Rap55 protein

Overview
NameRap55 protein (ADK78221.1)
Smed IDSMED30019490
Length (bp)1760
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rap55 protein (SMED30019490) t-SNE clustered cells

Violin plots show distribution of expression levels for Rap55 protein (SMED30019490) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019490

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30019490SMESG000020999.1 Contig37874newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30019490SMESG000020999.1 Contig37874uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30019490SMESG000020999.1 PL06011A1H05ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
spermatogoniumSMED30019490SMESG000020999.1 HM055596smed_ncbi_20200123PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30019490SMESG000020999.1 Contig4037_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30019490SMESG000020999.1 Contig4037_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30019490SMESG000020999.1 Contig4037_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rap55 protein vs. Ensembl Human
Match: LSM14B (LSM family member 14B [Source:HGNC Symbol;Acc:HGNC:15887])

HSP 1 Score: 138.272 bits (347), Expect = 7.604e-37
Identity = 66/105 (62.86%), Postives = 82/105 (78.10%), Query Frame = 2
Query:   74 NGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEITGKPPMATPY 388
            +G  +LG KISLIS+A IRYEGILYTID +NSTVAL+KV+SFGTEDR  + P PPR+EIYEYIIFRGSDI+D+ VCE PK     + QDPAI++ +     A+P+
Sbjct:    5 SGTPYLGSKISLISKAQIRYEGILYTIDTDNSTVALAKVRSFGTEDRPTDRPAPPREEIYEYIIFRGSDIKDITVCEPPKAQ-HTLPQDPAIVQSSLGSASASPF 108          
BLAST of Rap55 protein vs. Ensembl Human
Match: LSM14A (LSM14A mRNA processing body assembly factor [Source:HGNC Symbol;Acc:HGNC:24489])

HSP 1 Score: 133.265 bits (334), Expect = 1.234e-36
Identity = 65/95 (68.42%), Postives = 78/95 (82.11%), Query Frame = 2
Query:   74 NGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQI-MAQDPAILE 355
             G  ++G KISLIS+A IRYEGILYTID  NSTVAL+KV+SFGTEDR  + P+PPRDE++EYIIFRGSDI+DL VCE PK  PQ  + QDPAI++
Sbjct:    3 GGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPK--PQCSLPQDPAIVQ 95          
BLAST of Rap55 protein vs. Ensembl Human
Match: LSM14A (LSM14A mRNA processing body assembly factor [Source:HGNC Symbol;Acc:HGNC:24489])

HSP 1 Score: 133.265 bits (334), Expect = 1.234e-36
Identity = 65/95 (68.42%), Postives = 78/95 (82.11%), Query Frame = 2
Query:   74 NGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQI-MAQDPAILE 355
             G  ++G KISLIS+A IRYEGILYTID  NSTVAL+KV+SFGTEDR  + P+PPRDE++EYIIFRGSDI+DL VCE PK  PQ  + QDPAI++
Sbjct:    3 GGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPK--PQCSLPQDPAIVQ 95          
BLAST of Rap55 protein vs. Ensembl Human
Match: LSM14B (LSM family member 14B [Source:HGNC Symbol;Acc:HGNC:15887])

HSP 1 Score: 139.428 bits (350), Expect = 1.567e-36
Identity = 65/99 (65.66%), Postives = 80/99 (80.81%), Query Frame = 2
Query:   74 NGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEITGKP 370
            +G  +LG KISLIS+A IRYEGILYTID +NSTVAL+KV+SFGTEDR  + P PPR+EIYEYIIFRGSDI+D+ VCE PK     + QDPAI+++  +P
Sbjct:    5 SGTPYLGSKISLISKAQIRYEGILYTIDTDNSTVALAKVRSFGTEDRPTDRPAPPREEIYEYIIFRGSDIKDITVCEPPKAQ-HTLPQDPAIVQLNKRP 102          
BLAST of Rap55 protein vs. Ensembl Human
Match: LSM14B (LSM family member 14B [Source:HGNC Symbol;Acc:HGNC:15887])

HSP 1 Score: 137.117 bits (344), Expect = 1.871e-36
Identity = 66/105 (62.86%), Postives = 82/105 (78.10%), Query Frame = 2
Query:   74 NGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEITGKPPMATPY 388
            +G  +LG KISLIS+A IRYEGILYTID +NSTVAL+KV+SFGTEDR  + P PPR+EIYEYIIFRGSDI+D+ VCE PK     + QDPAI++ +     A+P+
Sbjct:    5 SGTPYLGSKISLISKAQIRYEGILYTIDTDNSTVALAKVRSFGTEDRPTDRPAPPREEIYEYIIFRGSDIKDITVCEPPKAQ-HTLPQDPAIVQSSLGSASASPF 108          
BLAST of Rap55 protein vs. Ensembl Celegans
Match: car-1 (Cytokinesis, Apoptosis, RNA-associated [Source:UniProtKB/TrEMBL;Acc:Q9XW17])

HSP 1 Score: 114.39 bits (285), Expect = 1.309e-27
Identity = 54/101 (53.47%), Postives = 73/101 (72.28%), Query Frame = 2
Query:   86 FLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKH--PQIMAQDPAILEITGKPPMAT 382
            ++G KISLIS+  IRYEGILYT+D N+ST+AL+KV+SFGTE R    PV  RD++YEYIIF+ SDI+DL VC+ PK       +  DPAI+ ++ +   A+
Sbjct:    7 YIGSKISLISKLDIRYEGILYTVDTNDSTIALAKVRSFGTEKRPTANPVAARDDVYEYIIFKASDIKDLIVCDTPKMANIGGGLPYDPAIISVSSRSAPAS 107          
BLAST of Rap55 protein vs. Ensembl Fly
Match: tral (gene:FBgn0041775 transcript:FBtr0332638)

HSP 1 Score: 99.7525 bits (247), Expect = 1.379e-21
Identity = 51/99 (51.52%), Postives = 65/99 (65.66%), Query Frame = 2
Query:   89 LGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEI---TGKPPM 376
            LG KISLIS+A IRYEG LYT+D    T+ALS V+SFGTEDR  +  + P+ +IY+YI+FRGSDI+D+ V      H      DPAI++     G P M
Sbjct:    8 LGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQIYDYILFRGSDIKDIRVV---NNHTLPHHNDPAIMQAQLQNGPPQM 103          

HSP 2 Score: 52.373 bits (124), Expect = 9.875e-7
Identity = 44/154 (28.57%), Postives = 67/154 (43.51%), Query Frame = 2
Query:  905 KYDKDYDFESAN---AEIAKELERLTLEKNSVSTTTLSECQFVNRDIGPSKNKGPTGDSERIENIEINPESQMNGLRNNTELDQTNSTVSNNNEIITNGPIAKDNGDNVINYDRSKSFYDNISSQAT-DRAKGKMIRAINWRDERKLNVETFGF 1354
            K++ D+DFE AN    E+  +L +L + ++                        P   +            Q+NG  +  + D  N T +  +E         +  D  + YD++KSF+DNIS +A  DR+K K     +WR ERKLN ETFG 
Sbjct:  402 KFEGDFDFEQANNKFEELRSQLAKLKVAEDGA----------------------PKPATNATAATATATNEQLNGETDKKD-DSGNETGAGEHE--------PEEDDVAVCYDKTKSFFDNISCEAAQDRSKNK---KNDWRQERKLNTETFGV 521          
BLAST of Rap55 protein vs. Ensembl Fly
Match: tral (gene:FBgn0041775 transcript:FBtr0332640)

HSP 1 Score: 99.7525 bits (247), Expect = 1.382e-21
Identity = 51/99 (51.52%), Postives = 65/99 (65.66%), Query Frame = 2
Query:   89 LGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEIT---GKPPM 376
            LG KISLIS+A IRYEG LYT+D    T+ALS V+SFGTEDR  +  + P+ +IY+YI+FRGSDI+D+ V      H      DPAI++     G P M
Sbjct:    8 LGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQIYDYILFRGSDIKDIRVV---NNHTLPHHNDPAIMQAQLQNGPPQM 103          

HSP 2 Score: 52.373 bits (124), Expect = 9.882e-7
Identity = 44/154 (28.57%), Postives = 67/154 (43.51%), Query Frame = 2
Query:  905 KYDKDYDFESAN---AEIAKELERLTLEKNSVSTTTLSECQFVNRDIGPSKNKGPTGDSERIENIEINPESQMNGLRNNTELDQTNSTVSNNNEIITNGPIAKDNGDNVINYDRSKSFYDNISSQAT-DRAKGKMIRAINWRDERKLNVETFGF 1354
            K++ D+DFE AN    E+  +L +L + ++                        P   +            Q+NG  +  + D  N T +  +E         +  D  + YD++KSF+DNIS +A  DR+K K     +WR ERKLN ETFG 
Sbjct:  402 KFEGDFDFEQANNKFEELRSQLAKLKVAEDGA----------------------PKPATNATAATATATNEQLNGETDKKD-DSGNETGAGEHE--------PEEDDVAVCYDKTKSFFDNISCEAAQDRSKNK---KNDWRQERKLNTETFGV 521          
BLAST of Rap55 protein vs. Ensembl Fly
Match: tral (gene:FBgn0041775 transcript:FBtr0332639)

