRIVLC---KSSDLSKTFPAAQCPEESKPPV 1008          

HSP 2 Score: 57.3806 bits (137), Expect = 3.767e-7
Identity = 70/230 (30.43%), Postives = 101/230 (43.91%), Query Frame = 1
Query: 1318 QWVVGPWSICSKSCGIGGYQTRYVGC-ELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYEN--KVLLPNNCDLSTQP-------IETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIK---KCSAPPCN--LGCMDLSK--HCGLR---KLCSVDHYQHFCCKTC 1947
            +W +G W  CSK+C  GG +TR V C   I       +D   CL    ++    +E    Q CP  W+   +S +CT  C   G  FK   + CK  +  K      C   ++P       +  C  P     W T  W  CS+ CG  G + RTV C   +   QA S C +  +R P + +   KC + P +    C D++K  +C L    K CS  +++  CCKTC
Sbjct:  902 EWFIGDWLECSKTCD-GGMRTRAVLCIRKIGPSEEETLDYSGCLTHRPVE----KEPCNNQSCPPQWVALDWS-ECTPKC---GPGFKHRIVLCKSSDLSKTFPAAQCPEESKPPVRIRCSLGRCPPPR----WVTGDWGQCSAQCG-LGQQMRTVQCL--SYTGQASSDCLET-VRPPSMQQCESKCDSTPISNTEECKDVNKVAYCPLVLKFKFCSRAYFRQMCCKTC 1114          

HSP 3 Score: 55.8398 bits (133), Expect = 1.246e-6
Identity = 52/187 (27.81%), Postives = 87/187 (46.52%), Query Frame = 1
Query: 1315 YQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLK--CKYENKVLLPNNCDLSTQPIET--CHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRN-DNSQAGSLC---SKAKIRMPLLIKKCSAP 1851
            + W   PWS CS +C  GG Q + V C+ ++    ++         +S  P+N R C      P W+IG+    +C++TC    ++   L ++     E + L  + C L+ +P+E   C+N +C   W    WS C+  CG PG K R V C+  +   +   + C   SK  +R+   + +C  P
Sbjct:  842 FTWNHQPWSECSATCA-GGVQRQEVVCKRLDDNSIVQ---NNYCDPDSKPPENQRACNTEPCPPEWFIGDWL--ECSKTCDGGMRTRAVLCIRKIGPSEEETLDYSGC-LTHRPVEKEPCNNQSCPPQWVALDWSECTPKCG-PGFKHRIVLCKSSDLSKTFPAAQCPEESKPPVRIRCSLGRCPPP 1020          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A183JCE1 (Ig-like domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS349 PE=4 SV=1)

HSP 1 Score: 352.829 bits (904), Expect = 1.372e-109
Identity = 202/573 (35.25%), Postives = 291/573 (50.79%), Query Frame = 1
Query:  262 WQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPR----EKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYM----NAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKP-PATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNI-TYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPIETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKHCGLR-KLCSVDHYQHFCCKTC 1947
            W  S+ WSSCSK CG GV+     CVQ         +   +C  +  P     E   + C LG C       + W+V  W  CS +CGG G+ +RDVQC+ S   G  +    +A +Y C +  +P ++  C  F C PEF    W KC +   C+ PG + RQ++C+    NG+ + +P   CY+  K    TW  CF+  E   KC  K          I         MR  K + L VGQ AFV+P TR+ ++CPV  F ++ LQW   N    A+     +RI V ++G L I+ F   DEG W C AG++ A + +  + P+ GF  ++ R   + + ++   ++     I     QWVVGPWS CS SCG  G Q R V CE ++ R++  +    C+ K   KP + R+C+   KCPTW++    +  CT+ CLDVGK      L C    + +    CD   +P   C NP C L W    WS CS SCG  G++AR + C W ++   AGSLC   ++ +P +I+ C  PPC LGC+D+SKHC  R +LC    Y++ CC++C
Sbjct:   24 WMPSESWSSCSKECGDGVETRRFLCVQNDHYNATTLLDESQCEHLPNPSAQNTENNQRACKLGPCGKG----YRWRVSNWGHCSQTCGGLGIMSRDVQCVYSGKDGDLVISDFDASYY-CGNYRQPERHASCNRFACKPEFVPEKWGKCIQSDPCR-PGRQVRQLSCISVQVNGSLRELPMAACYMTGKTIQPTWRRCFE--ESSRKCDSKPPMINTDTLTIV-------QMRKVKVIDLKVGQQAFVIPFTRVTVRCPVQYFTAQELQWANPNHGILAYTGAISDRIRVDKRGRLHIRSFRLIDEGDWTCIAGSMNATVTLTARTPAAGFHDWVQRNRLWTKGMLS--DDPKAIAINHEIIQWVVGPWSTCSTSCGQTGQQFRVVRCEKVDSRFYQILSDQVCIDKLLPKPPSTRKCLESNKCPTWFVENRDTSVCTDRCLDVGKGSISGNLVCMIGERTVATKYCDKLDKPNMECENPICQLRWNVSNWSQCSRSCGGVGVQARHLLCTWSHNGELAGSLCYSHQLAIPDVIRSCEVPPCKLGCVDMSKHCSKRVELCKFTIYRYQCCQSC 579          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A094ZL01 (ADAMTS-like protein 3 OS=Schistosoma haematobium OX=6185 GN=MS3_02878 PE=4 SV=1)

HSP 1 Score: 352.443 bits (903), Expect = 1.777e-109
Identity = 201/573 (35.08%), Postives = 289/573 (50.44%), Query Frame = 1
Query:  262 WQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPR----EKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKH---YDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKP-PATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNI-TYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPIETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKHCGLR-KLCSVDHYQHFCCKTCN 1950
            W  S+ WSSCSK CG GV+     CVQ         +   +C  +  P     E   + C LG C       + W+V  W  CS +CGG G+ +RDVQC+ S   G  + +     Y C +  +P ++  C  F C PEF    W KC +   C+ PG + RQ++C+    NG+ + +P   CY+  K    TW  CF+  E   KC  K          I         MR  K + L VGQ AFV+P TR+ ++CPV  F ++ LQW   N    A+     +RI V ++G L I+ F   DEG W C AG++ A + +  + P+ GF  ++ R   + + ++   ++     I     QWVVGPWS CS SCG  G Q R V CE ++ R++  +    C+ K   KP + R+C+   KCPTW++    +  CT+ CLDVGK      L C    + +    CD   +P   C NP C L W    WS CS SCG  G++AR + C W ++   AGSLC   ++ +P +I+ C  PPC LGC+D+SKHC  R +LC    Y++ CC++C 
Sbjct:   12 WMPSESWSSCSKECGDGVETRRFLCVQNDHYNATTLLDESQCEHLPNPSAQNTENNQRACKLGPCGKG----YRWRVSNWGHCSQTCGGLGIMSRDVQCVYSGKDGDLVISDFDAFYYCGNYRQPERHASCNRFACKPEFVPEKWGKCIQSDPCR-PGRQVRQLSCISVQVNGSLRELPMAACYMTGKTIQPTWRRCFE--ESSRKCDSKPPMINTDTLTIV-------QMRKVKVIDLKVGQQAFVIPFTRVTVRCPVQYFTAQELQWANPNHGILAYTGAISDRIRVDKRGRLHIRSFRLIDEGDWTCIAGSMNATVTLTARTPAAGFHDWVQRNRLWTKGMLS--DDPKAIAINHEIIQWVVGPWSTCSTSCGQTGQQFRVVRCEKVDSRFYQILSDQVCIDKLLPKPPSTRKCLESNKCPTWFVENRDTSVCTDRCLDVGKGSISGNLVCMIGERTVATKYCDKLDKPNMECENPICQLRWNVSNWSQCSRSCGGVGVQARHLLCTWSHNGELAGSLCYSHQLAIPDVIRSCEVPPCKLGCVDMSKHCSKRVELCKFTIYRYQCCESCQ 568          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A430QEZ9 (Uncharacterized protein OS=Schistosoma bovis OX=6184 GN=DC041_0006420 PE=4 SV=1)

HSP 1 Score: 347.051 bits (889), Expect = 2.061e-107
Identity = 200/575 (34.78%), Postives = 292/575 (50.78%), Query Frame = 1
Query:  262 WQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPR----EKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYM----NAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKP-PATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHM-RSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNI-TYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPIETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKHCGLR-KLCSVDHYQHFCCKTCN 1950
            W  S+ WSSCSK CG GV+     CVQ         +   +C  +  P     E   + C LG C       + W+V  W  CS +CGG G+ +RDVQC+ S   G  +    +A +Y C +  +P ++  C  F C PEF    W KC +   C+ PG + RQ++C+    NG+ + +P   CY+  K    TW  CF+  E   KC  K          I   +  +  +    K + L VGQ AFV+P TR+ ++CPV  F ++ LQW   N    A+     +RI V ++G L I+ F   DEG W C AG++ A + +  + P+ GF  ++ R   + + ++   ++     I     QWVVGPWS CS SCG  G Q R V CE ++ R++  +    C+ K   KP + R+C+   KCPTW++    +  CT+ CLDVGK      L C    + +    CD   +P   C NP C L W    WS CS SCG  G++AR + C W ++   AGSLC   ++ +P +I+ C  PPC LGC+D+SKHC  R +LC    Y++ CC++C 
Sbjct:    8 WMPSESWSSCSKECGDGVETRRFLCVQNDHYNATTLLDESQCEHLPNPSAQNTENNQRACKLGPCGKG----YRWRVSNWGHCSQTCGGLGIMSRDVQCVYSGKDGDLVISDFDASYY-CGNYRQPERHASCNRFACKPEFVPEKWGKCIQSDPCR-PGRQVRQLSCISVQVNGSLRELPMAACYMTGKTIQPTWRRCFE--ESSRKCDSKPPMINTDTLTIVQMRKVVSLIFLLVKVIDLKVGQQAFVIPFTRVTVRCPVQYFTAQELQWANPNHGILAYTGAISDRIRVDKRGRLHIRSFRLIDEGDWTCIAGSMNATVTLTARTPAAGFHDWVQRNRLWTKGMLS--DDPKAIAINHEIIQWVVGPWSTCSTSCGQTGQQFRVVRCEKVDSRFYQILSDQVCIDKLLPKPPSTRKCLESNKCPTWFVENRDTSVCTDRCLDVGKGSISGNLVCMIGERTVATKYCDKLDKPNMECENPICQLRWNVSNWSQCSRSCGGVGVQARHLLCTWSHNGELAGSLCYSHQLAIPDVIRSCEVPPCKLGCVDMSKHCSKRVELCKFTIYRYQCCESCQ 572          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A4Z2DGQ1 (Protein madd-4 isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_001159 PE=4 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 4.914e-103
Identity = 193/558 (34.59%), Postives = 280/558 (50.18%), Query Frame = 1
Query:  304 GIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKP----REKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAK---HYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKP-PATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNI-TYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPIETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKHCGLR-KLCSVDHYQHFCCKTC 1947
            G GV+     CVQ         +   +C+ +  P     E   + C LG C       + W+V  W  CS +CGG GV +RDVQCI S   G  + +     Y C +  +P ++  C  F C PEF    W KC +   C+ PG + RQ++C+    NG+ + +P   CY+  +    TW  CF+  E   KC  K          I         MR  K + L VGQ AFV+P TR+ ++CPV  F ++ LQW   N    A+     +RI V ++G L I+ F   DEG W C AG++ A + +  + P+ GF  ++ R   + + ++   ++     I     QWVVGPWS CS SCG  G Q R V CE ++ R++  ++   C+ K   KP + R+C+   KCP W+I    +  CT  CLDVGK      L C   ++ +    CD   +P   C NP C + W    WS CS SCG  G++AR + C W ++   AGSLC   ++ +P +I+ C  PPC LGC+D+SKHC  R +LC    Y++ CC+TC
Sbjct:   14 GDGVENRRFLCVQNDHYNATTILDDSQCKHLPNPVTQNTENNQRACKLGPCGKG----YRWRVSNWGHCSQTCGGLGVMSRDVQCIYSGKDGDLVMSDFDASYYCGNYRQPERHASCNRFPCKPEFVPEKWGKCIQSDPCR-PGRQVRQLSCISVQVNGSLRELPMAACYMTGQAIHPTWRRCFE--ESSRKCDSKPPMINTDTLTIV-------QMRKVKVIDLKVGQQAFVIPFTRVTVRCPVQYFTAQELQWANPNHGILAYTGAISDRIKVDKRGRLHIRSFRLIDEGDWTCIAGSMNATVTLTARTPAAGFHDWVQRNRLWTKGMLS--DDPKAIAINHEIIQWVVGPWSTCSTSCGQAGQQFRVVRCEKVDSRFYQILNDQVCVDKLLPKPPSTRKCLESNKCPVWFIENRDTSTCTNRCLDVGKGSIGGNLVCMIGDRPVAAKYCDKLDKPDMECENPICQVRWNVSNWSQCSRSCGGVGVQARHLLCTWSHNGELAGSLCYSHQVAIPDVIRSCEVPPCKLGCVDMSKHCSKRVELCKFTIYRYQCCETC 555          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A183LQA1 (Ig-like domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS5976 PE=4 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 1.165e-102
Identity = 193/559 (34.53%), Postives = 281/559 (50.27%), Query Frame = 1
Query:  304 GIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPR----EKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYM----NAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKP-PATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNI-TYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPIETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKHCGLR-KLCSVDHYQHFCCKTC 1947
            G GV+     CVQ         +   +C  +  P     E   + C LG C       + W+V  W  CS +CGG G+ +RDVQC+ S   G  +    +A +Y C +  +P ++  C  F C PEF    W KC +   C+ PG + RQ++C+    NG+ + +P   CY+  K    TW  CF+  E   KC  K          I         MR  K + L VGQ AFV+P TR+ ++CPV  F ++ LQW   N    A+     +RI V ++G L I+ F   DEG W C AG++ A + +  + P+ GF  ++ R   + + ++   ++     I     QWVVGPWS CS SCG  G Q R V CE ++ R++  +    C+ K   KP + R+C+   KCPTW++    +  CT+ CLDVGK      L C    + +    CD   +P   C NP C L W    WS CS SCG  G++AR + C W ++   AGSLC   ++ +P +I+ C  PPC LGC+D+SKHC  R +LC    Y++ CC++C
Sbjct:   45 GDGVETRRFLCVQNDHYNATTLLDESQCEHLPNPSAQNTENNQRACKLGPCGKG----YRWRVSNWGHCSQTCGGLGIMSRDVQCVYSGKDGDLVISDFDASYY-CGNYRQPERHASCNRFACKPEFVPEKWGKCIQSDPCR-PGRQVRQLSCISVQVNGSLRELPMAACYMTGKTIQPTWRRCFE--ESSRKCDSKPPMINTDTLTIV-------QMRKVKVIDLKVGQQAFVIPFTRVTVRCPVQYFTAQELQWANSNHGILAYTGAISDRIRVDKRGRLHIRSFRLIDEGDWTCIAGSMNATVTLTARTPAAGFHDWVQRNRLWTKGMLS--DDPKAIAINHEIIQWVVGPWSTCSTSCGQTGQQFRVVRCEKVDSRFYQILSDQVCIDKLLPKPPSTRKCLESNKCPTWFVENRDTSVCTDRCLDVGKGSISGNLVCMIGERTVATKYCDKLDKPNMECENPICQLRWNVSNWSQCSRSCGGVGVQARHLLCTWSHNGELAGSLCYSHQLAIPDVIRSCEVPPCKLGCVDMSKHCSKRVELCKFTIYRYQCCESC 586          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: adamtsl3 (ADAMTS-like protein 3 [Source:NCBI gene;Acc:103028701])

