Phosphodiesterase

Overview
NamePhosphodiesterase
Smed IDSMED30019487
Uniprot Best hitHigh affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A OS=Homo sapiens OX=9606 GN=PDE8A PE=1 SV=2 (E=8.89158e-110)
Length (bp)2866
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphodiesterase (SMED30019487) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphodiesterase (SMED30019487) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphodiesterase (SMED30019487) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphodiesterase (SMED30019487) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019487

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30019487SMESG000054903.1 SMESG000054878.1 Contig2366newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019487SMESG000073280.1 Contig2366newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30019487SMESG000054903.1 SMESG000054901.1 SMESG000054878.1 SMESG000044092.1 dd_Smed_v4_10593_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019487SMESG000054903.1 SMESG000054901.1 SMESG000054878.1 SMESG000044092.1 dd_Smed_v4_10593_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019487SMESG000054903.1 SMESG000054901.1 SMESG000054878.1 SMESG000044092.1 dd_Smed_v4_10593_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30019487SMESG000054903.1 SMESG000054901.1 SMESG000054878.1 SMESG000044092.1 dd_Smed_v4_10593_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30019487SMESG000054903.1 SMESG000054901.1 SMESG000054878.1 SMESG000044092.1 dd_Smed_v4_10593_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019487SMESG000054903.1 SMESG000054901.1 SMESG000054878.1 SMESG000044092.1 dd_Smed_v4_10593_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30019487SMESG000054903.1 SMESG000054901.1 SMESG000054878.1 SMESG000044092.1 dd_Smed_v4_10593_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30019487SMESG000054903.1 Contig44243uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30019487SMESG000054903.1 Contig44243newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30019487SMESG000054903.1 SMESG000054901.1 SMESG000054878.1 SMESG000044092.1 dd_Smed_v4_10593_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30019487SMESG000054903.1 SMESG000054901.1 SMESG000054878.1 SMESG000044092.1 dd_Smed_v4_10593_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE8A (phosphodiesterase 8A [Source:HGNC Symbol;Acc:HGNC:8793])

HSP 1 Score: 361.303 bits (926), Expect = 5.581e-111
Identity = 169/310 (54.52%), Postives = 218/310 (70.32%), Query Frame = 1
Query: 1639 LEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            +E+   W FDI +LE  + N+PL Y+G+K+F +F +   L+      ++WL +IE NY+ SN YHNSTH+ADVL ++ +FL +E+I E  D  D+V ++IAA IHD+ HPGRTN FL N+   LAILYND AVLE+HH++ AF++T  DD+ NIFKNM R+DYR +R GI+D VLATEM KHFEH+ KF+N+I KP      N     N   I + L    PEN+ +I+RMLIKC+DV+NP RP   C EWA RISEEYFSQTDEE  + LPVVMP F+R TC IPKSQI FID F+ DMF +W  F D+
Sbjct:  420 MENEEYWDFDIFELEAATHNRPLIYLGLKMFARFGICEFLHCSESTLRSWLQIIEANYHSSNPYHNSTHSADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDHPGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTTGDDKCNIFKNMERNDYRTLRQGIIDMVLATEMTKHFEHVNKFVNSINKPLATLEENGETDKNQEVINTMLRT--PENRTLIKRMLIKCADVSNPCRPLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPVFDRNTCSIPKSQISFIDYFITDMFDAWDAFVDL 727          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE8A (phosphodiesterase 8A [Source:HGNC Symbol;Acc:HGNC:8793])

HSP 1 Score: 361.688 bits (927), Expect = 7.523e-111
Identity = 169/310 (54.52%), Postives = 218/310 (70.32%), Query Frame = 1
Query: 1639 LEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            +E+   W FDI +LE  + N+PL Y+G+K+F +F +   L+      ++WL +IE NY+ SN YHNSTH+ADVL ++ +FL +E+I E  D  D+V ++IAA IHD+ HPGRTN FL N+   LAILYND AVLE+HH++ AF++T  DD+ NIFKNM R+DYR +R GI+D VLATEM KHFEH+ KF+N+I KP      N     N   I + L    PEN+ +I+RMLIKC+DV+NP RP   C EWA RISEEYFSQTDEE  + LPVVMP F+R TC IPKSQI FID F+ DMF +W  F D+
Sbjct:  446 MENEEYWDFDIFELEAATHNRPLIYLGLKMFARFGICEFLHCSESTLRSWLQIIEANYHSSNPYHNSTHSADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDHPGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTTGDDKCNIFKNMERNDYRTLRQGIIDMVLATEMTKHFEHVNKFVNSINKPLATLEENGETDKNQEVINTMLRT--PENRTLIKRMLIKCADVSNPCRPLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPVFDRNTCSIPKSQISFIDYFITDMFDAWDAFVDL 753          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE8A (phosphodiesterase 8A [Source:HGNC Symbol;Acc:HGNC:8793])

HSP 1 Score: 362.073 bits (928), Expect = 1.852e-110
Identity = 169/310 (54.52%), Postives = 218/310 (70.32%), Query Frame = 1
Query: 1639 LEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            +E+   W FDI +LE  + N+PL Y+G+K+F +F +   L+      ++WL +IE NY+ SN YHNSTH+ADVL ++ +FL +E+I E  D  D+V ++IAA IHD+ HPGRTN FL N+   LAILYND AVLE+HH++ AF++T  DD+ NIFKNM R+DYR +R GI+D VLATEM KHFEH+ KF+N+I KP      N     N   I + L    PEN+ +I+RMLIKC+DV+NP RP   C EWA RISEEYFSQTDEE  + LPVVMP F+R TC IPKSQI FID F+ DMF +W  F D+
Sbjct:  492 MENEEYWDFDIFELEAATHNRPLIYLGLKMFARFGICEFLHCSESTLRSWLQIIEANYHSSNPYHNSTHSADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDHPGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTTGDDKCNIFKNMERNDYRTLRQGIIDMVLATEMTKHFEHVNKFVNSINKPLATLEENGETDKNQEVINTMLRT--PENRTLIKRMLIKCADVSNPCRPLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPVFDRNTCSIPKSQISFIDYFITDMFDAWDAFVDL 799          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE8A (phosphodiesterase 8A [Source:HGNC Symbol;Acc:HGNC:8793])

HSP 1 Score: 362.073 bits (928), Expect = 1.852e-110
Identity = 169/310 (54.52%), Postives = 218/310 (70.32%), Query Frame = 1
Query: 1639 LEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            +E+   W FDI +LE  + N+PL Y+G+K+F +F +   L+      ++WL +IE NY+ SN YHNSTH+ADVL ++ +FL +E+I E  D  D+V ++IAA IHD+ HPGRTN FL N+   LAILYND AVLE+HH++ AF++T  DD+ NIFKNM R+DYR +R GI+D VLATEM KHFEH+ KF+N+I KP      N     N   I + L    PEN+ +I+RMLIKC+DV+NP RP   C EWA RISEEYFSQTDEE  + LPVVMP F+R TC IPKSQI FID F+ DMF +W  F D+
Sbjct:  492 MENEEYWDFDIFELEAATHNRPLIYLGLKMFARFGICEFLHCSESTLRSWLQIIEANYHSSNPYHNSTHSADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDHPGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTTGDDKCNIFKNMERNDYRTLRQGIIDMVLATEMTKHFEHVNKFVNSINKPLATLEENGETDKNQEVINTMLRT--PENRTLIKRMLIKCADVSNPCRPLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPVFDRNTCSIPKSQISFIDYFITDMFDAWDAFVDL 799          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE8B (phosphodiesterase 8B [Source:HGNC Symbol;Acc:HGNC:8794])

HSP 1 Score: 344.739 bits (883), Expect = 7.573e-110
Identity = 161/313 (51.44%), Postives = 216/313 (69.01%), Query Frame = 1
Query: 1624 VIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFA 2562
             I  LL++   W F+I +LE ++  +PL Y+G+KVF++F +   LN      + W  VIE NY+ SN YHNSTHAADVL ++ +FL +E++    D  D+V ++IAA +HD+ HPGRTN FL N+   LA+LYND AVLE+HH++ AF++T+KD + NIFKN++R+ YR +R  I+D VLATEM KHFEH+ KF+N+I KP    +  S    N            PEN+ +I+RM+IKC+DV NP RP ++C EWA RISEEYF+QTDEE  + LPVVMP F+R TC IPKSQI FID F+ DMF +W  FA
Sbjct:   11 CISQLLDNEESWDFNIFELEAITHKRPLVYLGLKVFSRFGVCEFLNCSETTLRAWFQVIEANYHSSNAYHNSTHAADVLHATAFFLGKERVKGSLDQLDEVAALIAATVHDVDHPGRTNSFLCNAGSELAVLYNDTAVLESHHTALAFQLTVKDTKCNIFKNIDRNHYRTLRQAIIDMVLATEMTKHFEHVNKFVNSINKPMAAEIEGSDCECNPAGKNF------PENQILIKRMMIKCADVANPCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQISFIDYFITDMFDAWDAFA 317          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-6 (Probable 3',5'-cyclic phosphodiesterase pde-6 [Source:UniProtKB/Swiss-Prot;Acc:Q9N2V9])

HSP 1 Score: 245.358 bits (625), Expect = 2.085e-71
Identity = 127/309 (41.10%), Postives = 198/309 (64.08%), Query Frame = 1
Query: 1639 LEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDD-RINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFA 2562
            LE+ + W FDIL LE++S++  L  +GMKVF ++++  +L     L   W+  IE +Y+  N YHN+THAADVLQ++ +FL+   +    +    V +++AA +HDL HPGR N +LIN+  SLAILYND ++LENHH + AF++TL+ +  +NIF +++R+++  +RH +V+ VLAT++++HFE+L KF N +   + P     +                  N   I  ML+KC+D++NP R + +C+ WA+RI EEYF QT EE  K LPV M  F+R TC++P +Q  FID+F ++ F ++ +FA
Sbjct:  164 LENDNCWKFDILHLEKVSDHHALSQVGMKVFERWKVCDVLGCSDDLLHRWILSIEAHYHAGNTYHNATHAADVLQATSFFLDSPSVAVHVNESHAVAALLAAAVHDLDHPGRGNAYLINTRQSLAILYNDNSILENHHIALAFQLTLQHNANVNIFSSLSREEFIQMRHAMVEMVLATDISRHFEYLAKF-NKMHVTDVPEEQRDT------------------NSLTICDMLVKCADISNPAREWGLCQRWAHRIVEEYFEQTREEKEKGLPVTMEVFDRNTCNVPITQCGFIDMFAREAFATFTEFA 453          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-6 (Probable 3',5'-cyclic phosphodiesterase pde-6 [Source:UniProtKB/Swiss-Prot;Acc:Q9N2V9])

