Ubiquitin-fold modifier-conjugating enzyme 1

Overview
NameUbiquitin-fold modifier-conjugating enzyme 1
Smed IDSMED30019494
Length (bp)750
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin-fold modifier-conjugating enzyme 1 (SMED30019494) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin-fold modifier-conjugating enzyme 1 (SMED30019494) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin-fold modifier-conjugating enzyme 1 (SMED30019494) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin-fold modifier-conjugating enzyme 1 (SMED30019494) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019494

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 28

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30019494h1SMcG0002666 Contig38855newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019494h1SMcG0002666 Contig38855uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019494h1SMcG0002666 Contig7437uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019494h1SMcG0002666 Contig7437newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30019494h1SMcG0002666 dd_Smed_v4_4590_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019494h1SMcG0002666 dd_Smed_v4_4590_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019494h1SMcG0002666 dd_Smed_v4_4590_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019494h1SMcG0002666 dd_Smed_v4_4590_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019494h1SMcG0002666 dd_Smed_v4_4590_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019494h1SMcG0002666 dd_Smed_v4_4590_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019494h1SMcG0015969 Contig7437uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019494h1SMcG0015969 Contig7437newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019494h1SMcG0015969 Contig38855newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019494h1SMcG0015969 Contig38855uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019494h1SMcG0002666 Contig38855newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019494h1SMcG0002666 Contig38855uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019494h1SMcG0002666 Contig7437uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019494h1SMcG0002666 Contig7437newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30019494h1SMcG0002666 dd_Smed_v4_4590_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019494h1SMcG0002666 dd_Smed_v4_4590_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019494h1SMcG0002666 dd_Smed_v4_4590_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019494h1SMcG0002666 dd_Smed_v4_4590_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019494h1SMcG0002666 dd_Smed_v4_4590_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019494h1SMcG0002666 dd_Smed_v4_4590_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019494h1SMcG0015969 Contig7437uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019494h1SMcG0015969 Contig7437newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019494h1SMcG0015969 Contig38855newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019494h1SMcG0015969 Contig38855uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Ensembl Human
Match: UFC1 (ubiquitin-fold modifier conjugating enzyme 1 [Source:HGNC Symbol;Acc:HGNC:26941])

HSP 1 Score: 280.411 bits (716), Expect = 3.358e-96
Identity = 124/163 (76.07%), Postives = 146/163 (89.57%), Query Frame = 1
Query:  112 MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEIPDMISKGIIKDKD 600
            M DEAT++ ++ IP+LKT AGPRD +LWVQRLKEEYQSLI+YV+NNK ADNDWFRLESN EGTRWFG CWYIH++ KYEF++ FDIP+ YP+T PEI +PELDGKTAKMYRGGKICLT+HFKPLW+RNVPKFG+ H MALGLGPWLAVEIPD+I KG+I+ K+
Sbjct:    1 MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKE 163          
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Ensembl Celegans
Match: ufc-1 (Ubiquitin-fold modifier-conjugating enzyme 1 [Source:UniProtKB/Swiss-Prot;Acc:Q03598])

HSP 1 Score: 265.003 bits (676), Expect = 1.295e-90
Identity = 118/161 (73.29%), Postives = 137/161 (85.09%), Query Frame = 1
Query:  115 IDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEIPDMISKGIIKDK 597
            +D+ATK +L AIPL KTKA PRDGDLW++RLKEEY+++I  VQNNK+ D DWF+LESN  GT+WFG CWY H M KYEF+V FDIP+ YP T PEI LPELDGKTAKMYRGGKICL+EHFKPLW+RN PKFGI HA ALGLGPW+AVEIPD+I KG+I+ K
Sbjct:    1 MDDATKSSLKAIPLCKTKASPRDGDLWIERLKEEYEAIIAAVQNNKDCDRDWFQLESNERGTKWFGKCWYFHNMVKYEFDVEFDIPITYPVTAPEIALPELDGKTAKMYRGGKICLSEHFKPLWARNTPKFGIAHAFALGLGPWMAVEIPDLIEKGLIQPK 161          
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Ensembl Fly
Match: Ufc1 (gene:FBgn0034061 transcript:FBtr0087264)