HSP 1 Score: 90.8929 bits (224), Expect = 2.261e-18
Identity = 86/328 (26.22%), Postives = 139/328 (42.38%), Query Frame = 1
Query:  220 SLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDC-PPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEIL 1200
            +++  C P      W  S+ WS CS++CG+G+Q   + CV+       E V   +C+  R P    ++ C    CP        W+  EW  CS +C   G + R V C   L  G +      +C    +P     C    C  P      W KC+    C   GI+RR+  C   + +G   ++ +  C    +PP    SC   P  + K        K++ P +   K      R  K+L   +G  A++LP T + IKCPV +FP   ++W KD        +  + + +++ G L +     +D G++ C A    ++I IL
Sbjct:  694 AMVRICNPQPCPARWDFSE-WSQCSESCGVGLQTRRVRCVRSVGSNLTESVELSECKGSRPPE---LQACNQHHCPP------AWEAEEWQQCSHACV-RGTQWRKVYCRQRLAGGSFRKLPDEECDG-VKPATQRPCTDPLCLQPHLDGGEWSKCSV--TC-GKGIQRREPVCRRLSVSGQLVTLDRSACN-GLQPPPLIRSCRMTPCNKHK------YSKKRCPQVLGLKRIYIQTRQEKRLSFTIGGRAYLLPKTSVVIKCPVRHFPKAQIRWEKDGQDL----QNSKHLSITKSGALRLYSLETRDIGEYRCWANQ-ASDIFIL 994          

HSP 2 Score: 63.5438 bits (153), Expect = 6.587e-10
Identity = 51/196 (26.02%), Postives = 86/196 (43.88%), Query Frame = 1
Query:  187 IMFVRYALILGSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFI-----------WKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCM 741
            I+ ++YA+   +++ F      +++W+ +  +  CS  CG G Q N   CV+     T             KP+ K +K C +  C  ++  + +           W+   WTSCS SCGG G + R V C+     G  +  + + C     P+  + C  FDC P++    W +CT    C   G+R R + C+
Sbjct:  318 IIKLKYAVPKDTVMQFMFYQPIRYQWRETDFFP-CSVTCGGGYQLNSADCVEIRYNKTVPDHHCHSYPENNKPKPK-LKECNMDPCLESDGFKEVMPYDHFQPLPRWEQNPWTSCSVSCGG-GSQQRSVVCVEEDMQGQVVQVEEWKCTHSPRPITEQPCNTFDC-PKWVAMEWSQCTV--TCGR-GLRYRVVLCI 506          

HSP 3 Score: 52.373 bits (124), Expect = 1.541e-6
Identity = 39/119 (32.77%), Postives = 54/119 (45.38%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHY-DCKSEYEPVKNEKC 633
            W+SCS +CG G Q+  + CV++ + G   +V   KC     PR  T + C    CP        W   EW+ C+ +C G G+R R V CI         N +H   C S  +P   E C
Sbjct:  427 WTSCSVSCGGGSQQRSVVCVEEDMQGQVVQVEEWKC--THSPRPITEQPCNTFDCPK-------WVAMEWSQCTVTC-GRGLRYRVVLCI-------DHNGQHTGGCSSSLKPHIKEDC 528          

HSP 4 Score: 50.0618 bits (118), Expect = 9.447e-6
Identity = 55/194 (28.35%), Postives = 85/194 (43.81%), Query Frame = 1
Query: 1303 KPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIE-VDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVL--LPN-NCD-LSTQPIETCHNPNCTL-FWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKA--KIRMPLLIKKCSAPPCN 1860
            +P   +W    WS CS+SCG+ G QTR V C         E V+  +C      +P  ++ C     CP  W  E +  +C+  C+  G  ++ +  + +        LP+  CD +       C +P C        +WS CS +CG  GI+ R   CR  + + Q  +L   A   ++ P LI+ C   PCN
Sbjct:  702 QPCPARWDFSEWSQCSESCGV-GLQTRRVRCVRSVGSNLTESVELSEC---KGSRPPELQACNQHH-CPPAWEAEEW-QQCSHACVR-GTQWRKVYCRQRLAGGSFRKLPDEECDGVKPATQRPCTDPLCLQPHLDGGEWSKCSVTCGK-GIQRREPVCRRLSVSGQLVTLDRSACNGLQPPPLIRSCRMTPCN 887          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000039281.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:25842872:25855936:-1 gene:ENSAMXG00000032437.1 transcript:ENSAMXT00000039281.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.8037 bits (203), Expect = 4.244e-16
Identity = 87/339 (25.66%), Postives = 138/339 (40.71%), Query Frame = 1
Query:  991 RIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEG---KNNSAIKYIKPLFY---------QWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPIETCH----NPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLG-CMDLSKHC-GLRK--LCSVDHYQHFCCKTC 1947
            R+E+KC     P   + W KD +          R+ +   G L+I+     D G + CKA                GF+   S++   +   V G    N S+      L Y         +W V  WS CS  CG GG QTR V C  +        +G +       +P + R C + Q C   WI   +   C   C+    + +   + C+ +N   L +    S+QP  T H       C L W+   W+ C+++CG  G ++R V C  R     A  L    + R P   ++C+   C  G C D +++C  +R+  LC +  ++  CC++C
Sbjct:  321 RVELKCQAQGNPQPVVIWKKDGVELT----NSSRVGLMPDGSLLIEAPQETDSGLYTCKATNHL------------GFTSLSSQVQITESGCVNGADENNTSSCTDSLQLPYSCHGQHCRHRWQVSSWSSCSADCG-GGLQTRSVTCLGV-------AEGAETCMGAGRRPVDSRACNI-QPC-VAWITRAWG-PCNGQCVGPQLALQHRHVFCQDKNSTRLQHRM-CSSQPRPTSHRNCTTEACALHWRVGPWTQCTATCGRHGFQSRHVMCVHRRSGKPARELHCAWRPR-PASWQRCNILSCGRGECRDSTRYCEKVRQLELCPLPQFKARCCRSC 630          

HSP 2 Score: 49.6766 bits (117), Expect = 9.362e-6
Identity = 26/81 (32.10%), Postives = 39/81 (48.15%), Query Frame = 1
Query:  931 RSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAG 1173
            R   KL   VG  A++ P T + I+CP  +F    + WLKD    A +      + +S  GY+ I++    D G + C AG
Sbjct:   40 RKGPKLHFVVGGYAYLFPWTSVVIRCPTRHFRKGLIHWLKDGKPLALL----PHVSLSHMGYIKIQQVRASDVGMYTCVAG 116          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: adamts14 (ADAM metallopeptidase with thrombospondin type 1 motif, 14 [Source:ZFIN;Acc:ZDB-GENE-130530-852])

HSP 1 Score: 78.1814 bits (191), Expect = 1.718e-14
Identity = 89/338 (26.33%), Postives = 138/338 (40.83%), Query Frame = 1
Query: 1018 NFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKK---FSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCE-----LIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKC--PTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLST----QPIETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKHC-----------GLRKLCSVDHYQHFCCKTCNYK 1956
            N  S ++  +K+ +T  FI  +K    V  K ++   +   +S + E + +  AG +   I +L     D     L+      ED+V    N+ +   +   Y+W +  WS C+K CG GG Q    GC       +  R F EV+          KP  IR+     +C  P W + E     C++TC   G   + ++     +N    P +    +    +   TC    C   W+T  WS CS SCG+ GI+ R V CR  + +S A     K +   P  +  C  P C   C  +S  C            L + CS+  Y   CC++CN K
Sbjct:  738 NETSPHIIAVKNQVTDIFILNSKGD-EVKTKSFIESGQEWEYSVEGEKETLKTAGPLHEGIVVLVVPREDDTKISLTYKYIIHEDLVPIITNNNVLLAELDTYEWALKNWSQCTKPCG-GGVQYTKYGCRRKSDSRLVHRNFCEVN---------KKPKPIRKRCNINECSQPVWVVEE--WGPCSKTCGSQGYQTRVVQCVQPLQNGTNRPIHIKYCSGKRPETRRTCGPNTCPAQWRTGAWSQCSVSCGD-GIQQRQVVCRASDSSSVA-----KCEGEKPECVSICKMPSCPGLCFYISAPCVGDKSIFCQMEVLARYCSIPGYNKLCCESCNKK 1056          

HSP 2 Score: 72.7886 bits (177), Expect = 7.872e-13
Identity = 54/171 (31.58%), Postives = 80/171 (46.78%), Query Frame = 1
Query:  256 FEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSK 768
            +EW     WS C+K CG GVQ     C +K+       V  + C   +KP+    +      C  NE S+ +W V EW  CS +CG +G +TR VQC+  L   G     H    S   P     CG   CP ++ T +W +C+   +C   GI++RQ+ C  +  +  +K
Sbjct:  839 YEWALKN-WSQCTKPCGGGVQYTKYGCRRKS---DSRLVHRNFCEVNKKPKPIRKR------CNINECSQPVWVVEEWGPCSKTCGSQGYQTRVVQCVQPL-QNGTNRPIHIKYCSGKRPETRRTCGPNTCPAQWRTGAWSQCSV--SCGD-GIQQRQVVCRASDSSSVAK 995          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000037051.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000074.1:160336:466926:1 gene:ENSAMXG00000043174.1 transcript:ENSAMXT00000037051.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.7962 bits (190), Expect = 2.932e-14
Identity = 77/289 (26.64%), Postives = 122/289 (42.21%), Query Frame = 1
Query: 1129 KFSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKC--PTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYEN---KVLLPNNC-DLSTQPIETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKHCGLRKLCSVDHYQHFCCKTCNYK*NAFAGD 1977
            ++  K+    I   G +  ++ I+ +      +   ++ I   E + +G N + +     + Y WV+  W+ CSK+CG GG QT   GC        +       ++K    PD  R+C L ++C  P W  GE    +C+++C   G   + ++      +   K +    C D   +    C+   C   WK   WS CS +CGN G + R V C  R DN+    L SK     P  +  C  P CN       K   L + CS+  +Q  CCK+C+   N    D
Sbjct:  779 EYENKNNKDTIQTTGPLKNDVVIMIRMHGSTRTKVSAKYIIDNERLSDGANENNMVPDNAVPYSWVLKRWTPCSKTCG-GGTQTTRYGCRKNAEMRMVHRSFCDKIRK---PPDFYRDCYL-RECVQPIWVAGE--WGECSKSCGRSGTQTRSVRCVQPLGDGKFKSVRSRYCSDERPESRRDCNRMLCPAEWKLGPWSQCSVTCGN-GTQERPVLCHTR-DNTIGLCLDSKPAALRPCRMDPCPRPRCNTDRSVFCKMEVLYQYCSLPSFQRICCKSCSTHNNHTNSD 1058          