HSP 1 Score: 246.899 bits (629), Expect = 1.807e-69
Identity = 127/309 (41.10%), Postives = 198/309 (64.08%), Query Frame = 1
Query: 1639 LEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLK-DDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFA 2562
            LE+ + W FDIL LE++S++  L  +GMKVF ++++  +L     L   W+  IE +Y+  N YHN+THAADVLQ++ +FL+   +    +    V +++AA +HDL HPGR N +LIN+  SLAILYND ++LENHH + AF++TL+ +  +NIF +++R+++  +RH +V+ VLAT++++HFE+L KF N +   + P     +                  N   I  ML+KC+D++NP R + +C+ WA+RI EEYF QT EE  K LPV M  F+R TC++P +Q  FID+F ++ F ++ +FA
Sbjct:  438 LENDNCWKFDILHLEKVSDHHALSQVGMKVFERWKVCDVLGCSDDLLHRWILSIEAHYHAGNTYHNATHAADVLQATSFFLDSPSVAVHVNESHAVAALLAAAVHDLDHPGRGNAYLINTRQSLAILYNDNSILENHHIALAFQLTLQHNANVNIFSSLSREEFIQMRHAMVEMVLATDISRHFEYLAKF-NKMHVTDVPEEQRDT------------------NSLTICDMLVKCADISNPAREWGLCQRWAHRIVEEYFEQTREEKEKGLPVTMEVFDRNTCNVPITQCGFIDMFAREAFATFTEFA 727          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-6 (Probable 3',5'-cyclic phosphodiesterase pde-6 [Source:UniProtKB/Swiss-Prot;Acc:Q9N2V9])

HSP 1 Score: 200.675 bits (509), Expect = 6.182e-54
Identity = 106/263 (40.30%), Postives = 167/263 (63.50%), Query Frame = 1
Query: 1639 LEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDD-RINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQ 2424
            LE+ + W FDIL LE++S++  L  +GMKVF ++++  +L     L   W+  IE +Y+  N YHN+THAADVLQ++ +FL+   +    +    V +++AA +HDL HPGR N +LIN+  SLAILYND ++LENHH + AF++TL+ +  +NIF +++R+++  +RH +V+ VLAT++++HFE+L KF N +   + P     +                  N   I  ML+KC+D++NP R + +C+ WA+RI EEYF Q
Sbjct:  438 LENDNCWKFDILHLEKVSDHHALSQVGMKVFERWKVCDVLGCSDDLLHRWILSIEAHYHAGNTYHNATHAADVLQATSFFLDSPSVAVHVNESHAVAALLAAAVHDLDHPGRGNAYLINTRQSLAILYNDNSILENHHIALAFQLTLQHNANVNIFSSLSREEFIQMRHAMVEMVLATDISRHFEYLAKF-NKMHVTDVPEEQRDT------------------NSLTICDMLVKCADISNPAREWGLCQRWAHRIVEEYFEQ 681          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-1 (Probable 3',5'-cyclic phosphodiesterase pde-1 [Source:UniProtKB/Swiss-Prot;Acc:O18696])

HSP 1 Score: 172.555 bits (436), Expect = 2.229e-45
Identity = 101/322 (31.37%), Postives = 168/322 (52.17%), Query Frame = 1
Query: 1570 RHSKINKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYND-SNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQ 2532
            R  ++ + P  PEI E      L+++   WSF   +L ++SE   L+Y+G ++F ++       +     +N+L  +E  Y+  +N YHN  HAADV QSS + L +  +       + +  +  A+IHD  H G TN F I S    A+LYND +VLENHH S  F++  +DD+ NI  ++ RD+Y+ +R+ +++ VLAT+M+ HF  +    + +  P G +                      +NKA+   +++   D+++P +P+N+ + W   + EE+F Q D E S  LP   P  +R T  +  SQI FID  ++
Sbjct:  120 RKQQVVQCPIPPEIAE------LMKEVCTWSFSPFQLNEVSEGHALKYVGFELFNRYGFMDRFKVPLTALENYLSALEVGYSKHNNPYHNVVHAADVTQSSHFMLSQTGLANSLGDLELLAVLFGALIHDYEHTGHTNNFHIQSQSQFAMLYNDRSVLENHHVSSCFRLMKEDDK-NILTHLTRDEYKELRNMVIEIVLATDMSTHFMQIKTMKSMLSLPEGID----------------------KNKALC--LIVHACDISHPAKPWNLHERWTEGVLEEFFRQGDLEASMGLPYS-PLCDRHTVHVADSQIGFIDFIVE 409          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-1 (Probable 3',5'-cyclic phosphodiesterase pde-1 [Source:UniProtKB/Swiss-Prot;Acc:O18696])

HSP 1 Score: 171.785 bits (434), Expect = 1.953e-44
Identity = 101/322 (31.37%), Postives = 168/322 (52.17%), Query Frame = 1
Query: 1570 RHSKINKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYND-SNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQ 2532
            R  ++ + P  PEI E      L+++   WSF   +L ++SE   L+Y+G ++F ++       +     +N+L  +E  Y+  +N YHN  HAADV QSS + L +  +       + +  +  A+IHD  H G TN F I S    A+LYND +VLENHH S  F++  +DD+ NI  ++ RD+Y+ +R+ +++ VLAT+M+ HF  +    + +  P G +                      +NKA+   +++   D+++P +P+N+ + W   + EE+F Q D E S  LP   P  +R T  +  SQI FID  ++
Sbjct:  251 RKQQVVQCPIPPEIAE------LMKEVCTWSFSPFQLNEVSEGHALKYVGFELFNRYGFMDRFKVPLTALENYLSALEVGYSKHNNPYHNVVHAADVTQSSHFMLSQTGLANSLGDLELLAVLFGALIHDYEHTGHTNNFHIQSQSQFAMLYNDRSVLENHHVSSCFRLMKEDDK-NILTHLTRDEYKELRNMVIEIVLATDMSTHFMQIKTMKSMLSLPEGID----------------------KNKALC--LIVHACDISHPAKPWNLHERWTEGVLEEFFRQGDLEASMGLPYS-PLCDRHTVHVADSQIGFIDFIVE 540          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde8 (gene:FBgn0266377 transcript:FBtr0344176)

HSP 1 Score: 302.368 bits (773), Expect = 1.618e-93
Identity = 149/313 (47.60%), Postives = 210/313 (67.09%), Query Frame = 1
Query: 1636 LLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLER--EKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            LL++   W FDI KLE++++  PL Y+GM++F +F++ + LNID  + + WL VIE +Y  SN YHNSTHAADV+Q++  F+ +   K   + D  ++  ++IAA  HD+ HPGR++ FL NS+ +LA+LYND+ VLENHH++  FK+TL DD+INIFKN++++ Y++ R  I+D +LATEM +HFEHL KF+ ++     P   N                 D E   ++RRMLIK +DV+NP RP   C EWA RI+EEYF QTDEE  + LP+VMP F+R TC IPKSQI FI+  +QDM  +W  F D+
Sbjct:   61 LLDESLSWDFDIFKLEEITDYHPLLYLGMEMFRRFDVFATLNIDENVCKAWLAVIEAHYRKSNTYHNSTHAADVMQATGAFITQLTNKDMLVMDRMEEATALIAAAAHDVDHPGRSSAFLCNSNDALAVLYNDLTVLENHHAAITFKLTLGDDKINIFKNLDKETYKSARSTIIDMILATEMTRHFEHLAKFV-SVFGGEEPRDHNPQ--------------TDEETSILMRRMLIKVADVSNPARPMQFCIEWARRIAEEYFMQTDEEKQRHLPIVMPMFDRATCSIPKSQIGFIEYIIQDMMHAWESFIDM 358          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde8 (gene:FBgn0266377 transcript:FBtr0344177)

HSP 1 Score: 304.679 bits (779), Expect = 8.716e-90
Identity = 149/313 (47.60%), Postives = 210/313 (67.09%), Query Frame = 1
Query: 1636 LLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLER--EKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            LL++   W FDI KLE++++  PL Y+GM++F +F++ + LNID  + + WL VIE +Y  SN YHNSTHAADV+Q++  F+ +   K   + D  ++  ++IAA  HD+ HPGR++ FL NS+ +LA+LYND+ VLENHH++  FK+TL DD+INIFKN++++ Y++ R  I+D +LATEM +HFEHL KF+ ++     P   N                 D E   ++RRMLIK +DV+NP RP   C EWA RI+EEYF QTDEE  + LP+VMP F+R TC IPKSQI FI+  +QDM  +W  F D+
Sbjct:  466 LLDESLSWDFDIFKLEEITDYHPLLYLGMEMFRRFDVFATLNIDENVCKAWLAVIEAHYRKSNTYHNSTHAADVMQATGAFITQLTNKDMLVMDRMEEATALIAAAAHDVDHPGRSSAFLCNSNDALAVLYNDLTVLENHHAAITFKLTLGDDKINIFKNLDKETYKSARSTIIDMILATEMTRHFEHLAKFV-SVFGGEEPRDHNPQ--------------TDEETSILMRRMLIKVADVSNPARPMQFCIEWARRIAEEYFMQTDEEKQRHLPIVMPMFDRATCSIPKSQIGFIEYIIQDMMHAWESFIDM 763          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde8 (gene:FBgn0266377 transcript:FBtr0344178)

HSP 1 Score: 304.679 bits (779), Expect = 5.329e-89
Identity = 149/313 (47.60%), Postives = 210/313 (67.09%), Query Frame = 1
Query: 1636 LLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLER--EKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            LL++   W FDI KLE++++  PL Y+GM++F +F++ + LNID  + + WL VIE +Y  SN YHNSTHAADV+Q++  F+ +   K   + D  ++  ++IAA  HD+ HPGR++ FL NS+ +LA+LYND+ VLENHH++  FK+TL DD+INIFKN++++ Y++ R  I+D +LATEM +HFEHL KF+ ++     P   N                 D E   ++RRMLIK +DV+NP RP   C EWA RI+EEYF QTDEE  + LP+VMP F+R TC IPKSQI FI+  +QDM  +W  F D+
Sbjct:  566 LLDESLSWDFDIFKLEEITDYHPLLYLGMEMFRRFDVFATLNIDENVCKAWLAVIEAHYRKSNTYHNSTHAADVMQATGAFITQLTNKDMLVMDRMEEATALIAAAAHDVDHPGRSSAFLCNSNDALAVLYNDLTVLENHHAAITFKLTLGDDKINIFKNLDKETYKSARSTIIDMILATEMTRHFEHLAKFV-SVFGGEEPRDHNPQ--------------TDEETSILMRRMLIKVADVSNPARPMQFCIEWARRIAEEYFMQTDEEKQRHLPIVMPMFDRATCSIPKSQIGFIEYIIQDMMHAWESFIDM 863          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde8 (gene:FBgn0266377 transcript:FBtr0344179)