HSP 1 Score: 99.3673 bits (246), Expect = 1.504e-21
Identity = 51/99 (51.52%), Postives = 65/99 (65.66%), Query Frame = 2
Query:   89 LGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEIT---GKPPM 376
            LG KISLIS+A IRYEG LYT+D    T+ALS V+SFGTEDR  +  + P+ +IY+YI+FRGSDI+D+ V      H      DPAI++     G P M
Sbjct:    8 LGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQIYDYILFRGSDIKDIRVV---NNHTLPHHNDPAIMQAQLQNGPPQM 103          

HSP 2 Score: 54.299 bits (129), Expect = 2.801e-7
Identity = 47/158 (29.75%), Postives = 75/158 (47.47%), Query Frame = 2
Query:  905 KYDKDYDFESAN---AEIAKELERLTLEKNSV----STTTLSECQFVNRDIGPSKNKGPTGDSERIENIEINPESQMNGLRNNTELDQTNSTVSNNNEIITNGPIAKDNGDNVINYDRSKSFYDNISSQAT-DRAKGKMIRAINWRDERKLNVETFGF 1354
            K++ D+DFE AN    E+  +L +L + ++      +  T +     N  +G           E++E +       +NG  +  + D  N T +  +E         +  D  + YD++KSF+DNIS +A  DR+K K     +WR ERKLN ETFG 
Sbjct:  402 KFEGDFDFEQANNKFEELRSQLAKLKVAEDGAPKPATNATAATATATNEQVG-----------EKVEGVHT-----LNGETDKKD-DSGNETGAGEHE--------PEEDDVAVCYDKTKSFFDNISCEAAQDRSKNK---KNDWRQERKLNTETFGV 531          
BLAST of Rap55 protein vs. Ensembl Fly
Match: tral (gene:FBgn0041775 transcript:FBtr0332642)

HSP 1 Score: 99.3673 bits (246), Expect = 1.650e-21
Identity = 48/89 (53.93%), Postives = 62/89 (69.66%), Query Frame = 2
Query:   89 LGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILE 355
            LG KISLIS+A IRYEG LYT+D    T+ALS V+SFGTEDR  +  + P+ +IY+YI+FRGSDI+D+ V      H      DPAI++
Sbjct:    8 LGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQIYDYILFRGSDIKDIRVV---NNHTLPHHNDPAIMQ 93          

HSP 2 Score: 52.373 bits (124), Expect = 1.017e-6
Identity = 44/154 (28.57%), Postives = 67/154 (43.51%), Query Frame = 2
Query:  905 KYDKDYDFESAN---AEIAKELERLTLEKNSVSTTTLSECQFVNRDIGPSKNKGPTGDSERIENIEINPESQMNGLRNNTELDQTNSTVSNNNEIITNGPIAKDNGDNVINYDRSKSFYDNISSQAT-DRAKGKMIRAINWRDERKLNVETFGF 1354
            K++ D+DFE AN    E+  +L +L + ++                        P   +            Q+NG  +  + D  N T +  +E         +  D  + YD++KSF+DNIS +A  DR+K K     +WR ERKLN ETFG 
Sbjct:  406 KFEGDFDFEQANNKFEELRSQLAKLKVAEDGA----------------------PKPATNATAATATATNEQLNGETDKKD-DSGNETGAGEHE--------PEEDDVAVCYDKTKSFFDNISCEAAQDRSKNK---KNDWRQERKLNTETFGV 525          
BLAST of Rap55 protein vs. Ensembl Fly
Match: tral (gene:FBgn0041775 transcript:FBtr0332635)

HSP 1 Score: 99.3673 bits (246), Expect = 1.669e-21
Identity = 51/99 (51.52%), Postives = 65/99 (65.66%), Query Frame = 2
Query:   89 LGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEIT---GKPPM 376
            LG KISLIS+A IRYEG LYT+D    T+ALS V+SFGTEDR  +  + P+ +IY+YI+FRGSDI+D+ V      H      DPAI++     G P M
Sbjct:    8 LGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQIYDYILFRGSDIKDIRVV---NNHTLPHHNDPAIMQAQLQNGPPQM 103          

HSP 2 Score: 53.9138 bits (128), Expect = 3.104e-7
Identity = 47/158 (29.75%), Postives = 75/158 (47.47%), Query Frame = 2
Query:  905 KYDKDYDFESAN---AEIAKELERLTLEKNSV----STTTLSECQFVNRDIGPSKNKGPTGDSERIENIEINPESQMNGLRNNTELDQTNSTVSNNNEIITNGPIAKDNGDNVINYDRSKSFYDNISSQAT-DRAKGKMIRAINWRDERKLNVETFGF 1354
            K++ D+DFE AN    E+  +L +L + ++      +  T +     N  +G           E++E +       +NG  +  + D  N T +  +E         +  D  + YD++KSF+DNIS +A  DR+K K     +WR ERKLN ETFG 
Sbjct:  402 KFEGDFDFEQANNKFEELRSQLAKLKVAEDGAPKPATNATAATATATNEQVG-----------EKVEGVHT-----LNGETDKKD-DSGNETGAGEHE--------PEEDDVAVCYDKTKSFFDNISCEAAQDRSKNK---KNDWRQERKLNTETFGV 531          
BLAST of Rap55 protein vs. Ensembl Zebrafish
Match: lsm14ab (LSM14A mRNA processing body assembly factor b [Source:ZFIN;Acc:ZDB-GENE-040426-2462])

HSP 1 Score: 135.191 bits (339), Expect = 6.469e-34
Identity = 63/95 (66.32%), Postives = 77/95 (81.05%), Query Frame = 2
Query:   74 NGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQI-MAQDPAILE 355
             G  ++G KISLIS+A IRYEG+LYTID  NSTVAL+KVKSFGTEDR  + P+PPRD+++EYIIFRGSDI+DL VCE PK  P   + QDPAI++
Sbjct:    3 GGTPYIGSKISLISKAEIRYEGVLYTIDTENSTVALAKVKSFGTEDRPTDRPIPPRDDVFEYIIFRGSDIKDLTVCEPPK--PTCNLPQDPAIVQ 95          
BLAST of Rap55 protein vs. Ensembl Zebrafish
Match: lsm14ab (LSM14A mRNA processing body assembly factor b [Source:ZFIN;Acc:ZDB-GENE-040426-2462])

HSP 1 Score: 135.576 bits (340), Expect = 6.998e-34
Identity = 63/95 (66.32%), Postives = 77/95 (81.05%), Query Frame = 2
Query:   74 NGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQI-MAQDPAILE 355
             G  ++G KISLIS+A IRYEG+LYTID  NSTVAL+KVKSFGTEDR  + P+PPRD+++EYIIFRGSDI+DL VCE PK  P   + QDPAI++
Sbjct:    3 GGTPYIGSKISLISKAEIRYEGVLYTIDTENSTVALAKVKSFGTEDRPTDRPIPPRDDVFEYIIFRGSDIKDLTVCEPPK--PTCNLPQDPAIVQ 95          
BLAST of Rap55 protein vs. Ensembl Zebrafish
Match: lsm14aa (LSM14A mRNA processing body assembly factor a [Source:ZFIN;Acc:ZDB-GENE-040426-1567])

HSP 1 Score: 129.798 bits (325), Expect = 1.274e-33
Identity = 62/94 (65.96%), Postives = 74/94 (78.72%), Query Frame = 2
Query:   74 NGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILE 355
             G  ++G KISLIS+A IRYEGILYTID  NSTVAL+KV+SFGTEDR  + P+ PRDE +EYIIFRGSDI+DL VCE PK     + QDPAI++
Sbjct:    3 GGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIAPRDETFEYIIFRGSDIKDLTVCEPPKPTCS-LPQDPAIVQ 95          
BLAST of Rap55 protein vs. Ensembl Zebrafish
Match: lsm14aa (LSM14A mRNA processing body assembly factor a [Source:ZFIN;Acc:ZDB-GENE-040426-1567])