HSP 1 Score: 274.248 bits (700), Expect = 3.344e-94
Identity = 122/163 (74.85%), Postives = 146/163 (89.57%), Query Frame = 1
Query:  112 MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEIPDMISKGIIKDKD 600
            M+D++T+KTL+ IPLL+ +AGPR+ D+WVQRLKEEYQ+LI+YV+NNK++ +DWFRLESN EGT+WFG CWY+H + KYEF+V FDIPV YP+T PEI LPELDGKTAKMYRGGKICLT+HFKPLW+RNVPKFGI HAMALGL PWLAVEIPD+I KGII  K+
Sbjct:    1 MVDDSTRKTLSNIPLLQIRAGPREKDVWVQRLKEEYQALIKYVENNKQSGSDWFRLESNKEGTKWFGKCWYMHNLLKYEFDVEFDIPVTYPTTAPEIALPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGIAHAMALGLAPWLAVEIPDLIEKGIITYKE 163          
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Ensembl Zebrafish
Match: ufc1 (ubiquitin-fold modifier conjugating enzyme 1 [Source:NCBI gene;Acc:445256])

HSP 1 Score: 279.256 bits (713), Expect = 4.441e-96
Identity = 124/164 (75.61%), Postives = 146/164 (89.02%), Query Frame = 1
Query:  112 MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEIPDMISKGIIKDKDS 603
            M DEAT+K ++ IPLLKT +GPRD +LWVQRL+EEY +LI+YV+NNK ADNDWFRLESN EGTRWFG CWYIHE+ KYEF++ FDIPV YP+T PE+ +PELDGKTAKMYRGGKICLT+HFKPLW+RNVPKFG+ H MALGLGPWLAVEIPD+I+KG+I+ KD 
Sbjct:    1 MADEATRKAVSEIPLLKTNSGPRDKELWVQRLREEYLALIKYVENNKAADNDWFRLESNKEGTRWFGKCWYIHELLKYEFDMEFDIPVTYPATAPEVAIPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIAKGLIQHKDQ 164          
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Ensembl Zebrafish
Match: ufc1 (ubiquitin-fold modifier conjugating enzyme 1 [Source:NCBI gene;Acc:445256])

HSP 1 Score: 279.256 bits (713), Expect = 4.441e-96
Identity = 124/164 (75.61%), Postives = 146/164 (89.02%), Query Frame = 1
Query:  112 MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEIPDMISKGIIKDKDS 603
            M DEAT+K ++ IPLLKT +GPRD +LWVQRL+EEY +LI+YV+NNK ADNDWFRLESN EGTRWFG CWYIHE+ KYEF++ FDIPV YP+T PE+ +PELDGKTAKMYRGGKICLT+HFKPLW+RNVPKFG+ H MALGLGPWLAVEIPD+I+KG+I+ KD 
Sbjct:    1 MADEATRKAVSEIPLLKTNSGPRDKELWVQRLREEYLALIKYVENNKAADNDWFRLESNKEGTRWFGKCWYIHELLKYEFDMEFDIPVTYPATAPEVAIPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIAKGLIQHKDQ 164          
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Ensembl Xenopus
Match: liph (lipase, member H [Source:Xenbase;Acc:XB-GENE-5847665])

HSP 1 Score: 222.631 bits (566), Expect = 9.203e-74
Identity = 103/162 (63.58%), Postives = 125/162 (77.16%), Query Frame = 1
Query:  112 MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEIPDMISKGIIKDK 597
            M+DEAT++ ++ IPLLKT A PRD ++WVQRLKEEYQ+LI+YV+NNK ADNDWFRLESN EGTRWFG CWYIH++ +YEF+V FD+       +                 GGKICLTEHFKPLW+RNVPKFG+ H MALGLGPWLAVEIPD+ISKG+++ K
Sbjct:    1 MVDEATRRVVSEIPLLKTLASPRDKEVWVQRLKEEYQALIKYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLRYEFDVEFDVSRWVSVWD----------------LGGKICLTEHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLISKGLVEHK 146          
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Ensembl Mouse
Match: Ufc1 (ubiquitin-fold modifier conjugating enzyme 1 [Source:MGI Symbol;Acc:MGI:1913405])