HSP 2 Score: 69.3218 bits (168), Expect = 1.077e-11
Identity = 44/136 (32.35%), Postives = 61/136 (44.85%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCT 687
            W+ CSK CG G Q     C +   +     V    C +IRKP +   + C+L  C      + IW  GEW  CS SCG  G +TR V+C+  L  G + + +   C  E  P     C    CP E+    W +C+
Sbjct:  848 WTPCSKTCGGGTQTTRYGCRKNAEM---RMVHRSFCDKIRKPPD-FYRDCYLREC-----VQPIWVAGEWGECSKSCGRSGTQTRSVRCVQPLGDGKFKSVRSRYCSDE-RPESRRDCNRMLCPAEWKLGPWSQCS 973          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: adamts14 (ADAM metallopeptidase with thrombospondin type 1 motif, 14 [Source:ZFIN;Acc:ZDB-GENE-130530-852])

HSP 1 Score: 72.7886 bits (177), Expect = 7.325e-13
Identity = 54/171 (31.58%), Postives = 81/171 (47.37%), Query Frame = 1
Query:  256 FEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSK 768
            +EW     WS C+K CG GVQ     C +K+       V  + C   +KP+    +      C  NE S+ +W V EW  CS +CG +G +TR VQC+  L + G     H    S   P     CG   CP ++ T +W +C+   +C   GI++RQ+ C  +  +  +K
Sbjct:  833 YEWALKN-WSQCTKPCGGGVQYTKYGCRRKS---DSRLVHRNFCEVNKKPKPIRKR------CNINECSQPVWVVEEWGPCSKTCGSQGYQTRVVQCVQPLQN-GTNRPIHIKYCSGKRPETRRTCGPNTCPAQWRTGAWSQCSV--SCGD-GIQQRQVVCRASDSSSVAK 989          

HSP 2 Score: 67.3958 bits (163), Expect = 4.424e-11
Identity = 92/362 (25.41%), Postives = 142/362 (39.23%), Query Frame = 1
Query: 1018 NFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKK---FSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCE-----LIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKC--PTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLST----QPIETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAG---------SLC------SKAKIRMPLL-----------------IKKCSAPPCNLGCMDLSKHCGLRKL---CSVDHYQHFCCKTCNYK 1956
            N  S ++  +K+ +T  FI  +K    V  K ++   +   +S + E + +  AG +   I +L     D     L+      ED+V    N+ +   +   Y+W +  WS C+K CG GG Q    GC       +  R F EV+          KP  IR+     +C  P W + E     C++TC   G   + ++     +N    P +    +    +   TC    C   W+T  WS CS SCG+ GI+ R V CR  + +S A          S+C       +A    P +                 + K S  PC     D S  C +  L   CS+  Y   CC++CN K
Sbjct:  732 NETSPHIIAVKNQVTDIFILNSKGD-EVKTKSFIESGQEWEYSVEGEKETLKTAGPLHEGIVVLVVPREDDTKISLTYKYIIHEDLVPIITNNNVLLAELDTYEWALKNWSQCTKPCG-GGVQYTKYGCRRKSDSRLVHRNFCEVN---------KKPKPIRKRCNINECSQPVWVVEE--WGPCSKTCGSQGYQTRVVQCVQPLQNGTNRPIHIKYCSGKRPETRRTCGPNTCPAQWRTGAWSQCSVSCGD-GIQQRQVVCRASDSSSVAKCEGEKPECVSICKMPSCPGEASFSTPTVDVMGNDTTGGEGLADASLNKISNEPC---VGDKSIFCQMEVLARYCSIPGYNKLCCESCNKK 1076          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: adamtsl3 (ADAMTS-like 3 [Source:ZFIN;Acc:ZDB-GENE-121030-8])

HSP 1 Score: 92.0485 bits (227), Expect = 1.800e-19
Identity = 80/317 (25.24%), Postives = 127/317 (40.06%), Query Frame = 1
Query:  262 WQNSQLWSSCSKACGIGVQENLLAC---VQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKC--GYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEI 1197
            W+ S+ W +CS +CG G++   + C   V +   G+ E+     C     PR   ++ C    CP        W   +W  CS +CG  GV++R ++C   L  G   +     C  +  P+  + C  G  +CP E+  + W    ++   Q    + R ++C  +T    +       C    KP A+  +C   P     C  K        P I   +           L   VG TA++ P + + +KCPV  F    ++W KD  + A      +R  V+R G L I+   P D G + C AG       I
Sbjct:  678 WETSE-WGACSASCGAGLRARSVGCARTVAREADGSEERQRATDCT---GPRPPDVEPCARSDCPP------AWHARDWQPCSRTCGSSGVQSRSLRCRRLLADGSSRDVDEQLCP-DSRPLAQQACGGGQSECPAEWVASEW---GQINTHQGNYTQHRDVSCQFSTAAEATSVANASQCSSLPKPLAS-RACTLPP-----CNRKGGSSANGGPQILGVRRIYIPSPWENLLAFPVGGTAYLFPKSMVVLKCPVARFQHSRVRWEKDGRSLA----ESDRHSVTRWGCLKIRCLQPDDIGVYTCVAGQARESFTI 970          

HSP 2 Score: 77.411 bits (189), Expect = 7.339e-15
Identity = 62/222 (27.93%), Postives = 96/222 (43.24%), Query Frame = 1
Query: 1321 WVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLK----KNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLP-NNCDLSTQP--IETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSC-RWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLG--CMDLSKHCGLRK---LCSVDHYQHFCCKTC 1947
            WV GPWS CS++CG  G + R V C            G   L     + + +P     C     CP W +G     +CT  C+ +G   +  ++ C   N    P  +C    +P  ++ C    C + W+T  W+ C++SCG  G +AR V C   R       + C  A    P   ++C+  PC     C D S++C + +   LC +  Y+  CC+ C
Sbjct: 1570 WVTGPWSDCSEACG-AGVRVRSVVCR--------SPAGATALPDYSCRGAERPARAEPCKR-HGCPEWAVG--AWAECTGRCVGLGIGTQHRRVLCFLHNGTAAPEGDCASKARPGSVQNCSVEACAVQWRTGPWAVCTASCGTHGFQARRVECAHVRTARPAPDAHC--AWQHKPATWQRCNITPCATTSECRDSSRYCEMVQKLNLCQLPTYRLRCCQAC 1777          

HSP 3 Score: 72.4034 bits (176), Expect = 2.344e-13
Identity = 57/200 (28.50%), Postives = 86/200 (43.00%), Query Frame = 1
Query:  241 PTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDP 840
            P  G   W  +  WS CS+ACG GV+   + C  ++  G      Y  CR   +P     + C    CP        W VG W  C+  C G G+ T+  + +  L++G    A   DC S+  P   + C    C  ++ T  W  CT   +C + G + R++ C       T++  P  +C  + K PATW+ C   P
Sbjct: 1562 PAVGCQPWWVTGPWSDCSEACGAGVRVRSVVC--RSPAGATALPDY-SCRGAERP--ARAEPCKRHGCPE-------WAVGAWAECTGRCVGLGIGTQHRRVLCFLHNG--TAAPEGDCASKARPGSVQNCSVEACAVQWRTGPWAVCTA--SCGTHGFQARRVECAHVR---TARPAPDAHCAWQHK-PATWQRCNITP 1741          

HSP 4 Score: 60.8474 bits (146), Expect = 7.853e-10
Identity = 63/263 (23.95%), Postives = 105/263 (39.92%), Query Frame = 1
Query:  124 LYIT---NEEFSLPFRLRSIMNMSIMFVRYALILGSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACV--QKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFI--------------WKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSK 855
            L+IT     +F++  R  S     ++F+ Y  I               +W+ +  +  CS +CG G Q     CV  +   I +    +Y    +  KPR   ++ C +  CP+++  + I              W+   WT+CS+SCGG GV++R V C+     G     + + C     P   + C  +DC P++    W  CT    C   G++ R + C+      T      G C  + KP    E     P Y+ +
Sbjct:  267 LHITGPIQADFTIKARHVSSAETVVLFLFYQPI-------------PHQWRETDFFP-CSSSCGGGYQLTSAECVDMRNARIASDHFCNYYPENKKPKPR---LRECSMEPCPSSDGFKQIMSYDHYQPLPRPCRWEGSPWTACSSSCGG-GVQSRSVSCVEEDQQGHLEPVEEWKCMYVLRPAVTQPCNLYDC-PKWMAQEWSSCTV--TCGR-GLKYRVVLCIDHRGQHT------GGCNTKIKPHVKEECLVTTPCYKPR 501          

HSP 5 Score: 57.7658 bits (138), Expect = 8.831e-9
Identity = 62/219 (28.31%), Postives = 91/219 (41.55%), Query Frame = 1
Query:  262 WQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCI--LSLYSGGYMNAKHYDCKSE-------YEPVK----NEKCGYFDCPPE------------FFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTS-KSVPKGNCYIRSKPPATWESCFKDP 840
            W+ S  W++CS +CG GVQ   ++CV++   G  E V   KC  + +P     + C L  CP        W   EW+SC+ +C G G++ R V CI     ++GG         K E       Y+P +      K  +F    E            F   +W  C+  R+C  PG+R R + C V      S   +P G C    + PA+   C   P
Sbjct:  385 WEGSP-WTACSSSCGGGVQSRSVSCVEEDQQGHLEPVEEWKCMYVLRP--AVTQPCNLYDCPK-------WMAQEWSSCTVTC-GRGLKYRVVLCIDHRGQHTGGCNTKIKPHVKEECLVTTPCYKPREKLPVEAKVPWFKQAQELIEGPAVSEEAAFAPDAWSPCS--RSC-GPGVRTRAVRCRVLLPFSRSVVELPDGEC--EGERPASERPCALGP 587          

HSP 6 Score: 51.2174 bits (121), Expect = 7.710e-7
Identity = 49/202 (24.26%), Postives = 87/202 (43.07%), Query Frame = 1
Query: 1297 YIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNS----MKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLK-------CKYENKVLLPNNCDLSTQPIETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAK---IRMPLLIKKCSAPPCN 1860
            +  P   +W    W  CS SCG  G + R VGC    R    E DG +  ++ +     +P ++  C     CP  W    +   C+ TC   G   + L+ +        +  ++ L P++  L+ Q      +  C   W   +W   ++  GN   + R VSC++ +  ++A S+ + ++   +  PL  + C+ PPCN
Sbjct:  670 HTLPCPSRWETSEWGACSASCG-AGLRARSVGCA---RTVAREADGSEERQRATDCTGPRPPDVEPCAR-SDCPPAWHARDW-QPCSRTCGSSGVQSRSLRCRRLLADGSSRDVDEQLCPDSRPLAQQACGGGQS-ECPAEWVASEWGQINTHQGN-YTQHRDVSCQF-STAAEATSVANASQCSSLPKPLASRACTLPPCN 862          