HSP 1 Score: 121.324 bits (303), Expect = 9.790e-33
Identity = 57/80 (71.25%), Postives = 66/80 (82.50%), Query Frame = 2
Query:   74 NGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPK 313
             G  ++G KISLIS+A IRYEGILYTID  NSTVAL+KV+SFGTEDR  + P+ PRDE +EYIIFRGSDI+DL VCE PK
Sbjct:    3 GGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIAPRDETFEYIIFRGSDIKDLTVCEPPK 82          
BLAST of Rap55 protein vs. Ensembl Zebrafish
Match: lsm14b (LSM family member 14B [Source:ZFIN;Acc:ZDB-GENE-040426-779])

HSP 1 Score: 129.413 bits (324), Expect = 2.110e-32
Identity = 62/94 (65.96%), Postives = 76/94 (80.85%), Query Frame = 2
Query:   74 NGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILE 355
            +G  ++G KISLIS+A IRYEGILYTID +NSTVAL+KV+SFGTE R  + PVP RDEI+EYIIFRGSDI+D+ VCE  K H   + QDPAI++
Sbjct:    3 SGTPYIGSKISLISKAQIRYEGILYTIDTDNSTVALAKVRSFGTEGRPTDRPVPARDEIFEYIIFRGSDIKDITVCEPLKVH-HGLPQDPAIVQ 95          
BLAST of Rap55 protein vs. Ensembl Xenopus
Match: rps15 (ribosomal protein S15 [Source:Xenbase;Acc:XB-GENE-5832673])

HSP 1 Score: 136.346 bits (342), Expect = 2.560e-34
Identity = 65/94 (69.15%), Postives = 78/94 (82.98%), Query Frame = 2
Query:   77 GQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQI-MAQDPAILE 355
            G  ++G KISLIS+A IRYEGILYTID  NSTVAL+KV+SFGTEDR  + P+PPRDE++EYIIFRGSDI+DL VCE PK  PQ  + QDPAI++
Sbjct:    4 GTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPK--PQCSLPQDPAIVQ 95          
BLAST of Rap55 protein vs. Ensembl Xenopus
Match: lsm14b (LSM family member 14B [Source:NCBI gene;Acc:595068])

HSP 1 Score: 134.035 bits (336), Expect = 4.519e-34
Identity = 69/115 (60.00%), Postives = 85/115 (73.91%), Query Frame = 2
Query:   74 NGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEIT-GKPPMAT-----PYSRRR 400
            +G  ++G KISLIS+A IRYEGILYTID  NSTVAL+KV+SFGTEDR  + P PPR+E+YEYIIFRGSDI+D+ VCE PK     + QDPAI++ + G  P A+     PYS  R
Sbjct:    3 SGTPYIGSKISLISKAQIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPAPPREEVYEYIIFRGSDIKDITVCEPPKAS-HALPQDPAIVQSSLGSAPSASYQSSVPYSPFR 116          
BLAST of Rap55 protein vs. Ensembl Xenopus
Match: rps15 (ribosomal protein S15 [Source:Xenbase;Acc:XB-GENE-5832673])

HSP 1 Score: 135.961 bits (341), Expect = 7.505e-34
Identity = 65/94 (69.15%), Postives = 78/94 (82.98%), Query Frame = 2
Query:   77 GQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQI-MAQDPAILE 355
            G  ++G KISLIS+A IRYEGILYTID  NSTVAL+KV+SFGTEDR  + P+PPRDE++EYIIFRGSDI+DL VCE PK  PQ  + QDPAI++
Sbjct:    4 GTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPK--PQCSLPQDPAIVQ 95          
BLAST of Rap55 protein vs. Ensembl Xenopus
Match: lsm14b (LSM family member 14B [Source:NCBI gene;Acc:595068])

HSP 1 Score: 134.035 bits (336), Expect = 7.624e-34
Identity = 69/115 (60.00%), Postives = 85/115 (73.91%), Query Frame = 2
Query:   74 NGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEIT-GKPPMAT-----PYSRRR 400
            +G  ++G KISLIS+A IRYEGILYTID  NSTVAL+KV+SFGTEDR  + P PPR+E+YEYIIFRGSDI+D+ VCE PK     + QDPAI++ + G  P A+     PYS  R
Sbjct:    3 SGTPYIGSKISLISKAQIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPAPPREEVYEYIIFRGSDIKDITVCEPPKAS-HALPQDPAIVQSSLGSAPSASYQSSVPYSPFR 116          
BLAST of Rap55 protein vs. Ensembl Xenopus
Match: rps15 (ribosomal protein S15 [Source:Xenbase;Acc:XB-GENE-5832673])

HSP 1 Score: 135.961 bits (341), Expect = 9.470e-34
Identity = 65/94 (69.15%), Postives = 78/94 (82.98%), Query Frame = 2
Query:   77 GQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQI-MAQDPAILE 355
            G  ++G KISLIS+A IRYEGILYTID  NSTVAL+KV+SFGTEDR  + P+PPRDE++EYIIFRGSDI+DL VCE PK  PQ  + QDPAI++
Sbjct:    4 GTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPK--PQCSLPQDPAIVQ 95          
BLAST of Rap55 protein vs. Ensembl Mouse
Match: Lsm14b (LSM family member 14B [Source:MGI Symbol;Acc:MGI:3040677])

HSP 1 Score: 139.428 bits (350), Expect = 9.288e-36
Identity = 66/105 (62.86%), Postives = 82/105 (78.10%), Query Frame = 2
Query:   74 NGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEITGKPPMATPY 388
            +G  +LG KISLIS+A IRYEGILYTID +NSTVAL+KV+SFGTEDR  + P PPR+EIYEYIIFRGSDI+D+ VCE PK     + QDPAI++ +     A+P+
Sbjct:    5 SGTPYLGSKISLISKAQIRYEGILYTIDTDNSTVALAKVRSFGTEDRPTDRPAPPREEIYEYIIFRGSDIKDITVCEPPKAQ-HTLPQDPAIVQSSLGSASASPF 108          
BLAST of Rap55 protein vs. Ensembl Mouse
Match: Lsm14a (LSM14A mRNA processing body assembly factor [Source:MGI Symbol;Acc:MGI:1914320])

HSP 1 Score: 134.42 bits (337), Expect = 5.698e-35
Identity = 65/92 (70.65%), Postives = 76/92 (82.61%), Query Frame = 2
Query:   77 GQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQI-MAQDPAI 349
            G  ++G KISLIS+A IRYEGILYTID  NSTVAL+KV+SFGTEDR  + P+PPRDE++EYIIFRGSDI+DL VCE PK  PQ  + QDPAI
Sbjct:    4 GTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPK--PQCSLPQDPAI 93          
BLAST of Rap55 protein vs. Ensembl Mouse
Match: Lsm14a (LSM14A mRNA processing body assembly factor [Source:MGI Symbol;Acc:MGI:1914320])

HSP 1 Score: 134.806 bits (338), Expect = 1.256e-33
Identity = 65/92 (70.65%), Postives = 76/92 (82.61%), Query Frame = 2
Query:   77 GQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQI-MAQDPAI 349
            G  ++G KISLIS+A IRYEGILYTID  NSTVAL+KV+SFGTEDR  + P+PPRDE++EYIIFRGSDI+DL VCE PK  PQ  + QDPAI
Sbjct:    4 GTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPK--PQCSLPQDPAI 93          
BLAST of Rap55 protein vs. Ensembl Mouse
Match: Lsm14a (LSM14A mRNA processing body assembly factor [Source:MGI Symbol;Acc:MGI:1914320])

HSP 1 Score: 82.0333 bits (201), Expect = 1.020e-17
Identity = 39/56 (69.64%), Postives = 46/56 (82.14%), Query Frame = 2
Query:  185 KVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQI-MAQDPAI 349
            KV+SFGTEDR  + P+PPRDE++EYIIFRGSDI+DL VCE PK  PQ  + QDPAI
Sbjct:    4 KVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPK--PQCSLPQDPAI 57          
BLAST of Rap55 protein vs. UniProt/SwissProt
Match: sp|Q8CGC4|LS14B_MOUSE (Protein LSM14 homolog B OS=Mus musculus OX=10090 GN=Lsm14b PE=1 SV=3)