HSP 1 Score: 304.679 bits (779), Expect = 5.561e-89
Identity = 149/313 (47.60%), Postives = 210/313 (67.09%), Query Frame = 1
Query: 1636 LLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLER--EKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            LL++   W FDI KLE++++  PL Y+GM++F +F++ + LNID  + + WL VIE +Y  SN YHNSTHAADV+Q++  F+ +   K   + D  ++  ++IAA  HD+ HPGR++ FL NS+ +LA+LYND+ VLENHH++  FK+TL DD+INIFKN++++ Y++ R  I+D +LATEM +HFEHL KF+ ++     P   N                 D E   ++RRMLIK +DV+NP RP   C EWA RI+EEYF QTDEE  + LP+VMP F+R TC IPKSQI FI+  +QDM  +W  F D+
Sbjct:  565 LLDESLSWDFDIFKLEEITDYHPLLYLGMEMFRRFDVFATLNIDENVCKAWLAVIEAHYRKSNTYHNSTHAADVMQATGAFITQLTNKDMLVMDRMEEATALIAAAAHDVDHPGRSSAFLCNSNDALAVLYNDLTVLENHHAAITFKLTLGDDKINIFKNLDKETYKSARSTIIDMILATEMTRHFEHLAKFV-SVFGGEEPRDHNPQ--------------TDEETSILMRRMLIKVADVSNPARPMQFCIEWARRIAEEYFMQTDEEKQRHLPIVMPMFDRATCSIPKSQIGFIEYIIQDMMHAWESFIDM 862          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde8 (gene:FBgn0266377 transcript:FBtr0344182)

HSP 1 Score: 304.679 bits (779), Expect = 5.810e-89
Identity = 149/313 (47.60%), Postives = 210/313 (67.09%), Query Frame = 1
Query: 1636 LLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLER--EKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            LL++   W FDI KLE++++  PL Y+GM++F +F++ + LNID  + + WL VIE +Y  SN YHNSTHAADV+Q++  F+ +   K   + D  ++  ++IAA  HD+ HPGR++ FL NS+ +LA+LYND+ VLENHH++  FK+TL DD+INIFKN++++ Y++ R  I+D +LATEM +HFEHL KF+ ++     P   N                 D E   ++RRMLIK +DV+NP RP   C EWA RI+EEYF QTDEE  + LP+VMP F+R TC IPKSQI FI+  +QDM  +W  F D+
Sbjct:  575 LLDESLSWDFDIFKLEEITDYHPLLYLGMEMFRRFDVFATLNIDENVCKAWLAVIEAHYRKSNTYHNSTHAADVMQATGAFITQLTNKDMLVMDRMEEATALIAAAAHDVDHPGRSSAFLCNSNDALAVLYNDLTVLENHHAAITFKLTLGDDKINIFKNLDKETYKSARSTIIDMILATEMTRHFEHLAKFV-SVFGGEEPRDHNPQ--------------TDEETSILMRRMLIKVADVSNPARPMQFCIEWARRIAEEYFMQTDEEKQRHLPIVMPMFDRATCSIPKSQIGFIEYIIQDMMHAWESFIDM 872          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde8b (phosphodiesterase 8B [Source:ZFIN;Acc:ZDB-GENE-091117-3])

HSP 1 Score: 352.058 bits (902), Expect = 9.844e-108
Identity = 168/329 (51.06%), Postives = 223/329 (67.78%), Query Frame = 1
Query: 1582 INKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            +N +P  P I E      LL +  +W F+IL+LE  +  +PL Y+G+K+F+ F +   LN      + WL VIETNY+ SN YHNSTHAADVL ++ +FL +E++    D  D+V +++AA +HD+ HPGRTN FL N+   LAILYND AVLE+HH++ AF++T++D + NIFKNM R  +R +R  I+D VLATEM +HFEH+ KF+N+I KP       SSN +  N          PEN+ +I+RMLIKC+DV NP RP  +C EWA RISEEYF+QTDEE  + LPVVMP F+R TC IPKSQI FID F+ DMF +W  FA +
Sbjct:  414 LNDIP--PSIAE------LLNEEEQWEFNILELEAATHKRPLSYLGLKIFSAFGVCEFLNCSESTLRLWLQVIETNYHSSNSYHNSTHAADVLHATAYFLRKERVKASLDQLDEVAALLAATVHDVDHPGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTVRDSKCNIFKNMERTQFRTLRQAIIDMVLATEMTRHFEHVNKFVNSINKPMSAIEETSSNASIRN---------SPENRLLIKRMLIKCADVANPCRPLELCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQISFIDYFITDMFDAWDAFASL 725          

HSP 2 Score: 57.3806 bits (137), Expect = 7.949e-8
Identity = 56/257 (21.79%), Postives = 117/257 (45.53%), Query Frame = 1
Query:  694 SAFNKFTDSMEILKNDFSIEIVNETFKKVFKVSKREITG-------RSWFSFHDISDHRQSVIKNELSLKKSWEGLLSSKTDLPIDYPLNVYAVIKPLDVRENYYIVTLNAYF----------NNQGKSEPSFSFISMDRESTTISIPRMKDSFFTS----QQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLFITTVDALKSDKMSSNLIDGLLSNHATMFAQTENRRHSSSLTKRRQTRVNSEV 1401
            +A  +  +++EI   D  I+ VN  F+K+    + E+ G       RS  +  D+ D   + IK      K W+G+  S+        +  Y  I P+  +  Y + +L +             ++ + + S    S+   S+    P +++  ++S      ++I++PI K++ II++ QE S   +   L R++EIL + +L+   + + + D  +++L+ GL+S+     +  E     S+L    Q+++   V
Sbjct:  164 TALEQCQEAVEISSEDHVIQYVNPAFEKMMGYHRGELIGKELTELPRSDKNSADLLDTINTCIKK----GKEWQGIYFSRRK--SGDSIQQYVKITPVVGQGGYVLHSLRSLLFCLYSECNSLRHKDRRKESVDVRSISSHSS--DAPSLQNRRYSSMARIHSMTIEAPITKVINIINAAQESSPVTVAEALDRVLEILRTTELYSPQLASKEDDPHTNDLVGGLMSDGLRRLSGNEYIFSKSALQNMSQSQLGVPV 412          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde8b (phosphodiesterase 8B [Source:ZFIN;Acc:ZDB-GENE-091117-3])

HSP 1 Score: 351.288 bits (900), Expect = 5.077e-107
Identity = 168/329 (51.06%), Postives = 224/329 (68.09%), Query Frame = 1
Query: 1582 INKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            +N +P  P I E      LL +  +W F+IL+LE  +  +PL Y+G+K+F+ F +   LN      + WL VIETNY+ SN YHNSTHAADVL ++ +FL +E++    D  D+V +++AA +HD+ HPGRTN FL N+   LAILYND AVLE+HH++ AF++T++D + NIFKNM R  +R +R  I+D VLATEM +HFEH+ KF+N+I KP       SS+      IR+      PEN+ +I+RMLIKC+DV NP RP  +C EWA RISEEYF+QTDEE  + LPVVMP F+R TC IPKSQI FID F+ DMF +W  FA +
Sbjct:  452 LNDIP--PSIAE------LLNEEEQWEFNILELEAATHKRPLSYLGLKIFSAFGVCEFLNCSESTLRLWLQVIETNYHSSNSYHNSTHAADVLHATAYFLRKERVKASLDQLDEVAALLAATVHDVDHPGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTVRDSKCNIFKNMERTQFRTLRQAIIDMVLATEMTRHFEHVNKFVNSINKPMSAIEETSSDCEGQASIRN-----SPENRLLIKRMLIKCADVANPCRPLELCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQISFIDYFITDMFDAWDAFASL 767          

HSP 2 Score: 56.9954 bits (136), Expect = 1.041e-7
Identity = 56/257 (21.79%), Postives = 117/257 (45.53%), Query Frame = 1
Query:  694 SAFNKFTDSMEILKNDFSIEIVNETFKKVFKVSKREITG-------RSWFSFHDISDHRQSVIKNELSLKKSWEGLLSSKTDLPIDYPLNVYAVIKPLDVRENYYIVTLNAYF----------NNQGKSEPSFSFISMDRESTTISIPRMKDSFFTS----QQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLFITTVDALKSDKMSSNLIDGLLSNHATMFAQTENRRHSSSLTKRRQTRVNSEV 1401
            +A  +  +++EI   D  I+ VN  F+K+    + E+ G       RS  +  D+ D   + IK      K W+G+  S+        +  Y  I P+  +  Y + +L +             ++ + + S    S+   S+    P +++  ++S      ++I++PI K++ II++ QE S   +   L R++EIL + +L+   + + + D  +++L+ GL+S+     +  E     S+L    Q+++   V
Sbjct:  202 TALEQCQEAVEISSEDHVIQYVNPAFEKMMGYHRGELIGKELTELPRSDKNSADLLDTINTCIKK----GKEWQGIYFSRRK--SGDSIQQYVKITPVVGQGGYVLHSLRSLLFCLYSECNSLRHKDRRKESVDVRSISSHSS--DAPSLQNRRYSSMARIHSMTIEAPITKVINIINAAQESSPVTVAEALDRVLEILRTTELYSPQLASKEDDPHTNDLVGGLMSDGLRRLSGNEYIFSKSALQNMSQSQLGVPV 450          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde8a (phosphodiesterase 8A [Source:ZFIN;Acc:ZDB-GENE-070112-622])

HSP 1 Score: 227.254 bits (578), Expect = 3.411e-63
Identity = 97/196 (49.49%), Postives = 141/196 (71.94%), Query Frame = 1
Query: 1639 LEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKP 2226
            +E+   W FDI  LE  +  +PL ++G+K+F++F +   L       ++WL  IE +Y+ SN YHNSTHAADVL ++ +FL +E++ +  D  D+V ++IAA +HD+ HPGRTN FL N+   LA+LYND AVLE+HH++ AF++T +DD+ NIF+NM R++YR +R  I+D VLATEM KHFEH+ KF+N+I KP
Sbjct:  409 MENEDSWDFDIFNLESATLKRPLAFLGLKLFSRFGVCEFLGCAEATLRSWLQNIEASYHGSNPYHNSTHAADVLHATAYFLCKERVKQSLDPIDEVAALIAAAVHDVDHPGRTNSFLCNAGSELAVLYNDTAVLESHHAALAFQITTRDDKSNIFRNMERNEYRTLRQAIIDMVLATEMTKHFEHVNKFVNSINKP 604          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde4ca (phosphodiesterase 4C, cAMP-specific a [Source:ZFIN;Acc:ZDB-GENE-070912-373])