HSP 7 Score: 48.1358 bits (113), Expect = 7.221e-6
Identity = 51/183 (27.87%), Postives = 75/183 (40.98%), Query Frame = 1
Query: 1318 QWVVGPWSICSKSCGIGGYQTRYVGC-ELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQP--------IETCHNPNCTL-------------------------FWKTEKWSTCSSSCGNPGIKARTVSCR 1764
            +W   PW+ CS SCG GG Q+R V C E  ++ +   V+  KC+    ++P   + C L+  CP W   E  S  CT TC   G+  K   + C  +++      C+   +P           C+ P   L                          +  + WS CS SCG PG++ R V CR
Sbjct:  384 RWEGSPWTACSSSCG-GGVQSRSVSCVEEDQQGHLEPVEEWKCMY--VLRPAVTQPCNLYD-CPKWMAQEWSS--CTVTC---GRGLKYRVVLC-IDHRGQHTGGCNTKIKPHVKEECLVTTPCYKPREKLPVEAKVPWFKQAQELIEGPAVSEEAAFAPDAWSPCSRSCG-PGVRTRAVRCR 555          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000756.1 (pep scaffold:Pmarinus_7.0:GL477404:44246:61450:-1 gene:ENSPMAG00000000690.1 transcript:ENSPMAT00000000756.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.4925 bits (197), Expect = 4.730e-16
Identity = 91/371 (24.53%), Postives = 154/371 (41.51%), Query Frame = 1
Query:  961 GQTAFVLP--HTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWIC----KAGTITAEIEI----LTQNPSD--------GFSHYLS-RIIYFKEDIVEGKNNSAIKYIKPLFY------------QWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIE-VDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNN-CDLSTQPI-----ETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLG-CMDLSKHCGL---RKLCSVDHYQHFCCKTC 1947
            G T+  +P  H  I + CPV      N+ W   +     +     ++    K   +     P D G   C    +AGT+TA + I    L+  P +        G +   S R+   ++D+ E   +      KP                W V  W  CS+SCG GG + R+V C+++     +  +  G C      +P     C     CP W +   +  +CT  C+      K  ++ C+  N  L+P++ CD S+        + C    C   W+  +WS C+++CG+ G ++R + C     ++  G   S A    P+  ++C+  PC  G C D +++C L    KLC +  Y+  CC++C
Sbjct:  245 GDTSLNVPTGHDLI-VGCPVAGNTKPNMTWYLGSQPVQSLPGLSYQLLAGEKVLRLRGVVGPWD-GPVRCVAQNEAGTLTATLHIAVGELSWTPGEPSPCSASCGNTGVQSWRLRCVRDDLEEVDASLCQGLPKPSLAAPQRCNRRDCPPSWSVEEWGTCSRSCG-GGMRLRHVTCQMLSSDGEVTPLPVGLCEHDAGPRPTEEESCAATHDCPHW-VALDWG-QCTGRCVGWMTGTKHRRVSCRTTNGTLVPDSACDKSSSVARPALSQNCSAEACAGEWRPGRWSECTATCGSHGFQSRRLECAGAAADAAGGEH-SCAWQPKPITWQRCNIIPCEKGECKDTTRYCHLVKRLKLCQLMMYKLRCCESC 609          

HSP 2 Score: 52.7582 bits (125), Expect = 2.068e-7
Identity = 36/125 (28.80%), Postives = 56/125 (44.80%), Query Frame = 1
Query:  463 EFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEP--VKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKP-PATWESC 828
            E  W  GE + CS SCG  GV++  ++C+               C+   +P     ++C   DCPP +    W  C+  R+C   G+R R + C + + +G    +P G C   + P P   ESC
Sbjct:  331 ELSWTPGEPSPCSASCGNTGVQSWRLRCVRD----DLEEVDASLCQGLPKPSLAAPQRCNRRDCPPSWSVEEWGTCS--RSCGG-GMRLRHVTCQMLSSDGEVTPLPVGLCEHDAGPRPTEEESC 448          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000757.1 (pep scaffold:Pmarinus_7.0:GL477404:45077:62293:-1 gene:ENSPMAG00000000690.1 transcript:ENSPMAT00000000757.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 7.296e-12
Identity = 43/154 (27.92%), Postives = 74/154 (48.05%), Query Frame = 1
Query: 1321 WVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIE-VDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNN-CDLST---QPI--ETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSC 1761
            W V  W  CS+SCG GG + R+V C+++     +  +  G C      +P     C     CP W +   +  +CT  C+      K  ++ C+  N  L+P++ CD S+   +P   + C    C   W+  +WS C+++CG+ G ++R + C
Sbjct:  572 WSVEEWGTCSRSCG-GGMRLRHVTCQMLSSDGEVTPLPVGLCEHDAGPRPTEEESCAATHDCPHW-VALDWG-QCTGRCVGWMTGTKHRRVSCRTTNGTLVPDSACDKSSSVARPALSQNCSAEACAGEWRPGRWSECTATCGSHGFQSRRLEC 722          

HSP 2 Score: 55.0694 bits (131), Expect = 4.685e-8
Identity = 39/142 (27.46%), Postives = 62/142 (43.66%), Query Frame = 1
Query:  412 KTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEP--VKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKP-PATWESC 828
            + +   +LG  P     E  W  GE + CS SCG  GV++  ++C+               C+   +P     ++C   DCPP +    W  C+  R+C   G+R R + C + + +G    +P G C   + P P   ESC
Sbjct:  497 RMLSAAYLGSLP-----ELSWTPGEPSPCSASCGNTGVQSWRLRCVRD----DLEEVDASLCQGLPKPSLAAPQRCNRRDCPPSWSVEEWGTCS--RSCGG-GMRLRHVTCQMLSSDGEVTPLPVGLCEHDAGPRPTEEESC 626          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: adamts17 (ADAM metallopeptidase with thrombospondin type 1 motif, 17 [Source:ZFIN;Acc:ZDB-GENE-121030-7])

HSP 1 Score: 65.0846 bits (157), Expect = 3.092e-11
Identity = 53/176 (30.11%), Postives = 78/176 (44.32%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKP 807
            W +CS  CG G   ++L C  K +  +   V  + CR + +P  +  + C    CP        WKV EW+ CS +C G+G++TR V C L L SGG +  +   C  +  P  ++ C   DC   +  TSW +C+        G R R   C          + P G C   S+P
Sbjct:  289 WENCSVQCGGGEVRSILGCT-KIVNRSQSCVPDEDCRNVSRPPLQN-RHCNSHPCPNR------WKVSEWSPCSRTC-GKGLQTRSVSCHLHLPSGGSVRTRDGRCP-KPRPPSSQGCQGHDCLGVWQATSWSQCSSR---CGKGTRVRTAQC----------TSPHGRCLATSRP 441          

HSP 2 Score: 51.2174 bits (121), Expect = 6.287e-7
Identity = 45/170 (26.47%), Postives = 76/170 (44.71%), Query Frame = 1
Query:  262 WQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCM--VTTKNGTS 765
            W+ S+ WS CS+ CG G+Q   ++C      G   +    +C    KPR  + + C    C        +W+   W+ CS+ C G+G R R  QC           + H  C +   P + + C  +    E+ T  W KC+   +C   G++ R ++CM  V+ ++G+ 
Sbjct:  345 WKVSE-WSPCSRTCGKGLQTRSVSCHLHLPSGGSVRTRDGRC---PKPRPPSSQGCQGHDC------LGVWQATSWSQCSSRC-GKGTRVRTAQCT----------SPHGRCLATSRPREQDGCEDYSQCYEWKTGDWSKCST--SCGR-GLQSRVVHCMHRVSGRHGSG 490          

HSP 3 Score: 51.2174 bits (121), Expect = 6.678e-7
Identity = 52/188 (27.66%), Postives = 81/188 (43.09%), Query Frame = 1
Query: 1306 PLFYQWVVGPWSICSKSCGIGGYQTRYVGCEL-IERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPIET--CHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCN 1860
            P   +W V  WS CS++CG G  QTR V C L +     +    G+C K    +P + + C     C   W    +S +C+  C   GK  +    +C   +       C  +++P E   C + +    WKT  WS CS+SCG  G+++R V C  R          +  K   P+  ++C    C+
Sbjct:  340 PCPNRWKVSEWSPCSRTCGKG-LQTRSVSCHLHLPSGGSVRTRDGRCPKP---RPPSSQGC-QGHDCLGVWQATSWS-QCSSRC---GKGTRVRTAQCTSPH-----GRCLATSRPREQDGCEDYSQCYEWKTGDWSKCSTSCGR-GLQSRVVHCMHRVSGRHGSGCEADGK---PVTYRECGVGECD 509          

HSP 4 Score: 48.521 bits (114), Expect = 4.293e-6
Identity = 37/133 (27.82%), Postives = 61/133 (45.86%), Query Frame = 1
Query:  262 WQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEF 660
            WQ +  WS CS  CG G +     C             + +C    +PRE+     +        +  + WK G+W+ CSTSC G G+++R V C+  + SG + +     C+++ +PV   +CG  +C   F
Sbjct:  405 WQATS-WSQCSSRCGKGTRVRTAQCTSP----------HGRCLATSRPREQDGCEDY--------SQCYEWKTGDWSKCSTSC-GRGLQSRVVHCMHRV-SGRHGSG----CEADGKPVTYRECGVGECDRTF 512          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ADAMTS7 (ADAM metallopeptidase with thrombospondin type 1 motif 7 [Source:HGNC Symbol;Acc:HGNC:223])

HSP 1 Score: 65.0846 bits (157), Expect = 3.887e-11
Identity = 47/155 (30.32%), Postives = 70/155 (45.16%), Query Frame = 1
Query:  277 LWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSE-YEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINC 738
            +WS CS +CG+G     + C    L         D C   ++P  +  + C +  C        +W VG W+ CS  CG  GV+TR VQC+ +   G  +   H  C S  Y P  +  C  + C PE+ T +W +C+  R C   G + R + C
Sbjct: 1184 VWSECSVSCGLGAMWRAVRCSSGRL---------DDCDAAKRP--EPARRCHVRPC-------AVWSVGNWSQCSEECGDGGVKTRVVQCVDAHKPGQALRPFH--CHSRGYTPPTSLACNSYPC-PEWSTGNWSQCS--RECGG-GWQHRSVTC 1314          

HSP 2 Score: 52.373 bits (124), Expect = 3.153e-7
Identity = 50/183 (27.32%), Postives = 77/183 (42.08%), Query Frame = 1
Query: 1321 WVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQP----IETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPC 1857
            W VG WS CS+ CG GG +TR V C +   +    +    C  +    P ++  C  +  CP W  G     +C+  C   G  ++   + C   ++    ++ D S +P    +  C NP   L W   +W  CS SC + G++ R V C       Q G+      +  P  I+ C   PC
Sbjct: 1231 WSVGNWSQCSEECGDGGVKTRVVQC-VDAHKPGQALRPFHCHSRGYTPPTSL-ACNSY-PCPEWSTGN--WSQCSREC---GGGWQHRSVTCPPGHRCN--DDGDGSPKPPPIALRPC-NPQPCLEWTVGRWGECSVSC-DGGVQQRMVQCVIVATRQQGGNGTWCGTLPRPETIRACGTHPC 1401          

HSP 3 Score: 49.6766 bits (117), Expect = 2.237e-6
Identity = 52/186 (27.96%), Postives = 76/186 (40.86%), Query Frame = 1
Query: 1309 LFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLK-LKCKYENKVLLPNNCDLS--TQPIETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPC 1857
            L   W VG WS CS SCG+G    R V C         + D  K       +P+  R C + + C  W +G     +C+E C D G   + ++ +      + L P +C     T P     N      W T  WS CS  CG  G + R+V+C   +  +  G    K     P+ ++ C+  PC
Sbjct: 1176 LPGHWFVGVWSECSVSCGLGAMW-RAVRC---SSGRLDDCDAAK-------RPEPARRCHV-RPCAVWSVGN--WSQCSEECGDGGVKTRVVQCVDAHKPGQALRPFHCHSRGYTPPTSLACNSYPCPEWSTGNWSQCSRECGG-GWQHRSVTCPPGHRCNDDGDGSPKPP---PIALRPCNPQPC 1343          

HSP 4 Score: 48.1358 bits (113), Expect = 7.122e-6
Identity = 36/126 (28.57%), Postives = 50/126 (39.68%), Query Frame = 1
Query:  280 WSSCSKACG-IGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGV-CPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCP 651
            W  CS  CG +G+ +  + C +        + S        +P+ KT   C  G+ CP        W VG+W+ CS SCGG G RTR   C                C+    P   E+C   +CP
Sbjct:  745 WQECSATCGELGLSKRSVRCERGGRAAGPHEPSLPDSHCYHRPKPKTRTPCNRGMPCPAR------WLVGDWSQCSVSCGG-GHRTRATYCD--------DRRNRTACEGRARPAAMEECNLTECP 855          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO44376 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW19])