HSP 1 Score: 276.559 bits (706), Expect = 6.015e-95
Identity = 121/163 (74.23%), Postives = 145/163 (88.96%), Query Frame = 1
Query:  112 MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEIPDMISKGIIKDKD 600
            M DEAT++ ++ IP+LKT AGPRD +LWVQRLKEEYQSLI+YV+NNK +DNDWFRLESN EGTRWFG CWYIH+  KYEF++ F+IP+ YP+T PEI +PELDGKTAKMYRGGKICLT+HFKPLW+RNVPKFG+ H MALGLGPWLAVE+PD+I KG+I+ K+
Sbjct:    1 MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNSDNDWFRLESNKEGTRWFGKCWYIHDFLKYEFDIEFEIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEVPDLIQKGVIQHKE 163          
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Ensembl Mouse
Match: Ufc1 (ubiquitin-fold modifier conjugating enzyme 1 [Source:MGI Symbol;Acc:MGI:1913405])

HSP 1 Score: 276.559 bits (706), Expect = 6.015e-95
Identity = 121/163 (74.23%), Postives = 145/163 (88.96%), Query Frame = 1
Query:  112 MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEIPDMISKGIIKDKD 600
            M DEAT++ ++ IP+LKT AGPRD +LWVQRLKEEYQSLI+YV+NNK +DNDWFRLESN EGTRWFG CWYIH+  KYEF++ F+IP+ YP+T PEI +PELDGKTAKMYRGGKICLT+HFKPLW+RNVPKFG+ H MALGLGPWLAVE+PD+I KG+I+ K+
Sbjct:    1 MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNSDNDWFRLESNKEGTRWFGKCWYIHDFLKYEFDIEFEIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEVPDLIQKGVIQHKE 163          
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Ensembl Mouse
Match: Ufc1 (ubiquitin-fold modifier conjugating enzyme 1 [Source:MGI Symbol;Acc:MGI:1913405])

HSP 1 Score: 143.665 bits (361), Expect = 1.174e-43
Identity = 62/88 (70.45%), Postives = 76/88 (86.36%), Query Frame = 1
Query:  112 MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPV 375
            M DEAT++ ++ IP+LKT AGPRD +LWVQRLKEEYQSLI+YV+NNK +DNDWFRLESN EGTRWFG CWYIH+  KYEF++ F++ V
Sbjct:    1 MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNSDNDWFRLESNKEGTRWFGKCWYIHDFLKYEFDIEFEVSV 88          
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. UniProt/SwissProt
Match: sp|A7SM54|UFC1_NEMVE (Ubiquitin-fold modifier-conjugating enzyme 1 OS=Nematostella vectensis OX=45351 GN=v1g214407 PE=3 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 2.338e-100
Identity = 135/163 (82.82%), Postives = 146/163 (89.57%), Query Frame = 1
Query:  112 MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEIPDMISKGIIKDKD 600
            M+DEATKKTLAAIPLLKTKAGPRDG  WV RLKEEY SLI+YV NNKEADNDWFRLESN EGTRWFG CWYIH + KYEF+V FDIP+ YP+T PEI LPELDGKTAKMYRGGKIC+T+HFKPLW RNVP+FGI HAMALGLGPWLAVEIPD+I KG+IK KD
Sbjct:    1 MVDEATKKTLAAIPLLKTKAGPRDGKDWVDRLKEEYTSLIKYVSNNKEADNDWFRLESNKEGTRWFGKCWYIHNLLKYEFDVEFDIPITYPTTAPEIALPELDGKTAKMYRGGKICMTDHFKPLWGRNVPRFGIAHAMALGLGPWLAVEIPDLIEKGLIKHKD 163          
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. UniProt/SwissProt
Match: sp|Q178A5|UFC1_AEDAE (Ubiquitin-fold modifier-conjugating enzyme 1 OS=Aedes aegypti OX=7159 GN=AAEL005968 PE=3 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 5.636e-98
Identity = 127/163 (77.91%), Postives = 148/163 (90.80%), Query Frame = 1
Query:  112 MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEIPDMISKGIIKDKD 600
            M+DE+T+KTL++IPLL+TKAGPRD +LWVQRLKEEYQ+LI+YVQNNK +D+DWFRLESN EGT+WFG CWY+H + KYEF+V FDIPV YP+T PEI LPELDGKTAKMYRGGKICLT+HFKPLWSRNVPKFGI HAMALGL PWLAVEIPD+I KG++  K+
Sbjct:    1 MVDESTRKTLSSIPLLQTKAGPRDKELWVQRLKEEYQALIKYVQNNKSSDSDWFRLESNKEGTKWFGKCWYVHNLLKYEFDVEFDIPVTYPATAPEIALPELDGKTAKMYRGGKICLTDHFKPLWSRNVPKFGIAHAMALGLAPWLAVEIPDLIEKGVVAYKE 163          
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. UniProt/SwissProt
Match: sp|B0WVC4|UFC1_CULQU (Ubiquitin-fold modifier-conjugating enzyme 1 OS=Culex quinquefasciatus OX=7176 GN=CPIJ011320 PE=3 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 1.119e-96
Identity = 126/163 (77.30%), Postives = 147/163 (90.18%), Query Frame = 1
Query:  112 MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEIPDMISKGIIKDKD 600
            M+DE T+KTL++IPLL+TKAGPR+ DLWVQRLKEEYQ+LI+YVQNNK +D+DWFRLESN EGT+WFGTCWY+H + KYEF+V FDIPV YP+T PEI LP LDGKTAKMYRGGKICLT+HFKPLW+RNVPKFGI HAMALGL PWLAVEIPD+I KG++  K+
Sbjct:    1 MVDEGTRKTLSSIPLLQTKAGPREKDLWVQRLKEEYQALIKYVQNNKSSDSDWFRLESNKEGTKWFGTCWYVHNLLKYEFDVEFDIPVTYPATAPEIALPGLDGKTAKMYRGGKICLTDHFKPLWARNVPKFGIAHAMALGLAPWLAVEIPDLIEKGVVTYKE 163          
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. UniProt/SwissProt
Match: sp|B3RTL9|UFC1_TRIAD (Ubiquitin-fold modifier-conjugating enzyme 1 OS=Trichoplax adhaerens OX=10228 GN=TRIADDRAFT_35934 PE=3 SV=1)