HSP 1 Score: 186.422 bits (472), Expect = 7.646e-49
Identity = 108/336 (32.14%), Postives = 179/336 (53.27%), Query Frame = 1
Query: 1564 KPRHSKINKMPEVPEIEEYGVI----DIL---LEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSW 2550
            KP HS  N  P    I  +GV     D+L   LED+ +W  D+ K+ + S N+PL       F + +L     I    F N++  +E NY     YHNS HAADV+QS+   L    +  +F   + + ++ A+ IHD+ HPG +N FLIN++  LA++YND +VLENHH +  FK+ L+++  +IF+N+ +   +++R  ++D VLAT+M+KH   L      +              T        L L +  ++  + + ++ C+D++NPT+P  + ++W  RI  E+F+Q D E  K + +  P  ++    I KSQ+ FID  +  ++ +W
Sbjct:  256 KPTHSS-NIAPS--SIPRFGVSTNREDLLAKELEDFDRWGVDMFKISECSGNRPLTVAMYTTFQERDLLKSFKIPVDTFINYMTALEENYRSDVAYHNSIHAADVVQSTHVLLSTPALEAVFTDLEILAAMFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKL-LQEENCDIFQNLTKKQRQSLRKMVIDMVLATDMSKHMNLLADLKTMV-------------ETKKVTSLGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLELYRQWTDRIMVEFFTQGDRERDKGMEIS-PMCDKHNASIEKSQVGFIDYIVHPLWETW 573          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde4ca (phosphodiesterase 4C, cAMP-specific a [Source:ZFIN;Acc:ZDB-GENE-070912-373])

HSP 1 Score: 186.422 bits (472), Expect = 7.646e-49
Identity = 108/336 (32.14%), Postives = 179/336 (53.27%), Query Frame = 1
Query: 1564 KPRHSKINKMPEVPEIEEYGVI----DIL---LEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSW 2550
            KP HS  N  P    I  +GV     D+L   LED+ +W  D+ K+ + S N+PL       F + +L     I    F N++  +E NY     YHNS HAADV+QS+   L    +  +F   + + ++ A+ IHD+ HPG +N FLIN++  LA++YND +VLENHH +  FK+ L+++  +IF+N+ +   +++R  ++D VLAT+M+KH   L      +              T        L L +  ++  + + ++ C+D++NPT+P  + ++W  RI  E+F+Q D E  K + +  P  ++    I KSQ+ FID  +  ++ +W
Sbjct:  256 KPTHSS-NIAPS--SIPRFGVSTNREDLLAKELEDFDRWGVDMFKISECSGNRPLTVAMYTTFQERDLLKSFKIPVDTFINYMTALEENYRSDVAYHNSIHAADVVQSTHVLLSTPALEAVFTDLEILAAMFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKL-LQEENCDIFQNLTKKQRQSLRKMVIDMVLATDMSKHMNLLADLKTMV-------------ETKKVTSLGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLELYRQWTDRIMVEFFTQGDRERDKGMEIS-PMCDKHNASIEKSQVGFIDYIVHPLWETW 573          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: ENSXETT00000055665.1 (phosphodiesterase 8A [Source:NCBI gene;Acc:100497070])

HSP 1 Score: 357.451 bits (916), Expect = 6.324e-110
Identity = 162/310 (52.26%), Postives = 218/310 (70.32%), Query Frame = 1
Query: 1639 LEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            +++   W FDI +LE  +  +PL Y+G+K+F +F +   LN      ++WLHVIE+NY+ SN YHNSTH+ADVL ++ +FL +E++ +  D  D+V ++IAA +HD+ HPGRTN FL N+   LAILYND AVLE+HH++ AF++T +DD+ NIFKNM R++YR +R  I+D VLATEM KHFEH+ KF+N+I KP      N  +      I     L  PEN+ +I+RMLIKC+D++NP R    C EWA RISEEYF+QTDEE  K LPVVMP F+R TC IPKSQI F+D F+ DMF +W  FAD+
Sbjct:  387 MDNEEDWEFDIFELEAATHKRPLVYLGLKMFARFGVCQFLNCSEATLRSWLHVIESNYHSSNAYHNSTHSADVLHATAYFLCKERVKQSLDQIDEVAALIAATVHDVDHPGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTTRDDKCNIFKNMERNEYRTLRQAIIDMVLATEMTKHFEHVNKFVNSINKPLAAVEENGVSSDAVKNI-----LTSPENRILIKRMLIKCADISNPCRALEQCIEWAGRISEEYFAQTDEEKRKGLPVVMPVFDRNTCSIPKSQISFVDYFITDMFDAWDAFADL 691          

HSP 2 Score: 51.6026 bits (122), Expect = 7.588e-6
Identity = 49/223 (21.97%), Postives = 91/223 (40.81%), Query Frame = 1
Query:  694 SAFNKFTDSMEILKNDFSIEIVNETFKKVFKVSKREITGRSWFSF------HDISDHRQSVIKNELSLKKSWEGLLSSKTDLPIDYPLNVYA---------VIKPLDVRENYYIVTLN-AYFNNQGKSEPSFSFISMDRESTTISIPRMKDSFFTSQQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLFITTVDALKSDKMSSNLIDGLLSN 1314
            +   K  +++EI   D  I+ VN  F+      K E+ G+            D  D     IK      K WEG+  +K     +   NV           V   +  + N  +  L+     ++ + + S    S     +  S  R   S      ++I++PI K++ II++ QE S   +   L R++EIL + +L+   +     D  +++L+ GL+++
Sbjct:  132 TTLEKSQEAIEITSEDHIIQYVNPAFESTMGYQKDELIGKELTEVPINEKKSDFLDTINCCIKT----GKEWEGIYYAKNKNGDNIQQNVKIIPVFGHRGYVTSEIKEKRNTNVCVLHIQTCRHKDRRKGSLDVRSTTSRGSDGSSQRRHSSMARIHSMTIEAPITKVINIINAGQENSPSAVAEALDRVLEILRTTELYSPQLGTKDEDPHTNDLVGGLMTD 350          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: ENSXETT00000055664.1 (phosphodiesterase 8A [Source:NCBI gene;Acc:100497070])

HSP 1 Score: 355.525 bits (911), Expect = 2.943e-109
Identity = 162/310 (52.26%), Postives = 218/310 (70.32%), Query Frame = 1
Query: 1639 LEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            +++   W FDI +LE  +  +PL Y+G+K+F +F +   LN      ++WLHVIE+NY+ SN YHNSTH+ADVL ++ +FL +E++ +  D  D+V ++IAA +HD+ HPGRTN FL N+   LAILYND AVLE+HH++ AF++T +DD+ NIFKNM R++YR +R  I+D VLATEM KHFEH+ KF+N+I KP      N  +    N       L  PEN+ +I+RMLIKC+D++NP R    C EWA RISEEYF+QTDEE  K LPVVMP F+R TC IPKSQI F+D F+ DMF +W  FAD+
Sbjct:  385 MDNEEDWEFDIFELEAATHKRPLVYLGLKMFARFGVCQFLNCSEATLRSWLHVIESNYHSSNAYHNSTHSADVLHATAYFLCKERVKQSLDQIDEVAALIAATVHDVDHPGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTTRDDKCNIFKNMERNEYRTLRQAIIDMVLATEMTKHFEHVNKFVNSINKPLAAVEENGEDEAVKNI------LTSPENRILIKRMLIKCADISNPCRALEQCIEWAGRISEEYFAQTDEEKRKGLPVVMPVFDRNTCSIPKSQISFVDYFITDMFDAWDAFADL 688          

HSP 2 Score: 51.6026 bits (122), Expect = 6.442e-6
Identity = 49/213 (23.00%), Postives = 88/213 (41.31%), Query Frame = 1
Query:  694 SAFNKFTDSMEILKNDFSIEIVNETFKKVFKVSKREITGRSWFSF------HDISDHRQSVIKNELSLKKSWEGLLSSKTDLPIDYPLNVYAVIKPLDVRENYYIVTLNAYFNNQGKSEPSFSFISMDRESTTISIPRMKDSFFTSQQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLFITTVDALKSDKMSSNLIDGLLSN 1314
            +   K  +++EI   D  I+ VN  F+      K E+ G+            D  D     IK      K WEG+  +K     +   NV   I P+     Y    +    N        F F +   +    S+ R+         ++I++PI K++ II++ QE S   +   L R++EIL + +L+   +     D  +++L+ GL+++
Sbjct:  145 TTLEKSQEAIEITSEDHIIQYVNPAFESTMGYQKDELIGKELTEVPINEKKSDFLDTINCCIKT----GKEWEGIYYAKNKNGDNIQQNVK--IIPVFGHRGYVTSEIKEKRNTNVCVLIPFFFFAGSSQRRHSSMARI-------HSMTIEAPITKVINIINAGQENSPSAVAEALDRVLEILRTTELYSPQLGTKDEDPHTNDLVGGLMTD 344          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: ENSXETT00000055662.1 (phosphodiesterase 8A [Source:NCBI gene;Acc:100497070])

HSP 1 Score: 357.066 bits (915), Expect = 3.681e-109
Identity = 162/310 (52.26%), Postives = 218/310 (70.32%), Query Frame = 1
Query: 1639 LEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            +++   W FDI +LE  +  +PL Y+G+K+F +F +   LN      ++WLHVIE+NY+ SN YHNSTH+ADVL ++ +FL +E++ +  D  D+V ++IAA +HD+ HPGRTN FL N+   LAILYND AVLE+HH++ AF++T +DD+ NIFKNM R++YR +R  I+D VLATEM KHFEH+ KF+N+I KP      N  +    N       L  PEN+ +I+RMLIKC+D++NP R    C EWA RISEEYF+QTDEE  K LPVVMP F+R TC IPKSQI F+D F+ DMF +W  FAD+
Sbjct:  453 MDNEEDWEFDIFELEAATHKRPLVYLGLKMFARFGVCQFLNCSEATLRSWLHVIESNYHSSNAYHNSTHSADVLHATAYFLCKERVKQSLDQIDEVAALIAATVHDVDHPGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTTRDDKCNIFKNMERNEYRTLRQAIIDMVLATEMTKHFEHVNKFVNSINKPLAAVEENGEDEAVKNI------LTSPENRILIKRMLIKCADISNPCRALEQCIEWAGRISEEYFAQTDEEKRKGLPVVMPVFDRNTCSIPKSQISFVDYFITDMFDAWDAFADL 756          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: ENSXETT00000055661.1 (phosphodiesterase 8A [Source:NCBI gene;Acc:100497070])

HSP 1 Score: 356.295 bits (913), Expect = 6.865e-109
Identity = 162/310 (52.26%), Postives = 218/310 (70.32%), Query Frame = 1
Query: 1639 LEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            +++   W FDI +LE  +  +PL Y+G+K+F +F +   LN      ++WLHVIE+NY+ SN YHNSTH+ADVL ++ +FL +E++ +  D  D+V ++IAA +HD+ HPGRTN FL N+   LAILYND AVLE+HH++ AF++T +DD+ NIFKNM R++YR +R  I+D VLATEM KHFEH+ KF+N+I KP      N  +      I     L  PEN+ +I+RMLIKC+D++NP R    C EWA RISEEYF+QTDEE  K LPVVMP F+R TC IPKSQI F+D F+ DMF +W  FAD+
Sbjct:  443 MDNEEDWEFDIFELEAATHKRPLVYLGLKMFARFGVCQFLNCSEATLRSWLHVIESNYHSSNAYHNSTHSADVLHATAYFLCKERVKQSLDQIDEVAALIAATVHDVDHPGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTTRDDKCNIFKNMERNEYRTLRQAIIDMVLATEMTKHFEHVNKFVNSINKPLAAVEENGVSSDAVKNI-----LTSPENRILIKRMLIKCADISNPCRALEQCIEWAGRISEEYFAQTDEEKRKGLPVVMPVFDRNTCSIPKSQISFVDYFITDMFDAWDAFADL 747          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: ENSXETT00000055660.1 (phosphodiesterase 8A [Source:NCBI gene;Acc:100497070])