HSP 1 Score: 77.411 bits (189), Expect = 1.255e-14
Identity = 126/518 (24.32%), Postives = 186/518 (35.91%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNE--TSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNIT--YAFIRRAKERIHVSRKGYLIIKKFSPKDE-------------GKW-----ICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQP--IETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSC 1761
            WS CS +CG+G +   + C        Y   S    R  R  R    + C    CPT      E  WK G W+ CS SCG +G R R V C  S    G   A+   C +   P   E+C    C   +   +W  C+K  +C   G++ R + C          S        +  P       FK P  Q +C+                      ++  ++L L+V + A VLP        P          W   ++T      RR        R     ++   P D              G W      C  G  T  I+          S  L++  + K+ +   + N+     +     W  GPWS CS SCG G  Q R        R  +   +GG C  +  +KP  I+ C   + CP W +G     +C+ TC   G+      + C         N C   T+P  ++ C  P+C   W +++W  CS +CG  G + R+V C
Sbjct:  835 WSGCSVSCGVGEKTRSVTC-------RYNGTSISPTRCDRALRPSLTERCTQPPCPTQAFIYPETKWKAGPWSQCSQSCGDQGRRMRRVTCADSR---GVAVAERL-CDAPNRPATYERCNVKPC-TSWKHGAWGLCSK--SC-GKGVQSRIVKCAYENWKIAKDS--------QCDP-------FKRPPEQRECE----------------------LQKCEELALHVNKQATVLPTDPYRPLTPAHQPTWRTSAWGACSVTCGKGIRRRPVTCTRNGRTSNACVQDSRPADTEVCTNAACPTWIMGSWSKCSLTCGGGVQTRRIDC---------SSSLTKCDHRKKPVESRRCNT-----EACPATWREGPWSKCSVSCGRG--QRR--------RNVYCLPEGGNCDLR--VKPSEIQPCAK-KACPEWTVGR--WSECSVTC---GEGVVRRVVTCSAGG-----NRCQDDTKPEVVKLCELPDCP-SWLSQEWGECSVTCG-VGRRLRSVVC 1261          

HSP 2 Score: 62.7734 bits (151), Expect = 4.204e-10
Identity = 54/184 (29.35%), Postives = 88/184 (47.83%), Query Frame = 1
Query: 1318 QWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIG--EPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPIET--CHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPC 1857
            +WV   WS CS++CG  G +TR   C   +  +  + D   C   + +    + + V   +CP W     E  S+ C+ +C   G   +   ++C   + +   + C  + +P  T  C+   C   W+T  WS CS SCG  G K R+V+CR+ N  S + + C +A    P L ++C+ PPC
Sbjct:  715 RWVYTRWSQCSRTCG-SGIKTRRANCVDHKGDFLPDTD---CRPSDRL----LLQQVCEAECPKWRAADWEQASNLCSASC---GSGMQSRVVQCSVGSVIHPDSACPRAAKPTGTQRCNQQPCPA-WETRNWSGCSVSCG-VGEKTRSVTCRY-NGTSISPTRCDRA--LRPSLTERCTQPPC 882          

HSP 3 Score: 60.8474 bits (146), Expect = 1.436e-9
Identity = 52/182 (28.57%), Postives = 77/182 (42.31%), Query Frame = 1
Query:  262 WQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKP 807
            W+ S  W +CS  CG G++   + C       T    + + C  ++  R    + C    CPT       W +G W+ CS +CGG GV+TR + C  SL            C    +PV++ +C    CP  +    W KC+   +C   G RRR + C+             GNC +R KP
Sbjct: 1034 WRTS-AWGACSVTCGKGIRRRPVTC-------TRNGRTSNAC--VQDSRPADTEVCTNAACPT-------WIMGSWSKCSLTCGG-GVQTRRIDCSSSLTK----------CDHRKKPVESRRCNTEACPATWREGPWSKCSV--SCGR-GQRRRNVYCLPE----------GGNCDLRVKP 1174          

HSP 4 Score: 59.6918 bits (143), Expect = 3.576e-9
Identity = 58/198 (29.29%), Postives = 80/198 (40.40%), Query Frame = 1
Query: 1318 QWVVGPW----SICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTW----WIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQP--IETCHNPNCTLF--------WKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPC 1857
            +W    W    ++CS SCG  G Q+R V C +      I  D   C +  + KP   + C   Q CP W    W G      C+ +C   G   K   + C+Y    + P  CD + +P   E C  P C           WK   WS CS SCG+ G + R V+C      + A  LC       P   ++C+  PC
Sbjct:  770 KWRAADWEQASNLCSASCG-SGMQSRVVQCSVGS---VIHPDSA-CPR--AAKPTGTQRCNQ-QPCPAWETRNWSG------CSVSC---GVGEKTRSVTCRYNGTSISPTRCDRALRPSLTERCTQPPCPTQAFIYPETKWKAGPWSQCSQSCGDQGRRMRRVTCADSRGVAVAERLCDAPN--RPATYERCNVKPC 948          

HSP 5 Score: 54.299 bits (129), Expect = 1.833e-7
Identity = 47/179 (26.26%), Postives = 76/179 (42.46%), Query Frame = 1
Query:  271 SQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKP 807
            SQ W  CS  CG+G +   + C             + KC + R+P   T+  C +G C T       W+ G W+ CS +C G+G + R V C          +     C    +P  +  CG     P++   +W +C+  R C   GI  R++ C++      + S+P  +C   S+P
Sbjct: 1240 SQEWGECSVTCGVGRRLRSVVC-----------SIHGKCDKQRQPSSSTL--CNMGPCAT-------WQTGTWSQCSVTC-GKGTQVRTVTC---------SDKDTSACDLRTKPQSSTVCGTSQECPKWIIGNWSQCS--RTC-GIGITSREVQCIL-----GNNSLPYASCDSNSRP 1380          

HSP 6 Score: 51.2174 bits (121), Expect = 1.267e-6
Identity = 47/150 (31.33%), Postives = 69/150 (46.00%), Query Frame = 1
Query: 1318 QWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPIET--CHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSC 1761
            +W VG WS CS +CG G          ++ R       G +C  ++  KP+ ++ C L   CP+W   E    +C+ TC  VG+  +   + C    K      CD   QP  +  C+   C   W+T  WS CS +CG  G + RTV+C
Sbjct: 1187 EWTVGRWSECSVTCGEG----------VVRRVVTCSAGGNRC--QDDTKPEVVKLCEL-PDCPSWLSQE--WGECSVTC-GVGRRLRS--VVCSIHGK------CDKQRQPSSSTLCNMGPCAT-WQTGTWSQCSVTCGK-GTQVRTVTC 1310          

HSP 7 Score: 50.447 bits (119), Expect = 2.679e-6
Identity = 41/131 (31.30%), Postives = 54/131 (41.22%), Query Frame = 1
Query:  262 WQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPP 654
            WQ    WS CS  CG G Q   + C  K             C    KP+  T       VC T++     W +G W+ CS +C G G+ +R+VQCIL     G  +  +  C S   PV    C   +C P
Sbjct: 1287 WQTG-TWSQCSVTCGKGTQVRTVTCSDK---------DTSACDLRTKPQSST-------VCGTSQECPK-WIIGNWSQCSRTC-GIGITSREVQCIL-----GNNSLPYASCDSNSRPVIRRVCQLIECTP 1393          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO35202 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM44])

HSP 1 Score: 75.0998 bits (183), Expect = 4.803e-14
Identity = 65/229 (28.38%), Postives = 99/229 (43.23%), Query Frame = 1
Query:  133 TNEEFSLPFRLRSIMNMSIMFVRYALILGSLL-GFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGG--YMNAKHYDCKSEYEPVK-NEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKP 807
            TNE+  L         +S++    A+    L+ G    +    EW+    WS+CSKACG G QE  +ACV+K      +  +Y +       +    + C    C ++      W   EW+ CS +C G+G ++R V C    ++G   Y       C      V  N++C   DCPPE+  T W  CTK   C   G + R ++C +   NG    V   +C+   KP
Sbjct:  707 TNEQLGL-------FMVSVIGSNKAVTWTYLIPGNSSVSSSDVEWKTG-AWSACSKACGTGSQERDVACVRK------DDKTYVRESLCAGSKPAANQECETAKCVSS------WYTTEWSPCSATC-GKGTQSRSVICRRETFTGSKQYETLPDASCTGSKPTVTLNQECNKVDCPPEWMPTEWSACTK--TCAG-GRQSRTLSCKLKDLNGAYHEVADYHCHNAIKP 911          

HSP 2 Score: 52.7582 bits (125), Expect = 4.566e-7
Identity = 48/164 (29.27%), Postives = 76/164 (46.34%), Query Frame = 1
Query: 1318 QWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKV------LLPNNCDLSTQPIET----CHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDN 1779
            +W  G WS CSK+CG G  Q R V C   + + ++     + L   S KP   +EC    KC + W    +S  C+ TC   GK  +   + C+ E          LP+     ++P  T    C+  +C   W   +WS C+ +C   G ++RT+SC+ ++ N
Sbjct:  743 EWKTGAWSACSKACGTGS-QERDVACVRKDDKTYVR----ESLCAGS-KPAANQECET-AKCVSSWYTTEWS-PCSATC---GKGTQSRSVICRRETFTGSKQYETLPDASCTGSKPTVTLNQECNKVDCPPEWMPTEWSACTKTCAG-GRQSRTLSCKLKDLN 894          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO32300 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVH8])

HSP 1 Score: 61.2326 bits (147), Expect = 2.254e-11
Identity = 40/110 (36.36%), Postives = 51/110 (46.36%), Query Frame = 1
Query:  217 GSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQC 546
            G+    C  T  K  W  S  W  CSK CG GVQ     CV +       ++S  KC R+  PR K  + C +  CP        W +G W+ CS SC GEG+R R + C
Sbjct:   30 GTHRRVCNVTPCKHRWYTSP-WRPCSKTCGTGVQHRFRRCVNR----HNRRISLWKCARLTPPRRK--RACAIVDCPVE------WNIGPWSKCSVSC-GEGIRRRSIAC 125          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO35222 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM43])

HSP 1 Score: 66.6254 bits (161), Expect = 2.294e-11
Identity = 43/143 (30.07%), Postives = 61/143 (42.66%), Query Frame = 1
Query:  259 EWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPR-EKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGY-FDCPPEFFTTSWLK 681
            EW  +  W  CSK CG G Q+  + C +K  I TYE    ++C+   KP+  + M+ C    CP        W    W+ CS +CG +GV  R + C     +G Y       CK   +P   E C    +CP      +  K
Sbjct:  854 EWHETG-WRPCSKTCGKGSQQRHVVCRRKVAIATYETRPDEECKEDDKPQLSQLMRPCNELDCPAE------WVPSSWSECSATCGPDGVTVRTLSCKRLNQNGVYEPVHKIQCKHAVQPSTQEACNQDVNCPMALIAANGKK 989          

HSP 2 Score: 65.0846 bits (157), Expect = 6.861e-11
Identity = 55/201 (27.36%), Postives = 90/201 (44.78%), Query Frame = 1
Query:  244 TRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNE---KCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKD 837
            T    EW     WS+C++ C  G Q   + C ++T   T+  VS D C+ ++  +  T + C    C +       W    W  CS +CG +G + R V C   +    Y      +CK + +P  ++    C   DCP E+  +SW +C+    C   G+  R ++C    +NG  + V K  C   +  P+T E+C +D
Sbjct:  790 TADDVEWTEGS-WSTCTEPCATGYQSRTVEC-RRTDDKTW--VSDDVCK-LKSGKPDTERKCNEQPCASE------WHETGWRPCSKTCG-KGSQQRHVVCRRKVAIATYETRPDEECKEDDKPQLSQLMRPCNELDCPAEWVPSSWSECSA--TCGPDGVTVRTLSCKRLNQNGVYEPVHKIQCK-HAVQPSTQEACNQD 975          

HSP 3 Score: 63.1586 bits (152), Expect = 2.519e-10
Identity = 51/191 (26.70%), Postives = 81/191 (42.41%), Query Frame = 1
Query: 1264 IVEGKNNSAIKY---------IKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLL-----PNNCDLSTQP-----IETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDN 1779
            + +G  N  + Y         +     +W  G WS C++ C  G YQ+R V C   + + ++  D     K  S KPD  R+C   Q C + W  E     C++TC   GK  +   + C+ +  +          C    +P     +  C+  +C   W    WS CS++CG  G+  RT+SC+  N N
Sbjct:  768 VSDGSKNPGVDYSFYSPSPSKVTADDVEWTEGSWSTCTEPCATG-YQSRTVECRRTDDKTWVSDD---VCKLKSGKPDTERKCN-EQPCASEW-HETGWRPCSKTC---GKGSQQRHVVCRRKVAIATYETRPDEECKEDDKPQLSQLMRPCNELDCPAEWVPSSWSECSATCGPDGVTVRTLSCKRLNQN 949          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO36399 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIR2])

HSP 1 Score: 63.1586 bits (152), Expect = 1.245e-10
Identity = 57/198 (28.79%), Postives = 88/198 (44.44%), Query Frame = 1
Query:  235 CGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESC 828
            C P   K  W     ++SCS  CG GV+E L+ C ++      + +   +C    +PR  + + C    C      +  W   EW+ CS +CG +G +TR V C   + +  +     Y+C+   +P     C   +C PE+F TSW KC+        G + R + C+    N   K V  G C + SK P  W+ C
Sbjct:  155 CNPGGCKTHWFIGSSFTSCSVTCGYGVKERLVFCGRQG----GDALPDSQCESRYRPR--STQRCREKRC------QASWVTSEWSKCSANCG-QGKQTRIVFCTNEVRNV-HQQVPIYNCRHSPQPESERNCTIKECAPEWFVTSWQKCSTT---CGGGSQHRIVMCL----NDQGKRV--GGCEV-SKKPLHWQRC 328          