HSP 1 Score: 282.722 bits (722), Expect = 2.085e-96
Identity = 130/163 (79.75%), Postives = 144/163 (88.34%), Query Frame = 1
Query:  112 MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEIPDMISKGIIKDKD 600
            M+DEATK+TLAAIPLLKT+AGPRD D WV RLKEE  SLI+YV+NNK+ DNDWFRLESN EGTRWFG CWY+H + KYEF+V FDIPV YP T PEI LPELDGKTAKMYRGGKICLT+HFKPLW+RNVPKFGI HAMALGLGPWLAVEIPD++ KGII  K+
Sbjct:    1 MVDEATKRTLAAIPLLKTRAGPRDKDQWVGRLKEELVSLIKYVENNKKQDNDWFRLESNKEGTRWFGKCWYVHNLLKYEFDVEFDIPVTYPGTAPEIALPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGIAHAMALGLGPWLAVEIPDLVEKGIIVHKE 163          
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. UniProt/SwissProt
Match: sp|Q5E953|UFC1_BOVIN (Ubiquitin-fold modifier-conjugating enzyme 1 OS=Bos taurus OX=9913 GN=UFC1 PE=2 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 1.281e-95
Identity = 124/163 (76.07%), Postives = 146/163 (89.57%), Query Frame = 1
Query:  112 MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEIPDMISKGIIKDKD 600
            M DEAT++ ++ IP+LKT AGPRD +LWVQRLKEEYQSLI+YV+NNK ADNDWFRLESN EGTRWFG CWYIH++ KYEF++ FDIP+ YP+T PEI +PELDGKTAKMYRGGKICLT+HFKPLW+RNVPKFG+ H MALGLGPWLAVEIPD+I KG+I+ K+
Sbjct:    1 MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKE 163          
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. TrEMBL
Match: A0A183BA10 (Ubiquitin-fold modifier-conjugating enzyme 1 OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS16045 PE=3 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 4.036e-103
Identity = 138/165 (83.64%), Postives = 156/165 (94.55%), Query Frame = 1
Query:  112 MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEIPDMISKGIIKDKDSE 606
            M+DE TKKTLAAIP LKT+AGPRDGDLWVQRLKEEY +LI+YV+NNKEADNDWFR+ESNA GTRW+G CWYIH+MKKYEF++NFDIPV+YPSTNPE+ LPELDGKTAKMYRGGKICLT+HFKPLWSRNVPKFGI HA+ALGLGPW+AVEIPD+ISKGI+K +D E
Sbjct:    1 MVDEVTKKTLAAIPQLKTRAGPRDGDLWVQRLKEEYLALIKYVENNKEADNDWFRVESNANGTRWYGKCWYIHDMKKYEFDLNFDIPVSYPSTNPELALPELDGKTAKMYRGGKICLTDHFKPLWSRNVPKFGIAHAIALGLGPWMAVEIPDLISKGIVKHRDDE 165          
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. TrEMBL
Match: A0A4S2M2F2 (Ubiquitin-fold modifier-conjugating enzyme 1 OS=Opisthorchis felineus OX=147828 GN=CRM22_004453 PE=3 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 7.235e-103
Identity = 140/172 (81.40%), Postives = 161/172 (93.60%), Query Frame = 1
Query:   91 KIYLVTKMIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEIPDMISKGIIKDKDSE 606
            +I+L + M+DEATKKTLAAIPLLKT+AGPRDGDLWVQRLKEEY +LI+YV+NNK ADNDWFRLESN+ GTRW+G CWYI +MKKYEF+++FDIPV+YPSTNPE+ LPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGI HA+ALGLGPW+AVEIPD+I+KGI+K KD E