HSP 1 Score: 139.428 bits (350), Expect = 6.497e-35
Identity = 66/105 (62.86%), Postives = 82/105 (78.10%), Query Frame = 2
Query:   74 NGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEITGKPPMATPY 388
            +G  +LG KISLIS+A IRYEGILYTID +NSTVAL+KV+SFGTEDR  + P PPR+EIYEYIIFRGSDI+D+ VCE PK     + QDPAI++ +     A+P+
Sbjct:    5 SGTPYLGSKISLISKAQIRYEGILYTIDTDNSTVALAKVRSFGTEDRPTDRPAPPREEIYEYIIFRGSDIKDITVCEPPKAQ-HTLPQDPAIVQSSLGSASASPF 108          
BLAST of Rap55 protein vs. UniProt/SwissProt
Match: sp|Q9BX40|LS14B_HUMAN (Protein LSM14 homolog B OS=Homo sapiens OX=9606 GN=LSM14B PE=1 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 7.679e-35
Identity = 66/105 (62.86%), Postives = 82/105 (78.10%), Query Frame = 2
Query:   74 NGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEITGKPPMATPY 388
            +G  +LG KISLIS+A IRYEGILYTID +NSTVAL+KV+SFGTEDR  + P PPR+EIYEYIIFRGSDI+D+ VCE PK     + QDPAI++ +     A+P+
Sbjct:    5 SGTPYLGSKISLISKAQIRYEGILYTIDTDNSTVALAKVRSFGTEDRPTDRPAPPREEIYEYIIFRGSDIKDITVCEPPKAQ-HTLPQDPAIVQSSLGSASASPF 108          
BLAST of Rap55 protein vs. UniProt/SwissProt
Match: sp|A0A8M2|L14AA_XENLA (Protein LSM14 homolog A-A OS=Xenopus laevis OX=8355 GN=lsm14a-a PE=1 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 8.304e-34
Identity = 66/94 (70.21%), Postives = 78/94 (82.98%), Query Frame = 2
Query:   77 GQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQI-MAQDPAILE 355
            G  ++G KISLIS+A IRYEGILYTID  NSTVAL+KV+SFGTEDR  + P+PPRDEI+EYIIFRGSDI+DL VCE PK  PQ  + QDPAI++
Sbjct:    4 GTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEIFEYIIFRGSDIKDLTVCEPPK--PQCSLPQDPAIVQ 95          
BLAST of Rap55 protein vs. UniProt/SwissProt
Match: sp|Q566L7|LS14B_XENTR (Protein LSM14 homolog B OS=Xenopus tropicalis OX=8364 GN=lsm14b PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 1.391e-33
Identity = 68/112 (60.71%), Postives = 84/112 (75.00%), Query Frame = 2
Query:   74 NGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEIT-GKPPMAT-----PYS 391
            +G  ++G KISLIS+A IRYEGILYTID  NSTVAL+KV+SFGTEDR  + P PPR+E+YEYIIFRGSDI+D+ VCE PK     + QDPAI++ + G  P A+     PYS
Sbjct:    3 SGTPYIGSKISLISKAQIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPAPPREEVYEYIIFRGSDIKDITVCEPPKAS-HALPQDPAIVQSSLGSAPSASYQSSVPYS 113          
BLAST of Rap55 protein vs. UniProt/SwissProt
Match: sp|Q498K9|L14BB_XENLA (Protein LSM14 homolog B-B OS=Xenopus laevis OX=8355 GN=lsm14b-b PE=1 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 1.394e-33
Identity = 62/94 (65.96%), Postives = 77/94 (81.91%), Query Frame = 2
Query:   74 NGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILE 355
            +G  ++G KISLIS+A IRYEGILYTID  NSTVAL+KV+SFGTEDR  + P PPR+E+YEYIIFRGSDI+D+ VCE PK     ++QDPAI++
Sbjct:    3 SGTPYIGSKISLISKAQIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPAPPREEVYEYIIFRGSDIKDITVCEPPKAS-HALSQDPAIVQ 95          
BLAST of Rap55 protein vs. TrEMBL
Match: E2F3W7 (Rap55 protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1024.62 bits (2648), Expect = 0.000e+0
Identity = 516/518 (99.61%), Postives = 516/518 (99.61%), Query Frame = 2
Query:   71 MNGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEITGKPPMATPYSRRRVQFTSRSYQGVDQRDGRDMSYVDDMRSGPYYQGHVDDEVYESWPDRAPSRSYYLRNRAYYPNGSNYSVRNQPVFYPEMQRYNNNRRRSGFNGTGMRNNKVSSVPAPPRRKNAXXXXXXXXXXXXXXXXXGQMSNKLNENAQETSRASSGNSRSTNMSGRPDSQNGLESKYDKDYDFESANAEIAKELERLTLEKNSVSTTTLSECQFVNRDIGPSKNKGPTGDSERIENIEINPESQMNGLRNNTELDQTNSTVSNNNEIITNGPIAKDNGDNVINYDRSKSFYDNISSQATDRAKGKMIRAINWRDERKLNVETFGFNIPNNNRQPSRRNATDSNNTINASNSVNRNIHNIVLPNSFYKHDAFRYQMPQNSFYSPYDMHMSSKYYYQPRWFSRRPDYRAPSYIQAWN 1624
            MNGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEITGKPPMATPYSRRRVQFT RSYQGVDQRDGRDMSYVDDMRSGPYYQGHVDDEVYESWPDRAPSRSYYLRNRAYYPNGSNYSVRNQPVFYPEMQRYNNNRRRSGFNGTGMRNNKVSSVPAPPRRKNATLRRNTRRSSSLNVRSTGQMSNKLNENAQETSRASSGNSRSTNMSGRPDSQNGLESKYDKDYDFESANAEIAKELERLTLEKNSVSTTTLSECQFVNRDIGPSKNKGPTGDSERIENIEINPESQMNGLRNNTELDQTNSTVSNNNEIITNGPIAKDNGDNVINYDRSKSFYDNISSQATDRAKGKMIRAINWRDERKLNVETFGFNIPNNNRQPSRRNATDSNNTINASNSVNRNIHNIVLPNSFYKHDAFRYQMPQNSFYSPYDMHMSSKYYYQPRWFSRRPDYR PSYIQAWN
Sbjct:    1 MNGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEITGKPPMATPYSRRRVQFTPRSYQGVDQRDGRDMSYVDDMRSGPYYQGHVDDEVYESWPDRAPSRSYYLRNRAYYPNGSNYSVRNQPVFYPEMQRYNNNRRRSGFNGTGMRNNKVSSVPAPPRRKNATLRRNTRRSSSLNVRSTGQMSNKLNENAQETSRASSGNSRSTNMSGRPDSQNGLESKYDKDYDFESANAEIAKELERLTLEKNSVSTTTLSECQFVNRDIGPSKNKGPTGDSERIENIEINPESQMNGLRNNTELDQTNSTVSNNNEIITNGPIAKDNGDNVINYDRSKSFYDNISSQATDRAKGKMIRAINWRDERKLNVETFGFNIPNNNRQPSRRNATDSNNTINASNSVNRNIHNIVLPNSFYKHDAFRYQMPQNSFYSPYDMHMSSKYYYQPRWFSRRPDYRVPSYIQAWN 518          
BLAST of Rap55 protein vs. TrEMBL
Match: A0A2T7NGN1 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_18470 PE=4 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 6.547e-35
Identity = 71/103 (68.93%), Postives = 83/103 (80.58%), Query Frame = 2
Query:   77 GQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQ-IMAQDPAIL---EITGKPP 373
            G  +LG KISLIS+A IRYEGILYTID N STVAL+KV+SFGTEDR  + PVPPRDEI+EYIIFRGSDI+DLHVCE PK+ P   + QDPAI+   + +G PP
Sbjct:    4 GIPYLGSKISLISKAEIRYEGILYTIDPNESTVALAKVRSFGTEDRPTDRPVPPRDEIFEYIIFRGSDIKDLHVCEPPKQQPMGGLPQDPAIVKSSQQSGGPP 106          
BLAST of Rap55 protein vs. TrEMBL
Match: A0A3M7Q2B1 (LSM14-like protein (Fragment) OS=Brachionus plicatilis OX=10195 GN=BpHYR1_047935 PE=4 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.269e-34
Identity = 66/106 (62.26%), Postives = 79/106 (74.53%), Query Frame = 2
Query:   71 MNGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEA------PKKHPQIMAQDPAILEITGKP 370
            M    +LG KISL+S+A IRYEGILYTID N STVAL+KV+SFGTEDR  + PVPPRDE++EYIIFRGSDI+DLHVCE       P + P  + QDPAI+  +  P
Sbjct:    1 MATTPYLGSKISLVSKAKIRYEGILYTIDTNESTVALAKVRSFGTEDRPTDRPVPPRDEVFEYIIFRGSDIEDLHVCEPYPAAKQPNQLPSGLMQDPAIVTTSSGP 106          
BLAST of Rap55 protein vs. TrEMBL
Match: A0A4W5LII5 (LSM14 domain-containing protein OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 2.940e-34
Identity = 66/100 (66.00%), Postives = 78/100 (78.00%), Query Frame = 2
Query:   74 NGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEITGKPP 373
             G  ++G KISLIS+A IRYEGILYTID  NSTVAL+KV+SFGTEDR  + P+PPRDEI+EYIIFRGSDI+DL VCE PK     + QDPAI++    PP
Sbjct:   41 GGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEIFEYIIFRGSDIKDLTVCEPPKPTCS-LPQDPAIVQAAPAPP 139          
BLAST of Rap55 protein vs. TrEMBL
Match: A0A4W5PCL3 (LSM family member 14B OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 3.517e-34
Identity = 64/94 (68.09%), Postives = 78/94 (82.98%), Query Frame = 2
Query:   74 NGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILE 355
             G  ++G KISLIS+AGIRYEGILYTID +N+TVAL+KVKSFGTE R  + PVPP+D+IYEYIIFRGSDI+D+ VCE PK H   + QDPAI++
Sbjct:    3 TGTPYIGSKISLISKAGIRYEGILYTIDTDNATVALAKVKSFGTEGRPTDRPVPPKDDIYEYIIFRGSDIKDITVCEPPKPH-HGLPQDPAIVQ 95          
BLAST of Rap55 protein vs. Ensembl Cavefish
Match: lsm14ab (LSM14A mRNA processing body assembly factor [Source:NCBI gene;Acc:103042286])