HSP 1 Score: 356.681 bits (914), Expect = 1.378e-108
Identity = 162/310 (52.26%), Postives = 222/310 (71.61%), Query Frame = 1
Query: 1639 LEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            +++   W FDI +LE  +  +PL Y+G+K+F +F +   LN      ++WLHVIE+NY+ SN YHNSTH+ADVL ++ +FL +E++ +  D  D+V ++IAA +HD+ HPGRTN FL N+   LAILYND AVLE+HH++ AF++T +DD+ NIFKNM R++YR +R  I+D VLATEM KHFEH+ KF+N+I KP      N  +I  +  +++   L  PEN+ +I+RMLIKC+D++NP R    C EWA RISEEYF+QTDEE  K LPVVMP F+R TC IPKSQI F+D F+ DMF +W  FAD+
Sbjct:  486 MDNEEDWEFDIFELEAATHKRPLVYLGLKMFARFGVCQFLNCSEATLRSWLHVIESNYHSSNAYHNSTHSADVLHATAYFLCKERVKQSLDQIDEVAALIAATVHDVDHPGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTTRDDKCNIFKNMERNEYRTLRQAIIDMVLATEMTKHFEHVNKFVNSINKPLAAVEENGGSIEEDEAVKNI--LTSPENRILIKRMLIKCADISNPCRALEQCIEWAGRISEEYFAQTDEEKRKGLPVVMPVFDRNTCSIPKSQISFVDYFITDMFDAWDAFADL 793          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde8a (phosphodiesterase 8A [Source:MGI Symbol;Acc:MGI:1277116])

HSP 1 Score: 358.221 bits (918), Expect = 2.424e-109
Identity = 165/314 (52.55%), Postives = 221/314 (70.38%), Query Frame = 1
Query: 1627 IDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            I + +E+  +W FDI +LE  ++N+PL Y+G+K F +F +   L       ++W  +IE+NY+ SN YHNSTHAADVL ++ +FL R+KI E  D  D+V ++IAA +HD+ HPGRTN FL N+ + LA+LYND AVLE+HH + AF++TL++D+ NIFK M R+DYR +R  I+D VLATEM KHFEH+ KF+N+I   N P  +  S   + +       L  PE++A+I+RM+IKC+DV+NP RP   C EWA RISEEYFSQTDEE   DLPVVMP F+R TC IPKSQI FID F+ DMF +W  F D+
Sbjct:  483 IALAIENEEQWDFDIFELEVATQNRPLIYLGLKTFARFGMCEFLQCSETTLRSWFQMIESNYHSSNPYHNSTHAADVLHATAYFLSRDKIKETLDRIDEVAALIAATVHDVDHPGRTNSFLCNAGNQLAVLYNDTAVLESHHVALAFQLTLENDQCNIFKQMERNDYRTLRQSIIDMVLATEMTKHFEHVNKFINSI---NKPLTAQESEEPDRSLEDIKAMLKTPESRALIKRMMIKCADVSNPCRPLEHCIEWAARISEEYFSQTDEEKQLDLPVVMPVFDRNTCSIPKSQISFIDYFITDMFDAWDAFVDL 793          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde8b (phosphodiesterase 8B [Source:MGI Symbol;Acc:MGI:2443999])

HSP 1 Score: 347.436 bits (890), Expect = 2.977e-106
Identity = 161/309 (52.10%), Postives = 215/309 (69.58%), Query Frame = 1
Query: 1636 LLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFA 2562
            LL++   W F+I +LE ++  +PL Y+G+KVF++F +   LN      + WL VIE NY+ SN YHNSTHAADVL ++ +FL +E++    D  D+V ++IAA +HD+ HPGRTN FL N+   LA+LYND AVLE+HH++ AF++T+KD + NIFKN++R+ YR +R  I+D VLATEM KHFEH+ KF+N+I KP       S    N            PEN+ +I+RM+IKC+DV NP RP ++C EWA RISEEYF+QTDEE  + LPVVMP F+R TC IPKSQI FID F+ DMF +W  FA
Sbjct:  395 LLDNEESWDFNIFELEAVTHKRPLVYLGLKVFSRFGVCEFLNCTETTLRAWLQVIEANYHSSNAYHNSTHAADVLHATAFFLGKERVKGSLDQLDEVAALIAATVHDVDHPGRTNSFLCNAGSELAVLYNDTAVLESHHTALAFQLTVKDTKCNIFKNIDRNHYRTLRQAIIDMVLATEMTKHFEHVNKFVNSINKPLAAESEGSDCECNPTGKNF------PENQILIKRMMIKCADVANPCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQISFIDYFITDMFDAWDAFA 697          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde8b (phosphodiesterase 8B [Source:MGI Symbol;Acc:MGI:2443999])

HSP 1 Score: 348.977 bits (894), Expect = 3.885e-106
Identity = 166/327 (50.76%), Postives = 222/327 (67.89%), Query Frame = 1
Query: 1582 INKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFA 2562
            IN +P  P I +      LL++   W F+I +LE ++  +PL Y+G+KVF++F +   LN      + WL VIE NY+ SN YHNSTHAADVL ++ +FL +E++    D  D+V ++IAA +HD+ HPGRTN FL N+   LA+LYND AVLE+HH++ AF++T+KD + NIFKN++R+ YR +R  I+D VLATEM KHFEH+ KF+N+I KP       S    N            PEN+ +I+RM+IKC+DV NP RP ++C EWA RISEEYF+QTDEE  + LPVVMP F+R TC IPKSQI FID F+ DMF +W  FA
Sbjct:  443 INDVP--PSIAQ------LLDNEESWDFNIFELEAVTHKRPLVYLGLKVFSRFGVCEFLNCTETTLRAWLQVIEANYHSSNAYHNSTHAADVLHATAFFLGKERVKGSLDQLDEVAALIAATVHDVDHPGRTNSFLCNAGSELAVLYNDTAVLESHHTALAFQLTVKDTKCNIFKNIDRNHYRTLRQAIIDMVLATEMTKHFEHVNKFVNSINKPLAAESEGSDCECNPTGKNF------PENQILIKRMMIKCADVANPCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQISFIDYFITDMFDAWDAFA 755          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde8b (phosphodiesterase 8B [Source:MGI Symbol;Acc:MGI:2443999])

HSP 1 Score: 348.206 bits (892), Expect = 4.666e-106
Identity = 166/327 (50.76%), Postives = 222/327 (67.89%), Query Frame = 1
Query: 1582 INKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFA 2562
            IN +P  P I +      LL++   W F+I +LE ++  +PL Y+G+KVF++F +   LN      + WL VIE NY+ SN YHNSTHAADVL ++ +FL +E++    D  D+V ++IAA +HD+ HPGRTN FL N+   LA+LYND AVLE+HH++ AF++T+KD + NIFKN++R+ YR +R  I+D VLATEM KHFEH+ KF+N+I KP       S    N            PEN+ +I+RM+IKC+DV NP RP ++C EWA RISEEYF+QTDEE  + LPVVMP F+R TC IPKSQI FID F+ DMF +W  FA
Sbjct:  435 INDVP--PSIAQ------LLDNEESWDFNIFELEAVTHKRPLVYLGLKVFSRFGVCEFLNCTETTLRAWLQVIEANYHSSNAYHNSTHAADVLHATAFFLGKERVKGSLDQLDEVAALIAATVHDVDHPGRTNSFLCNAGSELAVLYNDTAVLESHHTALAFQLTVKDTKCNIFKNIDRNHYRTLRQAIIDMVLATEMTKHFEHVNKFVNSINKPLAAESEGSDCECNPTGKNF------PENQILIKRMMIKCADVANPCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQISFIDYFITDMFDAWDAFA 747          

HSP 2 Score: 58.5362 bits (140), Expect = 3.965e-8
Identity = 72/405 (17.78%), Postives = 169/405 (41.73%), Query Frame = 1
Query:  274 PMKILFVTVENSFEAQNIEQICAQLEINYKLSYSEVDAISALSQYIFHLIIIDRRNYKMESDYNPDGIAKNVKIKYRSENFKIILY-----DNRGQLNLSELWDLGYDEQWIISGRXXXXXXXXXXXXXXXXPRDFRNEKNALISSAFNKFTDSMEILKNDFSIEIVNETFKKVFKVSKREITGRSWFSFHDISDHRQSV---IKNELSLKKSWEGLLSS--KTDLPIDYPLNVYAVIKP--------------LDVRENYYIVTLNAYFNNQGKSEP-SFSFISMDRESTTIS--------IPRMKDSFFTS----QQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLFITTVDALKSDKMSSNLIDGLLSN-----HATMFAQTENRRHSSS 1362
            P+++L +  +   ++      C +      ++ +   A+         +I+ID R  +   +++ + + ++++    SE+  I+       D+  + ++  L   G++ +++ +  +++  + L           F+      + +A +   +++EI  +D  I+ VN  F+++    K E+ G+          +R  +   I   +   K W+G+  +  K+   I   + +  VI                     N  I  ++    +  ++EP SF   S  +ES  +          P +++  + S      ++I++PI K++ II++ QE S   +   L R++EIL + +L+   +     D  +S+L+ GL+++         +  T+N  HS S
Sbjct:   26 PIQVLLIFAKEDSQSDGFWWACDRAGYRCNIARTPESALECFLDKHHEIIVIDHRQSR---NFDAEAVCRSIRATNPSEHTVILAVVSQASDDHEEASVLPLLHAGFNRRFMENSSIIACYNELIQIEHGEVRSQFKLRACNSVFTALDHCHEAIEITSDDHVIQYVNPAFERMMGYHKGELLGKELADLPKSDKNRADLLDTINTCIKKGKEWQGVYYARRKSGDSIQQHVKITPVIGQGGKIRHFVSLKKLCCTTDSNKQIHRIHRDSGDNSQTEPHSFRHKSRRKESIDVKSISSRGSDAPSLQNRRYPSMARIHSMTIEAPITKVINIINAAQENSPVTVAEALDRVLEILRTTELYSPQLGTKDEDPHTSDLVGGLMTDGLRRLSGNEYVFTKNVHHSHS 427          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde8b (phosphodiesterase 8B [Source:MGI Symbol;Acc:MGI:2443999])