Sbjct:   15 RIFLQS-MVDEATKKTLAAIPLLKTRAGPRDGDLWVQRLKEEYLALIKYVENNKAADNDWFRLESNSTGTRWYGKCWYIQDMKKYEFDLSFDIPVSYPSTNPELALPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIAHAIALGLGPWVAVEIPDLIAKGIVKHKDDE 185          
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. TrEMBL
Match: A0A074ZIN5 (Ubiquitin-fold modifier-conjugating enzyme 1 OS=Opisthorchis viverrini OX=6198 GN=T265_08875 PE=3 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 1.850e-102
Identity = 138/165 (83.64%), Postives = 156/165 (94.55%), Query Frame = 1
Query:  112 MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEIPDMISKGIIKDKDSE 606
            M+DEATKKTLAAIPLLKT+AGPRDGDLWVQRLKEEY +LI+YV+NNK ADNDWFRLESN+ GTRW+G CWYI +MKKYEF+++FDIPV+YPSTNPE+ LPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGI HA+ALGLGPW+AVEIPD+I+KGI+K KD E
Sbjct:    1 MVDEATKKTLAAIPLLKTRAGPRDGDLWVQRLKEEYLALIKYVENNKAADNDWFRLESNSTGTRWYGKCWYIQDMKKYEFDLSFDIPVSYPSTNPELALPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIAHAIALGLGPWVAVEIPDLIAKGIVKHKDDE 165          
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. TrEMBL
Match: A0A504YFX2 (Ubiquitin-fold modifier-conjugating enzyme 1 OS=Fasciola gigantica OX=46835 GN=FGIG_08499 PE=3 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 1.907e-101
Identity = 135/165 (81.82%), Postives = 156/165 (94.55%), Query Frame = 1
Query:  112 MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEIPDMISKGIIKDKDSE 606
            M+DE TKKTLAAIPLLKT+AGPRDGDLWVQRLKEEY +LI+YV+NNKE+DNDWFR+ESNA GTRW+G CWYI +MKKYEF++NFDIPV+YPSTNPE+ LPELDGKTAKMYRGGKICLT+HFKPLWSRNVPKFGI HA+ALGLGPW+AVEIPD+I+KGI+K ++ E
Sbjct:    1 MVDEVTKKTLAAIPLLKTRAGPRDGDLWVQRLKEEYLALIKYVENNKESDNDWFRVESNANGTRWYGKCWYIQDMKKYEFDLNFDIPVSYPSTNPELALPELDGKTAKMYRGGKICLTDHFKPLWSRNVPKFGIAHAIALGLGPWMAVEIPDLIAKGIVKHREDE 165          
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. TrEMBL
Match: A0A4E0R0C5 (Ubiquitin-fold modifier-conjugating enzyme 1 OS=Fasciola hepatica OX=6192 GN=D915_009172 PE=3 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 1.907e-101
Identity = 135/165 (81.82%), Postives = 156/165 (94.55%), Query Frame = 1
Query:  112 MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEIPDMISKGIIKDKDSE 606
            M+DE TKKTLAAIPLLKT+AGPRDGDLWVQRLKEEY +LI+YV+NNKE+DNDWFR+ESNA GTRW+G CWYI +MKKYEF++NFDIPV+YPSTNPE+ LPELDGKTAKMYRGGKICLT+HFKPLWSRNVPKFGI HA+ALGLGPW+AVEIPD+I+KGI+K ++ E
Sbjct:    1 MVDEVTKKTLAAIPLLKTRAGPRDGDLWVQRLKEEYLALIKYVENNKESDNDWFRVESNANGTRWYGKCWYIQDMKKYEFDLNFDIPVSYPSTNPELALPELDGKTAKMYRGGKICLTDHFKPLWSRNVPKFGIAHAIALGLGPWMAVEIPDLIAKGIVKHREDE 165          
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Ensembl Cavefish
Match: ufc1 (ubiquitin-fold modifier conjugating enzyme 1 [Source:NCBI gene;Acc:103030331])