HSP 1 Score: 133.65 bits (335), Expect = 3.219e-33
Identity = 66/108 (61.11%), Postives = 81/108 (75.00%), Query Frame = 2
Query:   77 GQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEI---TGKPPMATPYS 391
            G  ++G KISLIS+A IRYEG+LYTID  NSTVAL+KVKSFGTEDR  + PV PRD+++EYIIFRGSDI+DL VCE PK +   + QDPAI++    +  PP   P S
Sbjct:    4 GTPYIGSKISLISKAEIRYEGVLYTIDTENSTVALAKVKSFGTEDRPTDRPVAPRDDVFEYIIFRGSDIKDLTVCEPPKPNCS-LPQDPAIVQSSLGSSAPPSFQPVS 110          

HSP 2 Score: 50.447 bits (119), Expect = 3.731e-6
Identity = 45/152 (29.61%), Postives = 66/152 (43.42%), Query Frame = 2
Query:  905 KYDKDYDFESANAEIAKELERLTLEKNSVSTTTLSECQFVNRDIGPSKNKGPTGDSERIENIEINPESQMNGLRNNTELDQTNSTVSNNNEIITNGPIAKDNGDNVINYDRSKSFYDNISSQATDRAKGKMIRA--INWRDERKLNVETFGF 1354
            K++KD+DFESANA+  KE                        +I          D E    ++I  E  +NG       D    T ++  ++    P+    G N   YD+SKSF+DNIS   T + +G + R     W +ER++N ETFG 
Sbjct:  310 KFEKDFDFESANAQFNKE------------------------EI----------DREFQSKLKIKDEKAVNGEEKG---DSGVETQNSEGKVEEEDPL----GPNCY-YDKSKSFFDNISCDDTRKERGGVGRERRQTWAEERRMNSETFGI 419          
BLAST of Rap55 protein vs. Ensembl Cavefish
Match: lsm14ab (LSM14A mRNA processing body assembly factor [Source:NCBI gene;Acc:103042286])

HSP 1 Score: 132.88 bits (333), Expect = 4.029e-33
Identity = 66/109 (60.55%), Postives = 81/109 (74.31%), Query Frame = 2
Query:   74 NGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEI---TGKPPMATPYS 391
             G  ++G KISLIS+A IRYEG+LYTID  NSTVAL+KVKSFGTEDR  + PV PRD+++EYIIFRGSDI+DL VCE PK +   + QDPAI++    +  PP   P S
Sbjct:    3 GGTPYIGSKISLISKAEIRYEGVLYTIDTENSTVALAKVKSFGTEDRPTDRPVAPRDDVFEYIIFRGSDIKDLTVCEPPKPNCS-LPQDPAIVQSSLGSSAPPSFQPVS 110          

HSP 2 Score: 50.8322 bits (120), Expect = 2.796e-6
Identity = 45/154 (29.22%), Postives = 67/154 (43.51%), Query Frame = 2
Query:  905 KYDKDYDFESANAEIAKELERLTLEKNSVSTTTLSECQFVNRDIGPSKNKGPTGDSERIENIEINPESQMNGLRNNTELDQTNSTVSNNNEIITNGPIAKDNGDNVINYDRSKSFYDNISSQATDRAKGKMIRA--INWRDERKLNVETFGFNI 1360
            K++KD+DFESANA+  KE                        +I          D E    ++I  E  +NG       D    T ++  ++    P+    G N   YD+SKSF+DNIS   T + +G + R     W +ER++N ETFG  +
Sbjct:  275 KFEKDFDFESANAQFNKE------------------------EI----------DREFQSKLKIKDEKAVNGEEKG---DSGVETQNSEGKVEEEDPL----GPNCY-YDKSKSFFDNISCDDTRKERGGVGRERRQTWAEERRMNSETFGIPM 386          
BLAST of Rap55 protein vs. Ensembl Cavefish
Match: lsm14ab (LSM14A mRNA processing body assembly factor [Source:NCBI gene;Acc:103042286])

HSP 1 Score: 133.65 bits (335), Expect = 4.347e-33
Identity = 66/108 (61.11%), Postives = 81/108 (75.00%), Query Frame = 2
Query:   77 GQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEI---TGKPPMATPYS 391
            G  ++G KISLIS+A IRYEG+LYTID  NSTVAL+KVKSFGTEDR  + PV PRD+++EYIIFRGSDI+DL VCE PK +   + QDPAI++    +  PP   P S
Sbjct:    4 GTPYIGSKISLISKAEIRYEGVLYTIDTENSTVALAKVKSFGTEDRPTDRPVAPRDDVFEYIIFRGSDIKDLTVCEPPKPNCS-LPQDPAIVQSSLGSSAPPSFQPVS 110          

HSP 2 Score: 50.8322 bits (120), Expect = 3.371e-6
Identity = 45/154 (29.22%), Postives = 67/154 (43.51%), Query Frame = 2
Query:  905 KYDKDYDFESANAEIAKELERLTLEKNSVSTTTLSECQFVNRDIGPSKNKGPTGDSERIENIEINPESQMNGLRNNTELDQTNSTVSNNNEIITNGPIAKDNGDNVINYDRSKSFYDNISSQATDRAKGKMIRA--INWRDERKLNVETFGFNI 1360
            K++KD+DFESANA+  KE                        +I          D E    ++I  E  +NG       D    T ++  ++    P+    G N   YD+SKSF+DNIS   T + +G + R     W +ER++N ETFG  +
Sbjct:  310 KFEKDFDFESANAQFNKE------------------------EI----------DREFQSKLKIKDEKAVNGEEKG---DSGVETQNSEGKVEEEDPL----GPNCY-YDKSKSFFDNISCDDTRKERGGVGRERRQTWAEERRMNSETFGIPM 421          
BLAST of Rap55 protein vs. Ensembl Cavefish
Match: lsm14aa (protein LSM14 homolog A-like [Source:NCBI gene;Acc:103031607])

HSP 1 Score: 131.339 bits (329), Expect = 1.643e-32
Identity = 63/93 (67.74%), Postives = 74/93 (79.57%), Query Frame = 2
Query:   77 GQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILE 355
            G  ++G KISLIS+A IRYEGILYTID  NSTVAL+KV+SFGTEDR  + P+ PRDE YEYIIFRGSDI+DL VCE PK     + QDPAI++
Sbjct:    4 GTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPILPRDETYEYIIFRGSDIKDLTVCEPPKP---TLPQDPAIVQ 93          
BLAST of Rap55 protein vs. Ensembl Cavefish
Match: lsm14aa (protein LSM14 homolog A-like [Source:NCBI gene;Acc:103031607])

HSP 1 Score: 129.798 bits (325), Expect = 3.721e-32
Identity = 63/93 (67.74%), Postives = 74/93 (79.57%), Query Frame = 2
Query:   77 GQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILE 355
            G  ++G KISLIS+A IRYEGILYTID  NSTVAL+KV+SFGTEDR  + P+ PRDE YEYIIFRGSDI+DL VCE PK     + QDPAI++
Sbjct:    4 GTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPILPRDETYEYIIFRGSDIKDLTVCEPPKP---TLPQDPAIVQ 93          
BLAST of Rap55 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005960.1 (pep scaffold:Pmarinus_7.0:GL480662:10110:19118:-1 gene:ENSPMAG00000005377.1 transcript:ENSPMAT00000005960.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.724 bits (330), Expect = 2.138e-33
Identity = 65/96 (67.71%), Postives = 78/96 (81.25%), Query Frame = 2
Query:   71 MNGQA-FLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILE 355
            M+G+  ++G KISLIS+A IRYEGILYTID  NSTVAL+KV+SFGTEDR  E PV PRDEI+EYI+FRGSDI+D+ V E PK  PQ   QDPAI++
Sbjct:    1 MSGETPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTERPVAPRDEIFEYIVFRGSDIKDITVREPPK--PQRTPQDPAIVQ 94          
BLAST of Rap55 protein vs. Ensembl Yeast
Match: SCD6 (Repressor of translation initiation; binds eIF4G through its RGG domain and inhibits recruitment of the preinitiation complex; also contains an Lsm domain; may have a role in RNA processing; overproduction suppresses null mutation in clathrin heavy chain gene CHC1; forms cytoplasmic foci upon DNA replication stress [Source:SGD;Acc:S000006333])