HSP 2 Score: 56.225 bits (134), Expect = 2.064e-8
Identity = 49/151 (32.45%), Postives = 71/151 (47.02%), Query Frame = 1
Query: 1318 QWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNN-CDLSTQPIET--CHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSC 1761
            +W  GPW  CS +CG G  +TR V C  +E+   I  +   C +K   KP   R C        W+IG  ++  C+ TC   G   K+  + C  +    LP++ C+   +P  T  C    C   W T +WS CS++CG  G + R V C
Sbjct:  105 EWKTGPWRQCSVTCGTG-IETRTVECMDVEQN--ITQEESACAEK--PKPHTTRRCNPGGCKTHWFIGSSFTS-CSVTC---GYGVKERLVFCGRQGGDALPDSQCESRYRPRSTQRCREKRCQASWVTSEWSKCSANCGQ-GKQTRIVFC 245          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000040589.1 (A disintegrin and metalloproteinase with thrombospondin motifs 2 [Source:NCBI gene;Acc:101157151])

HSP 1 Score: 77.0258 bits (188), Expect = 4.072e-14
Identity = 78/294 (26.53%), Postives = 134/294 (45.58%), Query Frame = 1
Query: 1120 IIKKFSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKC--PTWWIGEPYSHKCTETCLDVGKSFKDLKLKCK----YENKVLLPNNC-DLSTQPIETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCN-LGCM-DLSKHCGLRKL---CSVDHYQHFCCKTCNYK*NA 1965
            ++ +++   E + I  +G +   + ++ +  S G S       Y  ++ +    +S +    P+FY+W +  WS CSK CG G   TR+ GC    RR    +   +    N  KP  I      + C  P W  G+    +C+ +C   G   + +  + K     E + +    C D+  +  +TC+   C   W+T  W+ CS SCGN G + R V+C   N     G+ CS+ +   P+  ++C  PPC+   C  D S  C +  L   C++  Y+  CCK+C+ + +A
Sbjct:  790 VLWEYNITAEKETILSSGPLKYRVLLMVR--SHGDSKVTVSYKYIIQNQLWSSLDSNLVQEDPIFYEWALKKWSHCSKPCGGGKQYTRF-GC----RRKADGLMVQRMFCSNISKPRAIGRTCNTESCQPPRWVTGD--WGECSASCGQTGWRRRLVSCQQKSSRGQEQRSVQSKLCRDVQPESKQTCNRIPCPAAWRTGPWTACSVSCGN-GTQERQVAC--LNPEGSPGN-CSEPE---PITWQRCETPPCSGQRCRGDRSAFCRMEVLSRYCAISGYRQMCCKSCSERNSA 1067          

HSP 2 Score: 61.6178 bits (148), Expect = 2.428e-9
Identity = 58/203 (28.57%), Postives = 82/203 (40.39%), Query Frame = 1
Query:  256 FEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKP-PATWESCFKDPEYQSKCQ 861
            +EW   + WS CSK CG G Q     C +K      +++    C  I KPR    +TC    C         W  G+W  CS SCG  G R R V C      G    +       + +P   + C    CP  + T  W  C+   +C + G + RQ+ C+       +     GNC   S+P P TW+ C   P    +C+
Sbjct:  853 YEWALKK-WSHCSKPCGGGKQYTRFGCRRKADGLMVQRMF---CSNISKPR-AIGRTCNTESCQPPR-----WVTGDWGECSASCGQTGWRRRLVSCQQKSSRGQEQRSVQSKLCRDVQPESKQTCNRIPCPAAWRTGPWTACSV--SCGN-GTQERQVACL-------NPEGSPGNC---SEPEPITWQRCETPPCSGQRCR 1032          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000034543.1 (pep primary_assembly:ASM223467v1:18:11549707:11555570:-1 gene:ENSORLG00000021989.1 transcript:ENSORLT00000034543.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.3218 bits (168), Expect = 5.132e-13
Identity = 44/149 (29.53%), Postives = 63/149 (42.28%), Query Frame = 1
Query:  235 CGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLK 681
            C  T G   W+  + WSSCS  CG+G+    +AC  +    +   V   +      P+   ++ C    CP       +W +  W  CS SC G GV+ R V C   L  G  M      C S   P   ++C   DCP ++ TT W+ 
Sbjct:   49 CNETSGSHRWKTGE-WSSCSATCGVGLMTRAVACTHRPFADSNRTVILGE-GDCHLPKPSPVQACNRFDCPP------LWDLHPWGQCSQSCAG-GVQRRRVLCKQRLADGSVMELPDSFCPSRRPP-SQQQCEKQDCPAQWITTDWVD 187          

HSP 2 Score: 60.077 bits (144), Expect = 7.108e-10
Identity = 41/124 (33.06%), Postives = 60/124 (48.39%), Query Frame = 1
Query:  445 PTNETS-EFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNA--KHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKP 807
            P NETS    WK GEW+SCS +C G G+ TR V C    ++           DC    +P   + C  FDCPP +    W +C++  +C   G++RR++ C     +G+   +P   C  R  P
Sbjct:   48 PCNETSGSHRWKTGEWSSCSATC-GVGLMTRAVACTHRPFADSNRTVILGEGDCHLP-KPSPVQACNRFDCPPLWDLHPWGQCSQ--SCAG-GVQRRRVLCKQRLADGSVMELPDSFCPSRRPP 166          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: adamts16 (ADAM metallopeptidase with thrombospondin type 1 motif 16 [Source:NCBI gene;Acc:101162868])

HSP 1 Score: 71.2478 bits (173), Expect = 2.599e-12
Identity = 55/197 (27.92%), Postives = 89/197 (45.18%), Query Frame = 1
Query:  241 PTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCF 831
            P++  + W   Q  S C+  C  G      +C +   +    +V+   C    KP    M  C    CP +      W VGEW  CS SCGG G +TR VQC+        ++A+     ++  PV+ + C    CPP + T  W +C+    C + G+++R + C+    +  ++++P   C    KPP+  E CF
Sbjct:  929 PSKHNYSWAVVQ--SLCTVTCAGGRMSTNASCYKDMRV----QVNTSYCNPKMKPATGVMP-CNTQPCPHS------WSVGEWGVCSRSCGG-GEQTRQVQCVQRTNQNN-VDARADSGCAQPAPVRRQTCNTHSCPPVWSTGPWSQCS--HKCGN-GLKKRTVLCVSPKADAQTRTLPDSKCAGLQKPPSQ-EPCF 1106          

HSP 2 Score: 58.151 bits (139), Expect = 3.040e-8
Identity = 46/180 (25.56%), Postives = 70/180 (38.89%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPP----EFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKP 807
            W  CS++CG G Q   + CVQ+T     +  +   C    +P     +TC    CP       +W  G W+ CS  C G G++ R V C+               C    +P   E C    C      ++F ++W +C+    C   G + R I C      G  + +P   C+   KP
Sbjct:  998 WGVCSRSCGGGEQTRQVQCVQRTNQNNVDARADSGC---AQPAPVRRQTCNTHSCPP------VWSTGPWSQCSHKC-GNGLKKRTVLCVSPKADAQTRTLPDSKCAGLQKPPSQEPCFIKRCQKQRKVQWFVSTWQECSA--KC-GQGYQARFIKCAEKDTAGKYRELPAKKCHHVPKP 1164          

HSP 3 Score: 55.0694 bits (131), Expect = 2.794e-7
Identity = 42/158 (26.58%), Postives = 62/158 (39.24%), Query Frame = 1
Query:  253 KFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFI--------------------WKVGEWTSCSTSCGGEGVRTRDVQCILS--LYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCP-PE 657
            K +W  S  W  CS  CG G Q   + C +K   G Y ++   KC  + KP     + C +  C ++ T                        W+   W+ C+ +CGG GV++R V C +   L SG         C    +P  ++ C    CP PE
Sbjct: 1115 KVQWFVS-TWQECSAKCGQGYQARFIKCAEKDTAGKYRELPAKKCHHVPKPTVDLQRPCIVAECRSHTTPAVHQWVTPLRTYPPQPLPHSPPEWQSSPWSHCTVTCGG-GVQSRTVYCQVQGKLSSG---------CAPHLKPPMSQACNTNFCPQPE 1261          

HSP 4 Score: 50.447 bits (119), Expect = 7.072e-6
Identity = 51/186 (27.42%), Postives = 77/186 (41.40%), Query Frame = 1
Query: 1303 KPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNI-RECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKC-----KYENKVLLPNNCDLSTQP--IETCHNPNCT----LFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMP 1824
            +P  + W VG W +CS+SCG GG QTR V C  ++R     VD          +P  + R+      CP  W   P+S +C+  C   G   K   + C       + + L  + C    +P   E C    C     + W    W  CS+ CG  G +AR + C  ++   +   L +K    +P
Sbjct:  987 QPCPHSWSVGEWGVCSRSCG-GGEQTRQVQC--VQRTNQNNVDARA--DSGCAQPAPVRRQTCNTHSCPPVWSTGPWS-QCSHKC---GNGLKKRTVLCVSPKADAQTRTLPDSKCAGLQKPPSQEPCFIKRCQKQRKVQWFVSTWQECSAKCGQ-GYQARFIKCAEKDTAGKYRELPAKKCHHVP 1162          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: adamts16 (ADAM metallopeptidase with thrombospondin type 1 motif 16 [Source:NCBI gene;Acc:101162868])

HSP 1 Score: 70.8626 bits (172), Expect = 3.235e-12
Identity = 55/197 (27.92%), Postives = 89/197 (45.18%), Query Frame = 1
Query:  241 PTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCF 831
            P++  + W   Q  S C+  C  G      +C +   +    +V+   C    KP    M  C    CP +      W VGEW  CS SCGG G +TR VQC+        ++A+     ++  PV+ + C    CPP + T  W +C+    C + G+++R + C+    +  ++++P   C    KPP+  E CF
Sbjct:  953 PSKHNYSWAVVQ--SLCTVTCAGGRMSTNASCYKDMRV----QVNTSYCNPKMKPATGVMP-CNTQPCPHS------WSVGEWGVCSRSCGG-GEQTRQVQCVQRTNQNN-VDARADSGCAQPAPVRRQTCNTHSCPPVWSTGPWSQCS--HKCGN-GLKKRTVLCVSPKADAQTRTLPDSKCAGLQKPPSQ-EPCF 1130          

HSP 2 Score: 57.7658 bits (138), Expect = 3.528e-8
Identity = 46/180 (25.56%), Postives = 70/180 (38.89%), Query Frame = 1
Query:  280 WSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPP----EFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKP 807
            W  CS++CG G Q   + CVQ+T     +  +   C    +P     +TC    CP       +W  G W+ CS  C G G++ R V C+               C    +P   E C    C      ++F ++W +C+    C   G + R I C      G  + +P   C+   KP
Sbjct: 1022 WGVCSRSCGGGEQTRQVQCVQRTNQNNVDARADSGC---AQPAPVRRQTCNTHSCPP------VWSTGPWSQCSHKC-GNGLKKRTVLCVSPKADAQTRTLPDSKCAGLQKPPSQEPCFIKRCQKQRKVQWFVSTWQECSA--KC-GQGYQARFIKCAEKDTAGKYRELPAKKCHHVPKP 1188          

HSP 3 Score: 54.6842 bits (130), Expect = 3.133e-7
Identity = 42/158 (26.58%), Postives = 62/158 (39.24%), Query Frame = 1
Query:  253 KFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFI--------------------WKVGEWTSCSTSCGGEGVRTRDVQCILS--LYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCP-PE 657
            K +W  S  W  CS  CG G Q   + C +K   G Y ++   KC  + KP     + C +  C ++ T                        W+   W+ C+ +CGG GV++R V C +   L SG         C    +P  ++ C    CP PE
Sbjct: 1139 KVQWFVS-TWQECSAKCGQGYQARFIKCAEKDTAGKYRELPAKKCHHVPKPTVDLQRPCIVAECRSHTTPAVHQWVTPLRTYPPQPLPHSPPEWQSSPWSHCTVTCGG-GVQSRTVYCQVQGKLSSG---------CAPHLKPPMSQACNTNFCPQPE 1285          

HSP 4 Score: 50.0618 bits (118), Expect = 8.412e-6
Identity = 51/186 (27.42%), Postives = 77/186 (41.40%), Query Frame = 1
Query: 1303 KPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNI-RECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKC-----KYENKVLLPNNCDLSTQP--IETCHNPNCT----LFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMP 1824
            +P  + W VG W +CS+SCG GG QTR V C  ++R     VD          +P  + R+      CP  W   P+S +C+  C   G   K   + C       + + L  + C    +P   E C    C     + W    W  CS+ CG  G +AR + C  ++   +   L +K    +P
Sbjct: 1011 QPCPHSWSVGEWGVCSRSCG-GGEQTRQVQC--VQRTNQNNVDARA--DSGCAQPAPVRRQTCNTHSCPPVWSTGPWS-QCSHKC---GNGLKKRTVLCVSPKADAQTRTLPDSKCAGLQKPPSQEPCFIKRCQKQRKVQWFVSTWQECSAKCGQ-GYQARFIKCAEKDTAGKYRELPAKKCHHVP 1186          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: adamts6 (ADAM metallopeptidase with thrombospondin type 1 motif 6 [Source:NCBI gene;Acc:101172594])