HSP 1 Score: 282.722 bits (722), Expect = 1.759e-97
Identity = 126/165 (76.36%), Postives = 148/165 (89.70%), Query Frame = 1
Query:  112 MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEIPDMISKGIIKDKDSE 606
            M DEAT+KT++ IPLLKT +GPRD +LWVQRL+EEY +LI+YV+NNK ADNDWFRLESN EGTRWFG CWYIHE+ KYEF++ FDIPV YP+T PE+ +PELDGKTAKMYRGGKICLT+HFKPLW+RNVPKFG+ H MALGLGPWLAVEIPD+ISKGII+ K+ +
Sbjct:    1 MADEATRKTVSEIPLLKTNSGPRDKELWVQRLREEYLALIKYVENNKAADNDWFRLESNKEGTRWFGKCWYIHELLKYEFDMEFDIPVTYPATAPEVAIPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLISKGIIQHKEQQ 165          
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Ensembl Cavefish
Match: ufc1 (ubiquitin-fold modifier conjugating enzyme 1 [Source:NCBI gene;Acc:103030331])

HSP 1 Score: 267.7 bits (683), Expect = 1.932e-91
Identity = 120/165 (72.73%), Postives = 143/165 (86.67%), Query Frame = 1
Query:  112 MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEIPDMISKGIIKDKDSE 606
            M DEAT+KT++ IPLLKT +GPRD +LWVQRL+EEY +LI+YV+NNK ADNDWFRLESN EGTRWFG CWYIHE+ KYEF++ FDIPV YP+T PE+ +PELDGKTAKMYRGGKICLT+HFKPLW+RNVPKFG+ H MALGL     +EIPD+ISKGII+ K+ +
Sbjct:    1 MADEATRKTVSEIPLLKTNSGPRDKELWVQRLREEYLALIKYVENNKAADNDWFRLESNKEGTRWFGKCWYIHELLKYEFDMEFDIPVTYPATAPEVAIPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLMGGYLIEIPDLISKGIIQHKEQQ 165          
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Ensembl Nematostella
Match: EDO35210 (Ubiquitin-fold modifier-conjugating enzyme 1 [Source:UniProtKB/Swiss-Prot;Acc:A7SM54])

HSP 1 Score: 292.738 bits (748), Expect = 9.582e-102
Identity = 135/163 (82.82%), Postives = 146/163 (89.57%), Query Frame = 1
Query:  112 MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEIPDMISKGIIKDKD 600
            M+DEATKKTLAAIPLLKTKAGPRDG  WV RLKEEY SLI+YV NNKEADNDWFRLESN EGTRWFG CWYIH + KYEF+V FDIP+ YP+T PEI LPELDGKTAKMYRGGKIC+T+HFKPLW RNVP+FGI HAMALGLGPWLAVEIPD+I KG+IK KD
Sbjct:    1 MVDEATKKTLAAIPLLKTKAGPRDGKDWVDRLKEEYTSLIKYVSNNKEADNDWFRLESNKEGTRWFGKCWYIHNLLKYEFDVEFDIPITYPTTAPEIALPELDGKTAKMYRGGKICMTDHFKPLWGRNVPRFGIAHAMALGLGPWLAVEIPDLIEKGLIKHKD 163          
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Ensembl Nematostella
Match: EDO28897 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T566])

HSP 1 Score: 149.058 bits (375), Expect = 6.479e-46
Identity = 81/113 (71.68%), Postives = 86/113 (76.11%), Query Frame = 1
Query:  112 MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFD--IPVAYPSTNPEIVLPELDGKTAKMYR 444
            M+DEATKKTLAAIPLLKTKAGPRDG  WV RLKEEY SLI+YV NNKEADNDWFRLESN EGTR   T   I    +    V F   IP+ YP+T PEI LPELDGKTAKMYR
Sbjct:    1 MVDEATKKTLAAIPLLKTKAGPRDGKDWVDRLKEEYTSLIKYVSNNKEADNDWFRLESNKEGTRKPLTI--IVNYYELILCVFFSPKIPITYPTTAPEIALPELDGKTAKMYR 111          
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Ensembl Medaka
Match: ufc1 (ubiquitin-fold modifier conjugating enzyme 1 [Source:NCBI gene;Acc:445256])