HSP 1 Score: 58.9214 bits (141), Expect = 8.008e-10
Identity = 29/76 (38.16%), Postives = 44/76 (57.89%), Query Frame = 2
Query:   86 FLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDR--YAETPVPPRDEIYEYIIFRGSDIQDLHVCEA 307
            ++G  ISLIS    RY G+L  ID+   TV L +V+ FGTE R  +    + P   +Y  + F GS+++DL + +A
Sbjct:    4 YIGKTISLISVTDNRYVGLLEDIDSEKGTVTLKEVRCFGTEGRKNWGPEEIYPNPTVYNSVKFNGSEVKDLSILDA 79          
BLAST of Rap55 protein vs. Ensembl Nematostella
Match: EDO49317 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHB0])

HSP 1 Score: 91.2781 bits (225), Expect = 1.312e-22
Identity = 41/71 (57.75%), Postives = 54/71 (76.06%), Query Frame = 2
Query:   86 FLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHV 298
            ++G  I+L+S+A IRY G LY ID   STV L+ V+SFGTE R  +  +PPR+EIYEYI+FRG DI+DL+V
Sbjct:    7 YIGSIINLVSKAEIRYVGTLYAIDTKESTVTLANVRSFGTEGRKVDVEIPPRNEIYEYIVFRGQDIKDLNV 77          
BLAST of Rap55 protein vs. Ensembl Medaka
Match: ENSORLT00000039753.1 (pep primary_assembly:ASM223467v1:3:30569759:30570647:-1 gene:ENSORLG00000028980.1 transcript:ENSORLT00000039753.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.88 bits (333), Expect = 1.469e-36
Identity = 62/96 (64.58%), Postives = 78/96 (81.25%), Query Frame = 2
Query:   74 NGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEIT 361
             G  ++G KISLIS+A IRYEGILYTID  NSTVAL+KV+SFGTEDR  + P+PPR+E++EYIIFRGSDI+DL VCE PK     + QDPAI++++
Sbjct:    4 GGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPREEVFEYIIFRGSDIKDLTVCEPPKATSS-LPQDPAIVQVS 98          
BLAST of Rap55 protein vs. Ensembl Medaka
Match: lsm14b (protein LSM14 homolog B-B [Source:NCBI gene;Acc:101155509])

HSP 1 Score: 127.102 bits (318), Expect = 1.160e-31
Identity = 63/113 (55.75%), Postives = 82/113 (72.57%), Query Frame = 2
Query:   65 ATMNGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEITGKP-----PMATPY 388
            +   G  ++G KISLIS+A IRYEGIL ++D   STVAL+KVKS+GTEDR+ + PVPP+DEIYEYIIFRGSDI+D+ V E PK H   + +DPAI++ +  P     P  +PY
Sbjct:    2 SATGGTPYIGSKISLISKAQIRYEGILSSVDTERSTVALAKVKSYGTEDRHTDRPVPPKDEIYEYIIFRGSDIKDITVSEPPKPH-MGLPRDPAIVQSSLGPSAGYHPRWSPY 113          
BLAST of Rap55 protein vs. Ensembl Medaka
Match: LSM14B (protein LSM14 homolog A [Source:NCBI gene;Acc:101155350])

HSP 1 Score: 119.013 bits (297), Expect = 8.412e-29
Identity = 55/100 (55.00%), Postives = 71/100 (71.00%), Query Frame = 2
Query:   74 NGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEITGKPP 373
            + + ++GCKI LIS+A  RYEGILYTID  NSTV L+KVK FGTE R A+ P+PP++E+YEYI FRGSDI D+ +CE    H   +  DPAI+  +   P
Sbjct:    3 SAKPYIGCKIGLISKAQNRYEGILYTIDKINSTVVLAKVKCFGTEGRPADRPLPPKNEVYEYITFRGSDIMDIGLCEPAAYHHSSLPSDPAIIHSSSAIP 102          
BLAST of Rap55 protein vs. Planmine SMEST
Match: SMESG000020999.1 (SMESG000020999.1)

HSP 1 Score: 1073.92 bits (2776), Expect = 0.000e+0
Identity = 537/541 (99.26%), Postives = 538/541 (99.45%), Query Frame = 2
Query:    2 IILNCCLDIIRNFKSKFIDCRATMNGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEITGKPPMATPYSRRRVQFTSRSYQGVDQRDGRDMSYVDDMRSGPYYQGHVDDEVYESWPDRAPSRSYYLRNRAYYPNGSNYSVRNQPVFYPEMQRYNNNRRRSGFNGTGMRNNKVSSVPAPPRRKNAXXXXXXXXXXXXXXXXXGQMSNKLNENAQETSRASSGNSRSTNMSGRPDSQNGLESKYDKDYDFESANAEIAKELERLTLEKNSVSTTTLSECQFVNRDIGPSKNKGPTGDSERIENIEINPESQMNGLRNNTELDQTNSTVSNNNEIITNGPIAKDNGDNVINYDRSKSFYDNISSQATDRAKGKMIRAINWRDERKLNVETFGFNIPNNNRQPSRRNATDSNNTINASNSVNRNIHNIVLPNSFYKHDAFRYQMPQNSFYSPYDMHMSSKYYYQPRWFSRRPDYRAPSYIQAWN 1624
            IILNC LDIIRNFKSKFIDCRATMNGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEITGKPPMATPYSRRRVQFT RSYQGVD+RDGRDMSYVDDMRSGPYYQGHVDDEVYESWPDRAPSRSYYLRNRAYYPNGSNYSVRNQPVFYPEMQRYNNNRRRSGFNGTGMRNNKVSSVPAPPRRKNATLRRNTRRSSSLNVRSTGQMSNKLNENAQETSRASSGNSRSTNMSGRPDSQNGLESKYDKDYDFESANAEIAKELERLTLEKNSVSTTTLSECQFVNRDIGPSKNKGPTGDSERIENIEINPESQMNGLRNNTELDQTNSTVSNNNEIITNGPIAKDNGDNVINYDRSKSFYDNISSQATDRAKGKMIRAINWRDERKLNVETFGFNIPNNNRQPSRRNATDSNNTINASNSVNRNIHNIVLPNSFYKHDAFRYQMPQNSFYSPYDMHMSSKYYYQPRWFSRRPDYR PSYIQAWN
Sbjct:  123 IILNCYLDIIRNFKSKFIDCRATMNGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEITGKPPMATPYSRRRVQFTPRSYQGVDERDGRDMSYVDDMRSGPYYQGHVDDEVYESWPDRAPSRSYYLRNRAYYPNGSNYSVRNQPVFYPEMQRYNNNRRRSGFNGTGMRNNKVSSVPAPPRRKNATLRRNTRRSSSLNVRSTGQMSNKLNENAQETSRASSGNSRSTNMSGRPDSQNGLESKYDKDYDFESANAEIAKELERLTLEKNSVSTTTLSECQFVNRDIGPSKNKGPTGDSERIENIEINPESQMNGLRNNTELDQTNSTVSNNNEIITNGPIAKDNGDNVINYDRSKSFYDNISSQATDRAKGKMIRAINWRDERKLNVETFGFNIPNNNRQPSRRNATDSNNTINASNSVNRNIHNIVLPNSFYKHDAFRYQMPQNSFYSPYDMHMSSKYYYQPRWFSRRPDYRVPSYIQAWN 663          
BLAST of Rap55 protein vs. Planmine SMEST
Match: SMESG000020999.1 (SMESG000020999.1)