HSP 1 Score: 348.977 bits (894), Expect = 1.007e-105
Identity = 166/327 (50.76%), Postives = 222/327 (67.89%), Query Frame = 1
Query: 1582 INKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFA 2562
            IN +P  P I +      LL++   W F+I +LE ++  +PL Y+G+KVF++F +   LN      + WL VIE NY+ SN YHNSTHAADVL ++ +FL +E++    D  D+V ++IAA +HD+ HPGRTN FL N+   LA+LYND AVLE+HH++ AF++T+KD + NIFKN++R+ YR +R  I+D VLATEM KHFEH+ KF+N+I KP       S    N            PEN+ +I+RM+IKC+DV NP RP ++C EWA RISEEYF+QTDEE  + LPVVMP F+R TC IPKSQI FID F+ DMF +W  FA
Sbjct:  493 INDVP--PSIAQ------LLDNEESWDFNIFELEAVTHKRPLVYLGLKVFSRFGVCEFLNCTETTLRAWLQVIEANYHSSNAYHNSTHAADVLHATAFFLGKERVKGSLDQLDEVAALIAATVHDVDHPGRTNSFLCNAGSELAVLYNDTAVLESHHTALAFQLTVKDTKCNIFKNIDRNHYRTLRQAIIDMVLATEMTKHFEHVNKFVNSINKPLAAESEGSDCECNPTGKNF------PENQILIKRMMIKCADVANPCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQISFIDYFITDMFDAWDAFA 805          
BLAST of Phosphodiesterase vs. UniProt
Match: sp|O60658|PDE8A_HUMAN (High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A OS=Homo sapiens OX=9606 GN=PDE8A PE=1 SV=2)

HSP 1 Score: 362.073 bits (928), Expect = 8.892e-110
Identity = 169/310 (54.52%), Postives = 218/310 (70.32%), Query Frame = 1
Query: 1639 LEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            +E+   W FDI +LE  + N+PL Y+G+K+F +F +   L+      ++WL +IE NY+ SN YHNSTH+ADVL ++ +FL +E+I E  D  D+V ++IAA IHD+ HPGRTN FL N+   LAILYND AVLE+HH++ AF++T  DD+ NIFKNM R+DYR +R GI+D VLATEM KHFEH+ KF+N+I KP      N     N   I + L    PEN+ +I+RMLIKC+DV+NP RP   C EWA RISEEYFSQTDEE  + LPVVMP F+R TC IPKSQI FID F+ DMF +W  F D+
Sbjct:  492 MENEEYWDFDIFELEAATHNRPLIYLGLKMFARFGICEFLHCSESTLRSWLQIIEANYHSSNPYHNSTHSADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDHPGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTTGDDKCNIFKNMERNDYRTLRQGIIDMVLATEMTKHFEHVNKFVNSINKPLATLEENGETDKNQEVINTMLRT--PENRTLIKRMLIKCADVSNPCRPLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPVFDRNTCSIPKSQISFIDYFITDMFDAWDAFVDL 799          
BLAST of Phosphodiesterase vs. UniProt
Match: sp|O88502|PDE8A_MOUSE (High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A OS=Mus musculus OX=10090 GN=Pde8a PE=1 SV=1)

HSP 1 Score: 358.221 bits (918), Expect = 1.696e-108
Identity = 165/314 (52.55%), Postives = 221/314 (70.38%), Query Frame = 1
Query: 1627 IDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            I + +E+  +W FDI +LE  ++N+PL Y+G+K F +F +   L       ++W  +IE+NY+ SN YHNSTHAADVL ++ +FL R+KI E  D  D+V ++IAA +HD+ HPGRTN FL N+ + LA+LYND AVLE+HH + AF++TL++D+ NIFK M R+DYR +R  I+D VLATEM KHFEH+ KF+N+I   N P  +  S   + +       L  PE++A+I+RM+IKC+DV+NP RP   C EWA RISEEYFSQTDEE   DLPVVMP F+R TC IPKSQI FID F+ DMF +W  F D+
Sbjct:  483 IALAIENEEQWDFDIFELEVATQNRPLIYLGLKTFARFGMCEFLQCSETTLRSWFQMIESNYHSSNPYHNSTHAADVLHATAYFLSRDKIKETLDRIDEVAALIAATVHDVDHPGRTNSFLCNAGNQLAVLYNDTAVLESHHVALAFQLTLENDQCNIFKQMERNDYRTLRQSIIDMVLATEMTKHFEHVNKFINSI---NKPLTAQESEEPDRSLEDIKAMLKTPESRALIKRMMIKCADVSNPCRPLEHCIEWAARISEEYFSQTDEEKQLDLPVVMPVFDRNTCSIPKSQISFIDYFITDMFDAWDAFVDL 793          
BLAST of Phosphodiesterase vs. UniProt
Match: sp|E9Q4S1|PDE8B_MOUSE (High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B OS=Mus musculus OX=10090 GN=Pde8b PE=1 SV=1)

HSP 1 Score: 349.747 bits (896), Expect = 7.717e-105
Identity = 166/327 (50.76%), Postives = 222/327 (67.89%), Query Frame = 1
Query: 1582 INKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFA 2562
            IN +P  P I +      LL++   W F+I +LE ++  +PL Y+G+KVF++F +   LN      + WL VIE NY+ SN YHNSTHAADVL ++ +FL +E++    D  D+V ++IAA +HD+ HPGRTN FL N+   LA+LYND AVLE+HH++ AF++T+KD + NIFKN++R+ YR +R  I+D VLATEM KHFEH+ KF+N+I KP       S    N            PEN+ +I+RM+IKC+DV NP RP ++C EWA RISEEYF+QTDEE  + LPVVMP F+R TC IPKSQI FID F+ DMF +W  FA
Sbjct:  520 INDVP--PSIAQ------LLDNEESWDFNIFELEAVTHKRPLVYLGLKVFSRFGVCEFLNCTETTLRAWLQVIEANYHSSNAYHNSTHAADVLHATAFFLGKERVKGSLDQLDEVAALIAATVHDVDHPGRTNSFLCNAGSELAVLYNDTAVLESHHTALAFQLTVKDTKCNIFKNIDRNHYRTLRQAIIDMVLATEMTKHFEHVNKFVNSINKPLAAESEGSDCECNPTGKNF------PENQILIKRMMIKCADVANPCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQISFIDYFITDMFDAWDAFA 832          

HSP 2 Score: 57.7658 bits (138), Expect = 4.899e-7
Identity = 68/389 (17.48%), Postives = 164/389 (42.16%), Query Frame = 1
Query:  259 ETFISPMKILFVTVENSFEAQNIEQICAQLEINYKLSYSEVDAISALSQYIFHLIIIDRRNYKMESDYNPDGIAKNVKIKYRSENFKIILY-----DNRGQLNLSELWDLGYDEQWIISGRXXXXXXXXXXXXXXXXPRDFRNEKNALISSAFNKFTDSMEILKNDFSIEIVNETFKKVFKVSKREITGRSWFSFHDISDHRQSV---IKNELSLKKSWEGLLSS--KTDLPIDYPLNVYAVIKP--------------LDVRENYYIVTLNAYFNNQGKSEP-SFSFISMDRESTTIS--------IPRMKDSFFTS----QQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLFITTVDALKSDKMSSNLIDGLLSN 1314
            +T  + +K+L +  +   ++      C +      ++ +   A+         +I+ID R  +   +++ + + ++++    SE+  I+       D+  + ++  L   G++ +++ +  +++  + L           F+      + +A +   +++EI  +D  I+ VN  F+++    K E+ G+          +R  +   I   +   K W+G+  +  K+   I   + +  VI                     N  I  ++    +  ++EP SF   S  +ES  +          P +++  + S      ++I++PI K++ II++ QE S   +   L R++EIL + +L+   +     D  +S+L+ GL+++
Sbjct:  106 QTSYTSVKVLLIFAKEDSQSDGFWWACDRAGYRCNIARTPESALECFLDKHHEIIVIDHRQSR---NFDAEAVCRSIRATNPSEHTVILAVVSQASDDHEEASVLPLLHAGFNRRFMENSSIIACYNELIQIEHGEVRSQFKLRACNSVFTALDHCHEAIEITSDDHVIQYVNPAFERMMGYHKGELLGKELADLPKSDKNRADLLDTINTCIKKGKEWQGVYYARRKSGDSIQQHVKITPVIGQGGKIRHFVSLKKLCCTTDSNKQIHRIHRDSGDNSQTEPHSFRHKSRRKESIDVKSISSRGSDAPSLQNRRYPSMARIHSMTIEAPITKVINIINAAQENSPVTVAEALDRVLEILRTTELYSPQLGTKDEDPHTSDLVGGLMTD 491          
BLAST of Phosphodiesterase vs. UniProt
Match: sp|O95263|PDE8B_HUMAN (High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B OS=Homo sapiens OX=9606 GN=PDE8B PE=1 SV=2)

HSP 1 Score: 349.362 bits (895), Expect = 1.583e-104
Identity = 161/316 (50.95%), Postives = 215/316 (68.04%), Query Frame = 1
Query: 1624 VIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLAD---PENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFA 2562
             I  LL++   W F+I +LE ++  +PL Y+G+KVF++F +   LN      + W  VIE NY+ SN YHNSTHAADVL ++ +FL +E++    D  D+V ++IAA +HD+ HPGRTN FL N+   LA+LYND AVLE+HH++ AF++T+KD + NIFKN++R+ YR +R  I+D VLATEM KHFEH+ KF+N+I KP                     N A    PEN+ +I+RM+IKC+DV NP RP ++C EWA RISEEYF+QTDEE  + LPVVMP F+R TC IPKSQI FID F+ DMF +W  FA
Sbjct:  546 CISQLLDNEESWDFNIFELEAITHKRPLVYLGLKVFSRFGVCEFLNCSETTLRAWFQVIEANYHSSNAYHNSTHAADVLHATAFFLGKERVKGSLDQLDEVAALIAATVHDVDHPGRTNSFLCNAGSELAVLYNDTAVLESHHTALAFQLTVKDTKCNIFKNIDRNHYRTLRQAIIDMVLATEMTKHFEHVNKFVNSINKP---------MAAEIEGSDCECNPAGKNFPENQILIKRMMIKCADVANPCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQISFIDYFITDMFDAWDAFA 852          