HSP 1 Score: 70.0922 bits (170), Expect = 5.145e-12
Identity = 65/233 (27.90%), Postives = 93/233 (39.91%), Query Frame = 1
Query:  115 LESLYITNEEFSLPFRLRSIMNMSIMFVRYALILGSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPA 813
            LE+L  T E   +   L+   N+ I   RY  I+       G     F W     WS CS  C  G Q+  + C +         V    C    KP E   + C    CP        W +G+W+ C  +C G G+RTR V C   +        K   C + + P++ E C    CPP++ T  W +CT    C  PG + R   C  +     +K+ P  +C   +KPP 
Sbjct:  804 LEALGPTTENLVVMVLLQE-QNLGI---RYRFIVPIQRTGSGDNEVGFAWHYLP-WSECSATCAGGTQKQEVLCKR---FDDNSVVQNSYCDSDSKPPEN-QRDCNTEPCPPE------WFIGDWSECGKTCDG-GIRTRTVLCTRKIGPAEEETMKDSHCLT-HRPIERETCNNQSCPPKWVTLEWSECTP--KC-GPGFKHRIALCKSSD---MTKTFPPSHCPSHNKPPV 1013          

HSP 2 Score: 60.4622 bits (145), Expect = 5.552e-9
Identity = 62/206 (30.10%), Postives = 97/206 (47.09%), Query Frame = 1
Query: 1315 YQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKY---ENKVLLPNNCDLSTQPIE--TCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRN-DNSQAGSLC---SKAKIRMPLLIKKCSAP---PCNLGCMDLSKHCGL 1896
            + W   PWS CS +C  GG Q + V C+  +    ++         +S  P+N R+C      P W+IG+    +C +TC D G   + +    K    E + +  ++C L+ +PIE  TC+N +C   W T +WS C+  CG PG K R   C+  +   +   S C   +K  +R+   + +C  P   P + G    S HCGL
Sbjct:  847 FAWHYLPWSECSATCA-GGTQKQEVLCKRFDDNSVVQ---NSYCDSDSKPPENQRDCNTEPCPPEWFIGD--WSECGKTC-DGGIRTRTVLCTRKIGPAEEETMKDSHC-LTHRPIERETCNNQSCPPKWVTLEWSECTPKCG-PGFKHRIALCKSSDMTKTFPPSHCPSHNKPPVRIRCSLGRCPPPRWIPGDWG--QCSAHCGL 1041          

HSP 3 Score: 56.9954 bits (136), Expect = 6.906e-8
Identity = 69/234 (29.49%), Postives = 101/234 (43.16%), Query Frame = 1
Query: 1303 KPLFYQWVVGPWSICSKSCGIGGYQTRYVGC-ELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYEN--KVLLPNNCDLSTQP-------IETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKA--KIRMPLLIKKCSAPPCNLG--CMDLSK--HCGLR---KLCSVDHYQHFCCKTC 1947
            +P   +W +G WS C K+C  GG +TR V C   I       +    CL    ++    RE    Q CP  W+   +S +CT  C   G  FK     CK  +  K   P++C    +P       +  C  P     W    W  CS+ CG  G + RTV+C   +   Q  + C ++     M     KC++ P + G  C D++K  +C L    K CS  +++  CCKTC
Sbjct:  902 EPCPPEWFIGDWSECGKTCD-GGIRTRTVLCTRKIGPAEEETMKDSHCLTHRPIE----RETCNNQSCPPKWVTLEWS-ECTPKC---GPGFKHRIALCKSSDMTKTFPPSHCPSHNKPPVRIRCSLGRCPPPR----WIPGDWGQCSAHCG-LGQQMRTVTCL--SYTGQLSNECPESLRPATMQQCESKCNSTPISNGDECKDVNKVAYCPLVLKFKFCSRAYFRQMCCKTC 1119          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000002617.1 (SMESG000002617.1)

HSP 1 Score: 1177.93 bits (3046), Expect = 0.000e+0
Identity = 593/594 (99.83%), Postives = 594/594 (100.00%), Query Frame = 1
Query:  175 MNMSIMFVRYALILGSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPIETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKHCGLRKLCSVDHYQHFCCKTCNYK 1956
            MNMSIMFVRYALILGSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFKDKKKKRKPPIISISKLKIHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPIETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKHCGL+KLCSVDHYQHFCCKTCNYK
Sbjct:    1 MNMSIMFVRYALILGSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFKDKKKKRKPPIISISKLKIHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPIETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKHCGLKKLCSVDHYQHFCCKTCNYK 594          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000002617.1 (SMESG000002617.1)

HSP 1 Score: 1061.98 bits (2745), Expect = 0.000e+0
Identity = 540/546 (98.90%), Postives = 540/546 (98.90%), Query Frame = 1
Query:  100 MNAIQLESLYITNEEFSLPFRLRSIMNMSIMFVRYALILGSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPIETCHNPNCTLFWKTEKWSTCSSSCGNPG 1737
            MNAIQLESLYITNEEFSLPF LRSIMNMSIMFVRYALILGSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFKDKKKKRKPPIISISKLKIHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPIETCHNPNCTLFWKTEKWST   S GN G
Sbjct:    1 MNAIQLESLYITNEEFSLPFHLRSIMNMSIMFVRYALILGSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQSKCQFKDKKKKRKPPIISISKLKIHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPIETCHNPNCTLFWKTEKWSTLWKS-GNKG 545          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000068292.1 (SMESG000068292.1)

HSP 1 Score: 359.762 bits (922), Expect = 8.266e-116
Identity = 206/603 (34.16%), Postives = 322/603 (53.40%), Query Frame = 1
Query:  172 IMNMSIMFVRYALILGSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCY-IRSKPPATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSC----GIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPIETCHNPNCTLFWKTEKWSTCSSSCG---NPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKHC--GLRKLCSVDHYQHFCCKTCN 1950
            ++ ++ +     + L  LL F   T   F W  +  W+ CSK C  G +     C+++T   TYE  + +KC+  + P  K  + CFLG CP N T  F+W+VG W+SC  +CGG+G + RDV CI+    G ++++K   C +++EP +   CG+ DCPP+F T+ W KC++  +C+ P IRRR + C+    +G  K    G CY +  +PP++W  C            K+ KK+     I     +IH MR +K+LK+ VGQTA+VL  TR+ I CP+       ++W   N TY +   ++ERI V+RKG L+I++F   D G+WICKAG  TA+  +  + PS GF ++L R       ++  ++N    +I+P    W+   WS CS +C       GYQTR V CE IE +Y+  ++   C     +KP  I++C  F++CP W + +  + +C++ C+++G +     + C++ N+ +  + CD    P  TC N  C + +    WS CS SC    N  I++RT+ C W++ N  A +LC   ++    L K C  P C LGC DL+  C    +  C    + HFCC  CN
Sbjct:    1 MLLLNFLTSVSVITLSGLLSFGTST---FMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYP--KKTRPCFLGRCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDNKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCR-PSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPSSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQPSTGFDNWLKRHANHNYGMLNEESN--FSFIRPESIIWIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKIIEDKFCP---PLKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGLARTSTNIVCQFNNRTVDSSLCDSQKLPNITCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSLTKPCRVPKCILGCKDLTPACVKQSKYRCRSSLFNHFCCAFCN 592          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000073134.1 (SMESG000073134.1)

HSP 1 Score: 342.428 bits (877), Expect = 3.447e-109
Identity = 207/598 (34.62%), Postives = 314/598 (52.51%), Query Frame = 1
Query:  169 SIMNMSIMFVRYALILGSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLK-CTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRS-KPPATWESCFK--DPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPIETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKHCGLRK-LCSVDHYQHFCCKTC 1947
            S   + I+ + +A+ L           GK   +   +WS CS  CG GVQE   AC +KT +   E +  DKC  I K +  T + C  G C       ++WK  +W+ CS +CG EG++ R+V+C  S  SG  ++ +   C    +P     C  ++CPP F    W K C K+ +C SPG +RR ++C+     G    +P+  CY +   PPA+W  CF   DP+   KC     KK    P I   K  +  MR  +KL L VGQ ++V P TR+ + CPV NF S NL W    I Y +  ++K RI V+RKG LIIK F  +D+G+W C AG I+  I I +++PSDG+  +  R     +D+        +  ++    +WV+G WS CS SC   G+Q+R V CE +++R++ ++   +C+++ + KP   REC     CP W       ++CT+ C+   K+     LKC ++N+ +    CD + +P+  C+N  C + WK  +W+ CS +CG  GI+AR + C W N    AG+LC    + +P ++K C+ P CNL C+D+   C  +K  C +  Y   CCKTC
Sbjct:    3 SFGGILIIILNFAICLFDGQSIGNRPIGKVFLEEIDIWSKCSTTCGEGVQEKFQACFKKT-VYLIENIPMDKCEHIPKIKV-TTRVCNYGDCENG----YVWKFTDWSKCSHTCGYEGIQLREVECYHS--SGQVVDQEM--CDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDC-SPGQQRRDLSCLSLLNTGKVVDLPRAACYAKGLVPPASWRQCFDHIDPK---KC----FKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWAHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDM--PNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLKCVDMHPSCKRKKEYCRMGIYSFSCCKTC 580          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000042318.1 (SMESG000042318.1)