HSP 1 Score: 1023.46 bits (2645), Expect = 0.000e+0
Identity = 515/518 (99.42%), Postives = 516/518 (99.61%), Query Frame = 2
Query:   71 MNGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEITGKPPMATPYSRRRVQFTSRSYQGVDQRDGRDMSYVDDMRSGPYYQGHVDDEVYESWPDRAPSRSYYLRNRAYYPNGSNYSVRNQPVFYPEMQRYNNNRRRSGFNGTGMRNNKVSSVPAPPRRKNAXXXXXXXXXXXXXXXXXGQMSNKLNENAQETSRASSGNSRSTNMSGRPDSQNGLESKYDKDYDFESANAEIAKELERLTLEKNSVSTTTLSECQFVNRDIGPSKNKGPTGDSERIENIEINPESQMNGLRNNTELDQTNSTVSNNNEIITNGPIAKDNGDNVINYDRSKSFYDNISSQATDRAKGKMIRAINWRDERKLNVETFGFNIPNNNRQPSRRNATDSNNTINASNSVNRNIHNIVLPNSFYKHDAFRYQMPQNSFYSPYDMHMSSKYYYQPRWFSRRPDYRAPSYIQAWN 1624
            MNGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEITGKPPMATPYSRRRVQFT RSYQGVD+RDGRDMSYVDDMRSGPYYQGHVDDEVYESWPDRAPSRSYYLRNRAYYPNGSNYSVRNQPVFYPEMQRYNNNRRRSGFNGTGMRNNKVSSVPAPPRRKNATLRRNTRRSSSLNVRSTGQMSNKLNENAQETSRASSGNSRSTNMSGRPDSQNGLESKYDKDYDFESANAEIAKELERLTLEKNSVSTTTLSECQFVNRDIGPSKNKGPTGDSERIENIEINPESQMNGLRNNTELDQTNSTVSNNNEIITNGPIAKDNGDNVINYDRSKSFYDNISSQATDRAKGKMIRAINWRDERKLNVETFGFNIPNNNRQPSRRNATDSNNTINASNSVNRNIHNIVLPNSFYKHDAFRYQMPQNSFYSPYDMHMSSKYYYQPRWFSRRPDYR PSYIQAWN
Sbjct:    1 MNGQAFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEITGKPPMATPYSRRRVQFTPRSYQGVDERDGRDMSYVDDMRSGPYYQGHVDDEVYESWPDRAPSRSYYLRNRAYYPNGSNYSVRNQPVFYPEMQRYNNNRRRSGFNGTGMRNNKVSSVPAPPRRKNATLRRNTRRSSSLNVRSTGQMSNKLNENAQETSRASSGNSRSTNMSGRPDSQNGLESKYDKDYDFESANAEIAKELERLTLEKNSVSTTTLSECQFVNRDIGPSKNKGPTGDSERIENIEINPESQMNGLRNNTELDQTNSTVSNNNEIITNGPIAKDNGDNVINYDRSKSFYDNISSQATDRAKGKMIRAINWRDERKLNVETFGFNIPNNNRQPSRRNATDSNNTINASNSVNRNIHNIVLPNSFYKHDAFRYQMPQNSFYSPYDMHMSSKYYYQPRWFSRRPDYRVPSYIQAWN 518          
BLAST of Rap55 protein vs. Planmine SMEST
Match: SMESG000014632.1 (SMESG000014632.1)

HSP 1 Score: 144.05 bits (362), Expect = 6.006e-37
Identity = 69/101 (68.32%), Postives = 81/101 (80.20%), Query Frame = 2
Query:   83 AFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAIL----EITGKPP 373
            +F+GCKISLIS+AGIRYEGILYTID   STVALSKVKSFGTEDR  +  +PPRDEIYEYIIFRGSDIQDL+VCE P K   ++++D AI+     I+G  P
Sbjct:    3 SFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCE-PSKESSLLSEDSAIVRAETSISGNLP 102          

HSP 2 Score: 67.0106 bits (162), Expect = 1.678e-11
Identity = 52/175 (29.71%), Postives = 76/175 (43.43%), Query Frame = 2
Query:  848 NSRSTNMSGRPDSQNGLESKYDKDYDFESANAEIAKELERLTLEKNSVSTTTLSECQFVNRDIGPSKNKGPTGDSERIENIEINPESQMNGLRNNTELDQTNSTVSNNNEIITNGPIAKDNGDNVINYDRSKSFYDNISSQATDRAKGKMIRAINWRDERKLNVETFGFNIPNNN 1372
            N +S   S R +  +  +  + +DYDFE+ANA IAKEL  L +                                           SQ      + E ++ +  +S+N+E                 YD++KSF+DNISS+  DRA GK +R +N ++ERK+NVETFG    N N
Sbjct:  307 NPKSKKKSSRENETSKKDESFKEDYDFETANAIIAKELAALHV-------------------------------------------SQEKKDVKDDECEKEDGQLSDNSEAGY--------------YDKTKSFFDNISSEMMDRANGKSVRQLNRKEERKINVETFGMAEANRN 424          
BLAST of Rap55 protein vs. Planmine SMEST
Match: SMESG000033950.1 (SMESG000033950.1)