HSP 1 Score: 268.085 bits (684), Expect = 1.302e-91
Identity = 116/163 (71.17%), Postives = 140/163 (85.89%), Query Frame = 1
Query:  112 MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEIPDMISKGIIKDKD 600
            M DEAT+K ++ IPLLKT AGPRD  LW QRLKEEYQ+LI++V+ NK ADNDWFRLESNA+GTRW GTCW++HE+ +YEF + FDIPV YP T PE+ +PELDGKTAKMYRGG+ICLTEHF PLW+RN P+FG+ H MALGLGPWLAVE+PD+ISKG++  K+
Sbjct:    1 MADEATRKAVSQIPLLKTHAGPRDRALWPQRLKEEYQALIRFVEQNKAADNDWFRLESNADGTRWTGTCWFVHELLRYEFRLEFDIPVTYPETAPELAIPELDGKTAKMYRGGRICLTEHFAPLWARNAPRFGLAHLMALGLGPWLAVEVPDLISKGLVAHKE 163          
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Planmine SMEST
Match: SMESG000068795.1 (SMESG000068795.1)

HSP 1 Score: 344.739 bits (883), Expect = 4.048e-122
Identity = 165/165 (100.00%), Postives = 165/165 (100.00%), Query Frame = 1
Query:  112 MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEIPDMISKGIIKDKDSE 606
            MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEIPDMISKGIIKDKDSE
Sbjct:    1 MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEADNDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLPELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEIPDMISKGIIKDKDSE 165          
The following BLAST results are available for this feature:
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
UFC13.358e-9676.07ubiquitin-fold modifier conjugating enzyme 1 [Sour... [more]
back to top
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ufc-11.295e-9073.29Ubiquitin-fold modifier-conjugating enzyme 1 [Sou... [more]
back to top
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ufc13.344e-9474.85gene:FBgn0034061 transcript:FBtr0087264[more]
back to top
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ufc14.441e-9675.61ubiquitin-fold modifier conjugating enzyme 1 [Sour... [more]
ufc14.441e-9675.61ubiquitin-fold modifier conjugating enzyme 1 [Sour... [more]
back to top
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
liph9.203e-7463.58lipase, member H [Source:Xenbase;Acc:XB-GENE-58476... [more]
back to top
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ufc16.015e-9574.23ubiquitin-fold modifier conjugating enzyme 1 [Sour... [more]
Ufc16.015e-9574.23ubiquitin-fold modifier conjugating enzyme 1 [Sour... [more]
Ufc11.174e-4370.45ubiquitin-fold modifier conjugating enzyme 1 [Sour... [more]
back to top
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A7SM54|UFC1_NEMVE2.338e-10082.82Ubiquitin-fold modifier-conjugating enzyme 1 OS=Ne... [more]
sp|Q178A5|UFC1_AEDAE5.636e-9877.91Ubiquitin-fold modifier-conjugating enzyme 1 OS=Ae... [more]
sp|B0WVC4|UFC1_CULQU1.119e-9677.30Ubiquitin-fold modifier-conjugating enzyme 1 OS=Cu... [more]
sp|B3RTL9|UFC1_TRIAD2.085e-9679.75Ubiquitin-fold modifier-conjugating enzyme 1 OS=Tr... [more]
sp|Q5E953|UFC1_BOVIN1.281e-9576.07Ubiquitin-fold modifier-conjugating enzyme 1 OS=Bo... [more]
back to top
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183BA104.036e-10383.64Ubiquitin-fold modifier-conjugating enzyme 1 OS=Ec... [more]
A0A4S2M2F27.235e-10381.40Ubiquitin-fold modifier-conjugating enzyme 1 OS=Op... [more]
A0A074ZIN51.850e-10283.64Ubiquitin-fold modifier-conjugating enzyme 1 OS=Op... [more]
A0A504YFX21.907e-10181.82Ubiquitin-fold modifier-conjugating enzyme 1 OS=Fa... [more]
A0A4E0R0C51.907e-10181.82Ubiquitin-fold modifier-conjugating enzyme 1 OS=Fa... [more]
back to top
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ufc11.759e-9776.36ubiquitin-fold modifier conjugating enzyme 1 [Sour... [more]
ufc11.932e-9172.73ubiquitin-fold modifier conjugating enzyme 1 [Sour... [more]
back to top
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO352109.582e-10282.82Ubiquitin-fold modifier-conjugating enzyme 1 [Sou... [more]
EDO288976.479e-4671.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ufc11.302e-9171.17ubiquitin-fold modifier conjugating enzyme 1 [Sour... [more]
back to top
BLAST of Ubiquitin-fold modifier-conjugating enzyme 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000068795.14.048e-122100.00SMESG000068795.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019494 ID=SMED30019494|Name=Ubiquitin-fold modifier-conjugating enzyme 1|organism=Schmidtea mediterranea sexual|type=transcript|length=750bp
ATTTTGAAATATAGACACGATTTAATTTAATTTTTTAAACAACTTTTCTA
TATATTGCACGTAGAGTATATTTTTTAATATAGAAGTTAAAAAATTTATT
TAGTAACTAAAATGATTGATGAAGCAACTAAAAAGACTCTTGCTGCAATT
CCGTTATTGAAAACAAAAGCTGGCCCTCGTGATGGTGATCTGTGGGTCCA
ACGTCTTAAAGAAGAATATCAGTCATTAATACAGTATGTACAAAATAACA
AAGAAGCTGACAATGATTGGTTTCGACTTGAATCTAATGCTGAAGGTACT
CGTTGGTTTGGAACATGCTGGTATATTCATGAAATGAAAAAATATGAATT
TGAAGTCAATTTCGACATTCCGGTTGCATATCCTAGCACCAATCCAGAAA
TTGTACTACCAGAATTGGATGGTAAAACTGCTAAAATGTATAGAGGTGGA
AAAATTTGTTTAACCGAACATTTTAAACCACTTTGGTCACGAAATGTTCC
AAAATTTGGAATTGGCCACGCAATGGCTCTTGGTTTGGGACCTTGGTTGG
CAGTTGAGATACCAGACATGATTTCTAAAGGCATTATTAAAGATAAAGAC
AGTGAATAATTATTTTGGCATATAAAATTATTTCACGTATGAAATTGTTT
ATTTTGATGCGGATTTTCAGTAACACGGTTTAATGATAAAAAAATAATCA
ATTCCGATTTATTTGAGTAATATATTTGTTGTTAAATGAATTTATAAATT
back to top