HSP 1 Score: 340.887 bits (873), Expect = 1.433e-108
Identity = 201/591 (34.01%), Postives = 305/591 (51.61%), Query Frame = 1
Query:  181 MSIMFVRYALILGSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPP-ATWESCFKDPEYQSKCQFXXXXXXXXXXXXXXXXXXXHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPIETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKHCGLR-KLCSVDHYQHFCCKTC 1947
            + I+F+ +A+I  SL  F   T   + WQ+S  WS CS  CG G Q     C  K +  T  K S  +C R+ K     ++ C+   CP     ++ WK   W+ CS SCG  G R RDV+C  ++     +    + C    +P++   C   DCPPEF T  W KC K + C  PG ++R++NC    ++G  K +P   CY + +PP A W  C+ D     KC    K    +    ++S    + MR +K ++L +GQ A++LP++RI I CPV NFP  N+ W   N T+ +  R  +RI V R G + I+K   +D+G+W C A        I  +NPS GF  +  R   +K  ++   +N  I   +    QW+   WS+CS +C   G Q R V CE +E R+++ +D   C +K +  P+ +R C    +CP W +      KCT  C+D+  S   ++LKC Y N+ +  + C+   +P  TC N  C L W+   WS CS SC   G +AR+++C W++    AGSLC + K  +P ++++C   PCN+ C+DLS  C    K C  + Y++ CC TC
Sbjct:    5 IPIVFLGFAIIQSSLNEF---TENIYLWQDSGEWSPCSVTCGEGKQTKEKFCAIK-VNSTVIKTSKHRCSRL-KASHTLIRFCYQTECP----EKYRWKTSSWSQCSHSCGNLGFRFRDVECSHNISETNSIGVAEFFCAKFIKPMQRSLCNRVDCPPEFVTGKWGKCVKGQGCH-PGNQKRKLNCSQILQSGEIKQMPLFRCYTKKRPPPAQWRKCY-DFINIPKC---LKGIPPRKVEFTMSNNNFYQMRRAKIVQLQIGQIAYLLPYSRIIITCPVENFPQHNIIWTHKNDTFKYNGRVSKRIRVDRIGQIRIRKLLFQDQGEWNCIADRSQKSAIIKIRNPSSGFRDWAVRNNLWKTGMLSEDSNKPIN--RQELVQWITSDWSVCSVTCSGDGLQYREVHCEKVEPRFYLVLDDNDC-EKVTPAPNKMRNCYTAIECPLWKVERIDKSKCTNECVDIRLSSVLVELKCIYMNQDVPLHLCEQKKKPEITCQNEACHLDWRLNSWSKCSKSCDGVGFQARSIACVWKSTRKSAGSLCYENKFPLPKVVRECETKPCNMKCIDLSTKCSSEPKRCHQNLYKYLCCYTC 578          
The following BLAST results are available for this feature:
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADAMTSL32.353e-1926.64ADAMTS like 3 [Source:HGNC Symbol;Acc:HGNC:14633][more]
ADAMTSL32.418e-1926.64ADAMTS like 3 [Source:HGNC Symbol;Acc:HGNC:14633][more]
ADAMTSL12.621e-1927.18ADAMTS like 1 [Source:HGNC Symbol;Acc:HGNC:14632][more]
ADAMTSL17.113e-1721.86ADAMTS like 1 [Source:HGNC Symbol;Acc:HGNC:14632][more]
ADAMTS62.059e-1430.04ADAM metallopeptidase with thrombospondin type 1 m... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
madd-45.110e-4725.83pep chromosome:WBcel235:I:8931035:8937718:-1 gene:... [more]
madd-44.402e-4625.83pep chromosome:WBcel235:I:8931035:8942287:-1 gene:... [more]
madd-45.420e-4626.15pep chromosome:WBcel235:I:8931035:8942287:-1 gene:... [more]
mig-64.087e-926.49Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840][more]
mig-64.087e-926.49Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840][more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nolo1.527e-1830.00gene:FBgn0051619 transcript:FBtr0339131[more]
nolo1.637e-1830.00gene:FBgn0051619 transcript:FBtr0339132[more]
nolo1.683e-1830.00gene:FBgn0051619 transcript:FBtr0085901[more]
nolo1.774e-1830.00gene:FBgn0051619 transcript:FBtr0301000[more]
nolo1.878e-1830.00gene:FBgn0051619 transcript:FBtr0085902[more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adamtsl35.574e-2229.25ADAMTS-like 3 [Source:ZFIN;Acc:ZDB-GENE-121030-8][more]
adamts141.206e-1333.54ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts35.658e-1328.74ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts61.070e-1226.81ADAM metallopeptidase with thrombospondin type 1 m... [more]
ADAMTS71.595e-1231.11ADAM metallopeptidase with thrombospondin type 1 m... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vash13.789e-2128.52vasohibin 1 [Source:Xenbase;Acc:XB-GENE-956494][more]
vash15.072e-2126.64vasohibin 1 [Source:Xenbase;Acc:XB-GENE-956494][more]
ADAMTSL12.409e-1928.20ADAMTS like 1 [Source:NCBI gene;Acc:100494603][more]
ADAMTSL12.959e-1928.20ADAMTS like 1 [Source:NCBI gene;Acc:100494603][more]
ADAMTSL13.262e-1928.20ADAMTS like 1 [Source:NCBI gene;Acc:100494603][more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adamtsl13.565e-2125.84ADAMTS-like 1 [Source:MGI Symbol;Acc:MGI:1924989][more]
Adamtsl11.992e-2026.80ADAMTS-like 1 [Source:MGI Symbol;Acc:MGI:1924989][more]
Adamtsl33.248e-1825.41ADAMTS-like 3 [Source:MGI Symbol;Acc:MGI:3028499][more]
Adamts62.908e-1430.04a disintegrin-like and metallopeptidase (reprolysi... [more]
Adamts62.908e-1430.04a disintegrin-like and metallopeptidase (reprolysi... [more]
back to top
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P90884|MADD4_CAEEL5.600e-4525.83Protein madd-4 OS=Caenorhabditis elegans OX=6239 G... [more]
sp|Q8BLI0|ATL1_MOUSE2.494e-2025.84ADAMTS-like protein 1 OS=Mus musculus OX=10090 GN=... [more]
sp|P82987|ATL3_HUMAN1.161e-1826.64ADAMTS-like protein 3 OS=Homo sapiens OX=9606 GN=A... [more]
sp|Q8N6G6|ATL1_HUMAN1.259e-1827.18ADAMTS-like protein 1 OS=Homo sapiens OX=9606 GN=A... [more]
sp|Q9UKP5|ATS6_HUMAN9.887e-1430.04A disintegrin and metalloproteinase with thrombosp... [more]
back to top
BLAST of Ig-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183JCE11.372e-10935.25Ig-like domain-containing protein OS=Schistosoma c... [more]
A0A094ZL011.777e-10935.08ADAMTS-like protein 3 OS=Schistosoma haematobium O... [more]
A0A430QEZ92.061e-10734.78Uncharacterized protein OS=Schistosoma bovis OX=61... [more]
A0A4Z2DGQ14.914e-10334.59Protein madd-4 isoform 2 OS=Schistosoma japonicum ... [more]
A0A183LQA11.165e-10234.53Ig-like domain-containing protein OS=Schistosoma m... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adamtsl32.261e-1826.22ADAMTS-like protein 3 [Source:NCBI gene;Acc:103028... [more]
ENSAMXT00000039281.14.244e-1625.66pep primary_assembly:Astyanax_mexicanus-2.0:16:258... [more]
adamts141.718e-1426.33ADAM metallopeptidase with thrombospondin type 1 m... [more]
ENSAMXT00000037051.12.932e-1426.64pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
adamts147.325e-1331.58ADAM metallopeptidase with thrombospondin type 1 m... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adamtsl31.800e-1925.24ADAMTS-like 3 [Source:ZFIN;Acc:ZDB-GENE-121030-8][more]
ENSPMAT00000000756.14.730e-1624.53pep scaffold:Pmarinus_7.0:GL477404:44246:61450:-1 ... [more]
ENSPMAT00000000757.17.296e-1227.92pep scaffold:Pmarinus_7.0:GL477404:45077:62293:-1 ... [more]
adamts173.092e-1130.11ADAM metallopeptidase with thrombospondin type 1 m... [more]
ADAMTS73.887e-1130.32ADAM metallopeptidase with thrombospondin type 1 m... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO443761.255e-1424.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352024.803e-1428.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO323002.254e-1136.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352222.294e-1130.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363991.245e-1028.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000040589.14.072e-1426.53A disintegrin and metalloproteinase with thrombosp... [more]
ENSORLT00000034543.15.132e-1329.53pep primary_assembly:ASM223467v1:18:11549707:11555... [more]
adamts162.599e-1227.92ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts163.235e-1227.92ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts65.145e-1227.90ADAM metallopeptidase with thrombospondin type 1 m... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002617.10.000e+099.83SMESG000002617.1[more]
SMESG000002617.10.000e+098.90SMESG000002617.1[more]
SMESG000068292.18.266e-11634.16SMESG000068292.1[more]
SMESG000073134.13.447e-10934.62SMESG000073134.1[more]
SMESG000042318.11.433e-10834.01SMESG000042318.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019505 ID=SMED30019505|Name=Ig-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1983bp
CTGTGACCGTATTTTATCTGTTATTGACAATTGCATTGAAATGATGCCAT
TAACGTGAACCTGGACCAGTCTCCGTGAACAATACAACTGAATTTAATAA
TGAATGCCATTCAGTTAGAAAGTCTGTATATAACAAATGAAGAATTTTCA
CTACCATTTCGTTTAAGGTCTATCATGAATATGTCTATTATGTTTGTGAG
ATATGCTCTCATTTTGGGATCTCTGCTAGGATTTTGTGGACCAACTCGGG
GAAAGTTTGAATGGCAGAACAGCCAGTTGTGGAGTTCATGTTCAAAGGCA
TGCGGAATAGGAGTTCAAGAAAATCTATTGGCCTGCGTCCAGAAGACCCT
TATTGGTACCTATGAAAAAGTGTCCTATGACAAATGTAGGAGAATAAGAA
AACCAAGAGAAAAGACTATGAAAACATGCTTTCTTGGAGTTTGTCCAACG
AATGAAACCAGCGAATTCATATGGAAAGTCGGTGAATGGACCAGTTGTTC
GACTAGCTGCGGCGGAGAGGGGGTACGTACAAGAGATGTTCAATGCATCT
TGTCCCTTTATTCTGGAGGATATATGAATGCAAAGCATTATGATTGCAAA
TCTGAATATGAGCCTGTAAAAAACGAAAAATGTGGATACTTTGATTGCCC
ACCGGAATTTTTTACAACCTCCTGGTTGAAGTGCACTAAAATGAGAAATT
GCCAATCTCCGGGAATCAGACGCCGCCAAATAAATTGTATGGTTACTACC
AAAAATGGAACTTCTAAATCTGTTCCAAAAGGAAATTGCTATATACGTTC
GAAACCTCCAGCCACTTGGGAGTCGTGTTTCAAAGATCCTGAGTATCAAT
CAAAATGTCAGTTTAAGGATAAAAAGAAGAAACGAAAGCCTCCGATCATT
TCGATAAGTAAATTAAAGATTCACCACATGAGAAGCAGCAAAAAACTGAA
ATTAAATGTTGGACAGACTGCCTTCGTCTTGCCACATACGAGAATTGAGA
TCAAATGTCCAGTAATAAATTTTCCTAGTGAAAACCTACAGTGGTTGAAA
GATAATATTACATATGCATTCATAAGAAGAGCCAAAGAAAGAATTCATGT
CTCAAGAAAAGGATATTTAATTATCAAAAAGTTTTCTCCGAAAGATGAAG
GAAAATGGATTTGCAAAGCTGGCACAATAACCGCTGAAATCGAAATTCTA
ACTCAAAATCCGTCCGATGGATTCTCACATTATTTATCGCGCATTATATA
TTTCAAGGAAGATATCGTAGAGGGTAAAAATAATTCTGCGATTAAATACA
TTAAGCCTTTATTCTACCAATGGGTGGTGGGTCCATGGTCAATATGCTCA
AAATCATGCGGCATTGGGGGCTACCAGACCCGCTATGTGGGCTGTGAATT
GATAGAAAGGCGATATTTTATTGAAGTTGATGGAGGAAAATGTTTAAAAA
AAAACTCTATGAAACCAGATAACATTAGAGAATGTGTACTATTTCAGAAA
TGTCCTACATGGTGGATTGGAGAGCCCTACAGTCATAAATGTACAGAGAC
TTGTTTGGACGTTGGGAAGTCATTTAAGGATCTAAAATTAAAGTGTAAAT
ATGAGAATAAAGTTCTCCTTCCGAACAACTGTGACCTATCAACACAGCCC
ATTGAGACCTGCCATAATCCCAATTGTACATTGTTTTGGAAAACTGAAAA
ATGGTCAACGTGTTCTTCTAGCTGTGGAAATCCGGGAATAAAGGCACGAA
CTGTCAGTTGCCGTTGGAGAAATGATAATTCCCAAGCTGGCAGTTTATGC
TCTAAAGCCAAAATTCGAATGCCTTTACTGATCAAGAAATGTTCAGCCCC
ACCTTGTAACTTGGGATGTATGGACCTGTCAAAGCATTGCGGGCTGAGAA
AATTGTGTTCAGTTGACCATTATCAACATTTCTGTTGCAAAACTTGTAAT
TATAAATAAAATGCATTTGCCGGAGATCGGAAG
back to top

protein sequence of SMED30019505-orf-1

>SMED30019505-orf-1 ID=SMED30019505-orf-1|Name=SMED30019505-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=620bp
MNAIQLESLYITNEEFSLPFRLRSIMNMSIMFVRYALILGSLLGFCGPTR
GKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIR
KPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCI
LSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRN
CQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSKPPATWESCFKDPEYQ
SKCQFKDKKKKRKPPIISISKLKIHHMRSSKKLKLNVGQTAFVLPHTRIE
IKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDE
GKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKY
IKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLK
KNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCK
YENKVLLPNNCDLSTQPIETCHNPNCTLFWKTEKWSTCSSSCGNPGIKAR
TVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKHCGLR
KLCSVDHYQHFCCKTCNYK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036383TSP1_rpt_sf
IPR036179Ig-like_dom_sf
IPR000884TSP1_rpt
IPR013783Ig-like_fold
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000884Thrombospondin type-1 (TSP1) repeatSMARTSM00209TSP1_2coord: 124..179
e-value: 0.025
score: 23.4
coord: 407..469
e-value: 0.033
score: 22.4
coord: 55..116
e-value: 1.3
score: 8.4
coord: 529..587
e-value: 0.042
score: 21.5
IPR000884Thrombospondin type-1 (TSP1) repeatPFAMPF00090TSP_1coord: 532..586
e-value: 4.0E-4
score: 20.5
coord: 411..433
e-value: 0.0038
score: 17.4
coord: 128..149
e-value: 0.0017
score: 18.5
coord: 59..80
e-value: 0.087
score: 13.1
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 404..469
score: 9.221
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 526..587
score: 9.313
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 121..184
score: 9.256
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 123..184
e-value: 1.5E-8
score: 36.9
coord: 406..469
e-value: 1.4E-6
score: 30.6
coord: 53..116
e-value: 4.7E-6
score: 28.9
coord: 528..586
e-value: 9.6E-6
score: 27.9
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 529..586
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 403..463
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 123..183
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 277..367
e-value: 2.0E-8
score: 36.2
NoneNo IPR availablePANTHERPTHR13723ADAMTS A DISINTEGRIN AND METALLOPROTEASE WITH THROMBOSPONDIN MOTIFS PROTEASEcoord: 329..618
coord: 58..249
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 264..365
score: 9.5
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 291..367