HSP 1 Score: 133.265 bits (334), Expect = 1.536e-33
Identity = 67/101 (66.34%), Postives = 78/101 (77.23%), Query Frame = 2
Query:   86 FLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEI-----TGKPP 373
            FLG KISLIS+AGIRYEGILYTID   STVALSKVKSFGTEDR +E  + PRDE+YEYIIFRGSDI+DLHVCE       + ++D AI++I     T +PP
Sbjct:    4 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCEN-----SLYSEDSAIVKIMSPNFTNQPP 99          
The following BLAST results are available for this feature:
BLAST of Rap55 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LSM14B7.604e-3762.86LSM family member 14B [Source:HGNC Symbol;Acc:HGNC... [more]
LSM14A1.234e-3668.42LSM14A mRNA processing body assembly factor [Sourc... [more]
LSM14A1.234e-3668.42LSM14A mRNA processing body assembly factor [Sourc... [more]
LSM14B1.567e-3665.66LSM family member 14B [Source:HGNC Symbol;Acc:HGNC... [more]
LSM14B1.871e-3662.86LSM family member 14B [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Rap55 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
car-11.309e-2753.47Cytokinesis, Apoptosis, RNA-associated [Source:Un... [more]
back to top
BLAST of Rap55 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tral1.379e-2151.52gene:FBgn0041775 transcript:FBtr0332638[more]
tral1.382e-2151.52gene:FBgn0041775 transcript:FBtr0332640[more]
tral1.504e-2151.52gene:FBgn0041775 transcript:FBtr0332639[more]
tral1.650e-2153.93gene:FBgn0041775 transcript:FBtr0332642[more]
tral1.669e-2151.52gene:FBgn0041775 transcript:FBtr0332635[more]
back to top
BLAST of Rap55 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lsm14ab6.469e-3466.32LSM14A mRNA processing body assembly factor b [Sou... [more]
lsm14ab6.998e-3466.32LSM14A mRNA processing body assembly factor b [Sou... [more]
lsm14aa1.274e-3365.96LSM14A mRNA processing body assembly factor a [Sou... [more]
lsm14aa9.790e-3371.25LSM14A mRNA processing body assembly factor a [Sou... [more]
lsm14b2.110e-3265.96LSM family member 14B [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of Rap55 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps152.560e-3469.15ribosomal protein S15 [Source:Xenbase;Acc:XB-GENE-... [more]
lsm14b4.519e-3460.00LSM family member 14B [Source:NCBI gene;Acc:595068... [more]
rps157.505e-3469.15ribosomal protein S15 [Source:Xenbase;Acc:XB-GENE-... [more]
lsm14b7.624e-3460.00LSM family member 14B [Source:NCBI gene;Acc:595068... [more]
rps159.470e-3469.15ribosomal protein S15 [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of Rap55 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Lsm14b9.288e-3662.86LSM family member 14B [Source:MGI Symbol;Acc:MGI:3... [more]
Lsm14a5.698e-3570.65LSM14A mRNA processing body assembly factor [Sourc... [more]
Lsm14a1.256e-3370.65LSM14A mRNA processing body assembly factor [Sourc... [more]
Lsm14a1.020e-1769.64LSM14A mRNA processing body assembly factor [Sourc... [more]
back to top
BLAST of Rap55 protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8CGC4|LS14B_MOUSE6.497e-3562.86Protein LSM14 homolog B OS=Mus musculus OX=10090 G... [more]
sp|Q9BX40|LS14B_HUMAN7.679e-3562.86Protein LSM14 homolog B OS=Homo sapiens OX=9606 GN... [more]
sp|A0A8M2|L14AA_XENLA8.304e-3470.21Protein LSM14 homolog A-A OS=Xenopus laevis OX=835... [more]
sp|Q566L7|LS14B_XENTR1.391e-3360.71Protein LSM14 homolog B OS=Xenopus tropicalis OX=8... [more]
sp|Q498K9|L14BB_XENLA1.394e-3365.96Protein LSM14 homolog B-B OS=Xenopus laevis OX=835... [more]
back to top
BLAST of Rap55 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E2F3W70.000e+099.61Rap55 protein (Fragment) OS=Schmidtea mediterranea... [more]
A0A2T7NGN16.547e-3568.93Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A3M7Q2B11.269e-3462.26LSM14-like protein (Fragment) OS=Brachionus plicat... [more]
A0A4W5LII52.940e-3466.00LSM14 domain-containing protein OS=Hucho hucho OX=... [more]
A0A4W5PCL33.517e-3468.09LSM family member 14B OS=Hucho hucho OX=62062 PE=4... [more]
back to top
BLAST of Rap55 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lsm14ab3.219e-3361.11LSM14A mRNA processing body assembly factor [Sourc... [more]
lsm14ab4.029e-3360.55LSM14A mRNA processing body assembly factor [Sourc... [more]
lsm14ab4.347e-3361.11LSM14A mRNA processing body assembly factor [Sourc... [more]
lsm14aa1.643e-3267.74protein LSM14 homolog A-like [Source:NCBI gene;Acc... [more]
lsm14aa3.721e-3267.74protein LSM14 homolog A-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of Rap55 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005960.12.138e-3367.71pep scaffold:Pmarinus_7.0:GL480662:10110:19118:-1 ... [more]
back to top
BLAST of Rap55 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SCD68.008e-1038.16Repressor of translation initiation; binds eIF4G t... [more]
back to top
BLAST of Rap55 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO493171.312e-2257.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Rap55 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000039753.11.469e-3664.58pep primary_assembly:ASM223467v1:3:30569759:305706... [more]
lsm14b1.160e-3155.75protein LSM14 homolog B-B [Source:NCBI gene;Acc:10... [more]
LSM14B8.412e-2955.00protein LSM14 homolog A [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Rap55 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000020999.10.000e+099.26SMESG000020999.1[more]
SMESG000020999.10.000e+099.42SMESG000020999.1[more]
SMESG000014632.16.006e-3768.32SMESG000014632.1[more]
SMESG000033950.11.536e-3366.34SMESG000033950.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30019490
GenBankADK78221.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019490 ID=SMED30019490|Name=Rap55 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1760bp
TATTATTTTGAATTGCTGCCTTGACATTATTCGAAATTTCAAATCTAAAT
TCATTGATTGTCGCGCAACTATGAATGGACAGGCTTTTCTTGGTTGCAAA
ATTAGTCTAATCTCAAGAGCAGGAATCCGCTACGAAGGAATTCTCTACAC
GATTGATGCTAACAATTCCACTGTAGCTTTGTCAAAGGTCAAATCCTTTG
GAACAGAAGACCGTTACGCCGAAACTCCGGTGCCGCCTCGGGATGAAATA
TACGAATATATCATTTTCCGTGGATCCGATATTCAGGACCTCCATGTGTG
CGAGGCTCCGAAAAAGCATCCCCAGATTATGGCGCAAGATCCAGCAATAC
TTGAGATTACTGGCAAACCTCCGATGGCCACTCCCTATTCAAGGCGACGA
GTACAATTCACTTCAAGATCGTATCAAGGTGTCGATCAAAGAGATGGAAG
AGATATGTCTTATGTTGATGACATGAGATCCGGTCCCTATTACCAAGGAC
ATGTGGACGATGAAGTGTACGAATCTTGGCCAGACAGAGCTCCATCAAGA
TCATACTATCTCAGAAATAGAGCTTATTATCCTAATGGAAGTAATTATTC
AGTAAGAAACCAACCAGTTTTCTATCCTGAAATGCAGCGATATAACAATA
ATCGGAGAAGATCCGGTTTTAATGGAACCGGAATGAGAAACAATAAAGTA
TCTTCAGTACCAGCTCCACCAAGGCGAAAGAATGCAACTCTTCGGCGTAA
TACAAGACGTTCTTCAAGTTTAAATGTTCGAAGTACCGGCCAAATGTCAA
ATAAGCTTAACGAAAATGCCCAGGAAACCTCTAGAGCATCAAGCGGAAAC
TCAAGATCCACAAATATGTCTGGTAGACCAGATAGCCAAAATGGCTTAGA
ATCGAAATATGACAAAGATTACGATTTCGAATCGGCAAACGCTGAGATTG
CCAAAGAACTGGAGCGGCTGACCTTAGAGAAAAATTCAGTTTCAACGACA
ACATTATCAGAGTGTCAATTTGTCAATCGCGACATTGGGCCATCTAAAAA
CAAAGGTCCAACGGGAGACAGCGAGAGAATAGAGAATATCGAAATAAATC
CTGAATCACAAATGAATGGGCTTAGAAACAACACAGAACTAGATCAAACA
AACTCAACCGTTTCAAACAATAATGAAATAATTACCAACGGGCCAATAGC
TAAAGATAATGGTGACAATGTCATTAACTATGATCGCTCGAAATCCTTTT
ATGATAATATCAGTTCACAGGCCACTGATAGAGCAAAAGGAAAAATGATT
CGTGCTATAAATTGGCGAGACGAGCGCAAACTAAACGTAGAAACGTTCGG
TTTCAATATTCCAAACAATAATCGTCAGCCGAGTAGAAGAAATGCCACGG
ATTCTAACAATACGATAAATGCTTCAAATTCTGTTAATAGAAATATACAT
AACATTGTTTTACCAAACTCCTTTTATAAACATGATGCTTTCCGATATCA
AATGCCTCAAAACTCTTTTTACTCTCCATATGATATGCACATGTCTAGTA
AGTACTATTATCAACCTCGATGGTTTTCTAGACGCCCCGACTATCGGGCC
CCGTCATATATTCAAGCTTGGAATTGATCATCGAGATACCTTGAAGACAC
ACATGATCCTTCAATACATCGTGAACTTTTCAATGTTTAGTATTGTTAGA
ATTGTGTTAGTAAGCCATACAATTTTCATTAATACTGAAGTTGGTTTTGA
CAGAATTTGC
back to top

protein sequence of SMED30019490-orf-1

>SMED30019490-orf-1 ID=SMED30019490-orf-1|Name=SMED30019490-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=542bp
IILNCCLDIIRNFKSKFIDCRATMNGQAFLGCKISLISRAGIRYEGILYT
IDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVC
EAPKKHPQIMAQDPAILEITGKPPMATPYSRRRVQFTSRSYQGVDQRDGR
DMSYVDDMRSGPYYQGHVDDEVYESWPDRAPSRSYYLRNRAYYPNGSNYS
VRNQPVFYPEMQRYNNNRRRSGFNGTGMRNNKVSSVPAPPRRKNATLRRN
TRRSSSLNVRSTGQMSNKLNENAQETSRASSGNSRSTNMSGRPDSQNGLE
SKYDKDYDFESANAEIAKELERLTLEKNSVSTTTLSECQFVNRDIGPSKN
KGPTGDSERIENIEINPESQMNGLRNNTELDQTNSTVSNNNEIITNGPIA
KDNGDNVINYDRSKSFYDNISSQATDRAKGKMIRAINWRDERKLNVETFG
FNIPNNNRQPSRRNATDSNNTINASNSVNRNIHNIVLPNSFYKHDAFRYQ
MPQNSFYSPYDMHMSSKYYYQPRWFSRRPDYRAPSYIQAWN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:1990904ribonucleoprotein complex
GO:0005575cellular_component
GO:0030529intracellular ribonucleoprotein complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0000220spermatogonium
PLANA:0002030early male germ cell
PLANA:0002089reproductive organ
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR019050FDF_dom
IPR025609Lsm14-like_N
IPR025762DFDF
IPR025761FFD_box
IPR025768TFG_box
IPR010920LSM_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
Vocabulary: biological process
TermDefinition
GO:0006417regulation of translation
GO:0007275multicellular organism development
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019050FDF domainSMARTSM01199FDF_2coord: 301..453
e-value: 3.4E-10
score: 49.9
IPR019050FDF domainPFAMPF09532FDFcoord: 374..451
e-value: 1.8E-7
score: 32.0
IPR025609Lsm14-like, N-terminalSMARTSM01271LSM14_2coord: 24..121
e-value: 2.2E-45
score: 166.8
IPR025609Lsm14-like, N-terminalPFAMPF12701LSM14coord: 29..101
e-value: 1.2E-29
score: 102.2
IPR025609Lsm14-like, N-terminalCDDcd01736LSm14_Ncoord: 26..99
e-value: 1.30253E-33
score: 120.0
NoneNo IPR availableGENE3DG3DSA:2.30.30.100coord: 14..106
e-value: 1.2E-35
score: 123.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 219..233
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 250..297
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 219..301
NoneNo IPR availablePANTHERPTHR13586SCD6 PROTEIN-RELATEDcoord: 26..464
NoneNo IPR availablePANTHERPTHR13586:SF0TRAILER HITCH, ISOFORM Hcoord: 26..464
IPR025768TFG boxPROSITEPS51536TFGcoord: 433..453
score: 11.503
IPR025761FFD boxPROSITEPS51513FFDcoord: 408..424
score: 13.096
IPR025762DFDF domainPROSITEPS51512DFDFcoord: 295..331
score: 9.371
IPR010920LSM domain superfamilySUPERFAMILYSSF50182Sm-like ribonucleoproteinscoord: 29..104