protein sequence of SMED30019494-orf-1

>SMED30019494-orf-1 ID=SMED30019494-orf-1|Name=SMED30019494-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=166bp
MIDEATKKTLAAIPLLKTKAGPRDGDLWVQRLKEEYQSLIQYVQNNKEAD
NDWFRLESNAEGTRWFGTCWYIHEMKKYEFEVNFDIPVAYPSTNPEIVLP
ELDGKTAKMYRGGKICLTEHFKPLWSRNVPKFGIGHAMALGLGPWLAVEI
PDMISKGIIKDKDSE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR014806Ufc1
IPR016135UBQ-conjugating_enzyme/RWD
Vocabulary: molecular function
TermDefinition
GO:0071568UFM1 transferase activity
Vocabulary: biological process
TermDefinition
GO:1990592protein K69-linked ufmylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 29..49
NoneNo IPR availablePANTHERPTHR12921:SF0UBIQUITIN-FOLD MODIFIER-CONJUGATING ENZYME 1coord: 1..164
IPR014806Ubiquitin-fold modifier-conjugating enzyme 1PIRSFPIRSF008716Ufc1coord: 1..165
e-value: 3.0E-92
score: 304.3
IPR014806Ubiquitin-fold modifier-conjugating enzyme 1PFAMPF08694UFC1coord: 6..160
e-value: 4.4E-85
score: 283.0
IPR014806Ubiquitin-fold modifier-conjugating enzyme 1PANTHERPTHR12921FAMILY NOT NAMEDcoord: 1..164
IPR016135Ubiquitin-conjugating enzyme/RWD-likeGENE3DG3DSA:3.10.110.10coord: 1..165
e-value: 1.5E-93
score: 313.0
IPR016135Ubiquitin-conjugating enzyme/RWD-likeSUPERFAMILYSSF54495UBC-likecoord: 3..159