HSP 2 Score: 58.151 bits (139), Expect = 3.858e-7
Identity = 66/384 (17.19%), Postives = 164/384 (42.71%), Query Frame = 1
Query:  274 PMKILFVTVENSFEAQNIEQICAQLEINYKLSYSEVDAISALSQYIFHLIIIDRRNYKMESDYNPDGIAKNVKIKYRSENFKII-----LYDNRGQLNLSELWDLGYDEQWIISGRXXXXXXXXXXXXXXXXPRDFRNEKNALISSAFNKFTDSMEILKNDFSIEIVNETFKKVFKVSKREITGRSWFSFHDISDHRQSV---IKNELSLKKSWEGLLSS--KTDLPIDYPLNVYAVIKP--------------LDVRENYYIVTLNAYFNNQGKSEP-SFSFISMDRESTTIS--------IPRMKDSFFTS----QQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLFITTVDALKSDKMSSNLIDGLLSN 1314
            P+++L +  +   ++      C +      ++ +   A+         +I+ID R  +   +++ + + ++++    SE+  I+     + D+  + ++  L   G++ +++ +  +++  + L           F+      + +A +   +++EI  +D  I+ VN  F+++    K E+ G+          +R  +   I   +   K W+G+  +  K+   I   + +  VI                     N  I  ++    +  ++EP SF + +  +ES  +          P +++  + S      ++I++PI K++ II++ QE S   +   L R++EIL + +L+   +     D  +S+L+ GL+++
Sbjct:  131 PIQVLLIFAKEDSQSDGFWWACDRAGYRCNIARTPESALECFLDKHHEIIVIDHRQTQ---NFDAEAVCRSIRATNPSEHTVILAVVSRVSDDHEEASVLPLLHAGFNRRFMENSSIIACYNELIQIEHGEVRSQFKLRACNSVFTALDHCHEAIEITSDDHVIQYVNPAFERMMGYHKGELLGKELADLPKSDKNRADLLDTINTCIKKGKEWQGVYYARRKSGDSIQQHVKITPVIGQGGKIRHFVSLKKLCCTTDNNKQIHKIHRDSGDNSQTEPHSFRYKNRRKESIDVKSISSRGSDAPSLQNRRYPSMARIHSMTIEAPITKVINIINAAQENSPVTVAEALDRVLEILRTTELYSPQLGTKDEDPHTSDLVGGLMTD 511          
BLAST of Phosphodiesterase vs. UniProt
Match: sp|Q6NNF2|PDE8_DROME (High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8 OS=Drosophila melanogaster OX=7227 GN=Pde8 PE=2 SV=1)

HSP 1 Score: 304.679 bits (779), Expect = 5.824e-88
Identity = 149/313 (47.60%), Postives = 210/313 (67.09%), Query Frame = 1
Query: 1636 LLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLER--EKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            LL++   W FDI KLE++++  PL Y+GM++F +F++ + LNID  + + WL VIE +Y  SN YHNSTHAADV+Q++  F+ +   K   + D  ++  ++IAA  HD+ HPGR++ FL NS+ +LA+LYND+ VLENHH++  FK+TL DD+INIFKN++++ Y++ R  I+D +LATEM +HFEHL KF+ ++     P   N                 D E   ++RRMLIK +DV+NP RP   C EWA RI+EEYF QTDEE  + LP+VMP F+R TC IPKSQI FI+  +QDM  +W  F D+
Sbjct:  575 LLDESLSWDFDIFKLEEITDYHPLLYLGMEMFRRFDVFATLNIDENVCKAWLAVIEAHYRKSNTYHNSTHAADVMQATGAFITQLTNKDMLVMDRMEEATALIAAAAHDVDHPGRSSAFLCNSNDALAVLYNDLTVLENHHAAITFKLTLGDDKINIFKNLDKETYKSARSTIIDMILATEMTRHFEHLAKFV-SVFGGEEPRDHNPQ--------------TDEETSILMRRMLIKVADVSNPARPMQFCIEWARRIAEEYFMQTDEEKQRHLPIVMPMFDRATCSIPKSQIGFIEYIIQDMMHAWESFIDM 872          
BLAST of Phosphodiesterase vs. TrEMBL
Match: gnl|BL_ORD_ID|18323350 (tr|A0A267GWB8|A0A267GWB8_9PLAT Phosphodiesterase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015483g1 PE=3 SV=1)

HSP 1 Score: 432.95 bits (1112), Expect = 1.093e-134
Identity = 242/632 (38.29%), Postives = 356/632 (56.33%), Query Frame = 1
Query:  712 TDSMEILKNDFSIEIVNETFKKVFKVSKREITGRSWFSF--HDISDHRQSVIKNELSLKKSWEGLLSS--KTDLPIDYPLNVYAVIKPLDVRENYYIVTLNAYFNNQGKSEP----SFSFISMDREST---TISIPRMKDSFFTS-QQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEIL-SSKDLFITTVDALKSDKMSSNLIDGLLSNHATMFAQTENRRHSSSLTKRRQTRVNSEVIHDHITQVLGKAVKILSSVYICMALDKCYLQYATPNXXXXXXXXXXXXXXXLTAKPRHSKINKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            +D++EI  + F I+  N   +++F  +  E+ G+S F     D +D   S ++  L   K W+G ++   K+    D+  ++Y V K    +  +++    +  ++ G  E     S    S+ ++S+    I     KDS       V+I++PI K++ +I+  QE SNP +   L R++EIL  S DL+   + + + DKM+S+ + GL+    T  ++   ++    L  RR  +  SE++ +HI Q+L  +                                              S I  + E+PE      +   L++   WSFDI++LE+++E KP+ Y+ MK   +F +   L         WL VI+ +Y+  NCYHN+TH ADV+QSS +FLER++I  IFD  D+V S++ A++HDL HPGRTNPFLINS H LAILYNDI VLE+HH S AF++T +DDRINIFKNM+R+DY+ +R  ++D VLATEMAKHFEH+ KF N I+ P               E    + L   EN+ +I+R+LIKCSDV+NP R   +CKEWA RISEEYF QTDEE SK LP+VMP F+R TC++P SQ  FID FL++MF++WH F DV
Sbjct:  153 SDAVEITNDKFQIQYANPAHERMFGFALGEMIGKSSFEMIHSDKTDEEVSNLQQHLRRGKEWDGAVTGRRKSGASADHHNSIYPV-KGRKGKVQHFVCLKQSGSHHAGGYEKHLANSHHDYSLPKDSSLMAGIKTGSRKDSGTGRLNSVTIEAPIHKVINLINVAQENSNPTVAAALDRVLEILHQSTDLYTGELPSTQEDKMTSDYVGGLM----TGGSKPPEKKRQVMLQPRRMHQRPSEIMSEHINQLLENSS---------------------------------------------SNIQSLSEIPE-----ELLAYLDNDDDWSFDIIELERVTEKKPMVYLAMKTLQRFNVCHFLQCSEDTMLKWLQVIQDHYHADNCYHNATHGADVMQSSAYFLERDRIKSIFDEMDEVASLLGALVHDLDHPGRTNPFLINSQHKLAILYNDITVLESHHVSLAFQLTTRDDRINIFKNMSREDYKTLRQSMIDIVLATEMAKHFEHVGKFANQIVAPLVAKEGEEGAERITEEEALEM-LTKSENRTLIKRVLIKCSDVSNPCRSLKLCKEWAKRISEEYFQQTDEEKSKGLPIVMPVFDRTTCNMPHSQTSFIDFFLREMFSAWHAFCDV 728          
BLAST of Phosphodiesterase vs. TrEMBL
Match: gnl|BL_ORD_ID|15780804 (tr|A0A267EMK8|A0A267EMK8_9PLAT Phosphodiesterase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015483g2 PE=3 SV=1)

HSP 1 Score: 433.335 bits (1113), Expect = 2.449e-134
Identity = 242/632 (38.29%), Postives = 356/632 (56.33%), Query Frame = 1
Query:  712 TDSMEILKNDFSIEIVNETFKKVFKVSKREITGRSWFSF--HDISDHRQSVIKNELSLKKSWEGLLSS--KTDLPIDYPLNVYAVIKPLDVRENYYIVTLNAYFNNQGKSEP----SFSFISMDREST---TISIPRMKDSFFTS-QQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEIL-SSKDLFITTVDALKSDKMSSNLIDGLLSNHATMFAQTENRRHSSSLTKRRQTRVNSEVIHDHITQVLGKAVKILSSVYICMALDKCYLQYATPNXXXXXXXXXXXXXXXLTAKPRHSKINKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            +D++EI  + F I+  N   +++F  +  E+ G+S F     D +D   S ++  L   K W+G ++   K+    D+  ++Y V K    +  +++    +  ++ G  E     S    S+ ++S+    I     KDS       V+I++PI K++ +I+  QE SNP +   L R++EIL  S DL+   + + + DKM+S+ + GL+    T  ++   ++    L  RR  +  SE++ +HI Q+L  +                                              S I  + E+PE      +   L++   WSFDI++LE+++E KP+ Y+ MK   +F +   L         WL VI+ +Y+  NCYHN+TH ADV+QSS +FLER++I  IFD  D+V S++ A++HDL HPGRTNPFLINS H LAILYNDI VLE+HH S AF++T +DDRINIFKNM+R+DY+ +R  ++D VLATEMAKHFEH+ KF N I+ P               E    + L   EN+ +I+R+LIKCSDV+NP R   +CKEWA RISEEYF QTDEE SK LP+VMP F+R TC++P SQ  FID FL++MF++WH F DV
Sbjct:  201 SDAVEITNDKFQIQYANPAHERMFGFALGEMIGKSSFEMIHSDKTDEEVSNLQQHLRRGKEWDGAVTGRRKSGASADHHNSIYPV-KGRKGKVQHFVCLKQSGSHHAGGYEKHLANSHHDYSLPKDSSLMAGIKTGSRKDSGTGRLNSVTIEAPIHKVINLINVAQENSNPTVAAALDRVLEILHQSTDLYTGELPSTQEDKMTSDYVGGLM----TGGSKPPEKKRQVMLQPRRMHQRPSEIMSEHINQLLENSS---------------------------------------------SNIQSLSEIPE-----ELLAYLDNDDDWSFDIIELERVTEKKPMVYLAMKTLQRFNVCHFLQCSEDTMLKWLQVIQDHYHADNCYHNATHGADVMQSSAYFLERDRIKSIFDEMDEVASLLGALVHDLDHPGRTNPFLINSQHKLAILYNDITVLESHHVSLAFQLTTRDDRINIFKNMSREDYKTLRQSMIDIVLATEMAKHFEHVGKFANQIVAPLVAKEGEEGAERITEEEALEM-LTKSENRTLIKRVLIKCSDVSNPCRSLKLCKEWAKRISEEYFQQTDEEKSKGLPIVMPVFDRTTCNMPHSQTSFIDFFLREMFSAWHAFCDV 776          
BLAST of Phosphodiesterase vs. TrEMBL
Match: gnl|BL_ORD_ID|20335237 (tr|A0A1S3IEX1|A0A1S3IEX1_LINUN Phosphodiesterase OS=Lingula unguis OX=7574 GN=LOC106163080 PE=3 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 4.699e-119
Identity = 207/497 (41.65%), Postives = 304/497 (61.17%), Query Frame = 1
Query: 1087 RMKDSFFTSQQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLF---ITTVDALKSDKMSSNLIDGLLSNHATMFAQTENRRHSSSLTKRRQTRVNSEVIHDHITQVLGKAVKILSSVYICMALDKCYLQYATPNXXXXXXXXXXXXXXXLTAKPRHSKINKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            R +DS      ++I++PI K++ II++ QE S   +   L +++EIL + +L+   +T+    + D+M+S+L+ GL+S+  ++ +  + +      TKRR +  +    H HI                                                  P+      + +VP       I  LLE   +W F+IL+LE+L+  +PL Y+ MK FT+F +   LN       NWL +IE  Y+ SN YHNSTHAADV+QS+ +FLER++I  +FD  D+V S+IAA++HD+ HPG+TN FL+N+ + LA++YND+AVLE+HH S AF+++ ++D +NIFKN+ RDD+RA+R  I+D VLATE+ KHFEHL+KF+N   K          ++  + + +++L+L  PENKA+I+RM+IKCSDV+NP RPF +CKEWA RI+EEYF QTDEE S  LPVVMP F+R+TC IPKSQI FID F+ +MF +W  FADV
Sbjct:  332 RRRDSAARIHSMTIEAPINKVINIINAAQENSPLTVVQALDKVLEILRTTELYSPHLTSQQVREEDQMTSDLVGGLMSSQGSVRSAEQEQ----GTTKRRMSSTDKFSHHSHI--------------------------------------------------PQQLPATMLSQVP-----ADISRLLETEPQWEFNILELERLTNRRPLAYLAMKTFTRFNVCEFLNTSETTMWNWLQLIEAKYHSSNKYHNSTHAADVMQSTAYFLERQRIKSLFDHMDEVASLIAAVVHDVDHPGKTNAFLVNAGNDLALVYNDLAVLESHHVSLAFRLSAQNDDVNIFKNLERDDFRAMRQMIIDMVLATELTKHFEHLSKFVNCT-KHFVEKEEEDFSLNGSQDAQTTLSL--PENKAVIKRMIIKCSDVSNPARPFYLCKEWALRIAEEYFQQTDEEKSLGLPVVMPVFDRKTCSIPKSQISFIDFFINEMFEAWDDFADV 766          
BLAST of Phosphodiesterase vs. TrEMBL
Match: gnl|BL_ORD_ID|20319449 (tr|A0A1S3ICW6|A0A1S3ICW6_LINUN Phosphodiesterase OS=Lingula unguis OX=7574 GN=LOC106163080 PE=3 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 6.856e-119
Identity = 207/497 (41.65%), Postives = 304/497 (61.17%), Query Frame = 1
Query: 1087 RMKDSFFTSQQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLF---ITTVDALKSDKMSSNLIDGLLSNHATMFAQTENRRHSSSLTKRRQTRVNSEVIHDHITQVLGKAVKILSSVYICMALDKCYLQYATPNXXXXXXXXXXXXXXXLTAKPRHSKINKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            R +DS      ++I++PI K++ II++ QE S   +   L +++EIL + +L+   +T+    + D+M+S+L+ GL+S+  ++ +  + +      TKRR +  +    H HI                                                  P+      + +VP       I  LLE   +W F+IL+LE+L+  +PL Y+ MK FT+F +   LN       NWL +IE  Y+ SN YHNSTHAADV+QS+ +FLER++I  +FD  D+V S+IAA++HD+ HPG+TN FL+N+ + LA++YND+AVLE+HH S AF+++ ++D +NIFKN+ RDD+RA+R  I+D VLATE+ KHFEHL+KF+N   K          ++  + + +++L+L  PENKA+I+RM+IKCSDV+NP RPF +CKEWA RI+EEYF QTDEE S  LPVVMP F+R+TC IPKSQI FID F+ +MF +W  FADV
Sbjct:  345 RRRDSAARIHSMTIEAPINKVINIINAAQENSPLTVVQALDKVLEILRTTELYSPHLTSQQVREEDQMTSDLVGGLMSSQGSVRSAEQEQ----GTTKRRMSSTDKFSHHSHI--------------------------------------------------PQQLPATMLSQVP-----ADISRLLETEPQWEFNILELERLTNRRPLAYLAMKTFTRFNVCEFLNTSETTMWNWLQLIEAKYHSSNKYHNSTHAADVMQSTAYFLERQRIKSLFDHMDEVASLIAAVVHDVDHPGKTNAFLVNAGNDLALVYNDLAVLESHHVSLAFRLSAQNDDVNIFKNLERDDFRAMRQMIIDMVLATELTKHFEHLSKFVNCT-KHFVEKEEEDFSLNGSQDAQTTLSL--PENKAVIKRMIIKCSDVSNPARPFYLCKEWALRIAEEYFQQTDEEKSLGLPVVMPVFDRKTCSIPKSQISFIDFFINEMFEAWDDFADV 779          
BLAST of Phosphodiesterase vs. TrEMBL
Match: gnl|BL_ORD_ID|20306644 (tr|A0A1S3IDS4|A0A1S3IDS4_LINUN Phosphodiesterase OS=Lingula unguis OX=7574 GN=LOC106163080 PE=3 SV=1)

HSP 1 Score: 395.586 bits (1015), Expect = 7.267e-119
Identity = 207/497 (41.65%), Postives = 304/497 (61.17%), Query Frame = 1
Query: 1087 RMKDSFFTSQQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLF---ITTVDALKSDKMSSNLIDGLLSNHATMFAQTENRRHSSSLTKRRQTRVNSEVIHDHITQVLGKAVKILSSVYICMALDKCYLQYATPNXXXXXXXXXXXXXXXLTAKPRHSKINKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            R +DS      ++I++PI K++ II++ QE S   +   L +++EIL + +L+   +T+    + D+M+S+L+ GL+S+  ++ +  + +      TKRR +  +    H HI                                                  P+      + +VP       I  LLE   +W F+IL+LE+L+  +PL Y+ MK FT+F +   LN       NWL +IE  Y+ SN YHNSTHAADV+QS+ +FLER++I  +FD  D+V S+IAA++HD+ HPG+TN FL+N+ + LA++YND+AVLE+HH S AF+++ ++D +NIFKN+ RDD+RA+R  I+D VLATE+ KHFEHL+KF+N   K          ++  + + +++L+L  PENKA+I+RM+IKCSDV+NP RPF +CKEWA RI+EEYF QTDEE S  LPVVMP F+R+TC IPKSQI FID F+ +MF +W  FADV
Sbjct:  407 RRRDSAARIHSMTIEAPINKVINIINAAQENSPLTVVQALDKVLEILRTTELYSPHLTSQQVREEDQMTSDLVGGLMSSQGSVRSAEQEQ----GTTKRRMSSTDKFSHHSHI--------------------------------------------------PQQLPATMLSQVP-----ADISRLLETEPQWEFNILELERLTNRRPLAYLAMKTFTRFNVCEFLNTSETTMWNWLQLIEAKYHSSNKYHNSTHAADVMQSTAYFLERQRIKSLFDHMDEVASLIAAVVHDVDHPGKTNAFLVNAGNDLALVYNDLAVLESHHVSLAFRLSAQNDDVNIFKNLERDDFRAMRQMIIDMVLATELTKHFEHLSKFVNCT-KHFVEKEEEDFSLNGSQDAQTTLSL--PENKAVIKRMIIKCSDVSNPARPFYLCKEWALRIAEEYFQQTDEEKSLGLPVVMPVFDRKTCSIPKSQISFIDFFINEMFEAWDDFADV 841          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde8b (phosphodiesterase 8B [Source:ZFIN;Acc:ZDB-GENE-091117-3])

HSP 1 Score: 348.591 bits (893), Expect = 5.136e-106
Identity = 161/315 (51.11%), Postives = 219/315 (69.52%), Query Frame = 1
Query: 1624 VIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            + +IL E+ H W F IL+LE  +  +PL Y+G+K+F  F +   LN    + ++WL +IE NY+ SN YHNSTHAADVL ++ +FL ++K+    D  D++ S+IAA +HD+ HPGRTN FL N+   LAILYND AVLE+HH++ AF++T++D + NIFKNM R  +R +R  I+D VLATEM +HFEH+ KF+N+I KP      + S+      +R+      PEN+ +I+RM+IKC+DV NP RP  +C EWA RISEEYF+QTDEE  + LPVVMP F+R TC IPKSQI FID F+ DMF +W  FA +
Sbjct:  470 IAEILNEEEH-WDFSILELEAATHKRPLTYLGLKIFAHFGVSEFLNCTEAVMRSWLQMIEANYHASNSYHNSTHAADVLHATAYFLRKDKVKGSLDQLDEIASLIAATVHDVDHPGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTVRDSKCNIFKNMERTQFRTLRQAIIDMVLATEMTRHFEHVNKFVNSINKPMAAIEDDGSDCEGQANVRN-----SPENRLLIKRMMIKCADVANPCRPLQLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQISFIDYFITDMFDAWDAFAGL 778          

HSP 2 Score: 62.3882 bits (150), Expect = 1.978e-9
Identity = 54/230 (23.48%), Postives = 108/230 (46.96%), Query Frame = 1
Query:  688 ISSAFNKFTDSMEILKNDFSIEIVNETFKKVFKVSKREITGRSWFSF----HDISDHRQSVIKNELSLKKSWEGLLSS--KTDLPIDYPLNVYAVI-KPLDVRENYYIVTLNAYFNNQGKSEPSFSFISMDRESTTISI----------PRMKDSFFTS----QQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLFITTVDALKSDKMSSNLIDGLLSN 1314
            I +A     D++EI   D  I+ VN  F+++    K E+ G+    F     + +D  +S I N +   K W+G+ ++  K+   I   + +  VI +   +R    I   +   N Q       S    DR   ++ +          P +++  ++S      ++I++PI K++ II++ QE S   +   L R++EIL + +L+   + + + D  +++L+ GL+S+
Sbjct:  208 IFTALEHCQDAVEITSEDHVIQYVNPAFERMMGYHKGELIGKELTEFSKSDKNCADLLES-INNCIKKGKEWQGICNARRKSGDSIQQHVKITPVIGQGGKIRHFVAIKRPHCDSNRQVSFTECNSLRHKDRRKESVDVRSISSRSSDAPSLQNRRYSSMARIHSMTIEAPITKVINIINAAQESSPVTVAEALDRVLEILRTTELYSPQLGSKEDDPHTNDLVGGLMSD 436          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde8a (phosphodiesterase 8A [Source:ZFIN;Acc:ZDB-GENE-070112-622])

HSP 1 Score: 295.049 bits (754), Expect = 1.619e-86
Identity = 150/310 (48.39%), Postives = 210/310 (67.74%), Query Frame = 1
Query: 1639 LEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            +E+   W FDI  LE  +  +PL Y+G+K+F++F +   L+      ++WL VIE NY+ SN YHNS+HAADVL ++ +FL +E++ +  D  D+V ++IAA +HD+ HPGRTN FL N+   LAILYND AVLE+HH++ AF+++ +DD+ NIFKNM R +YR++R  I+D VLATEM KHFEH+ KF+N+I   N P  +   N  N ++      L+ PEN+ +++RMLIKC+D++NP RP  +C EWA RISEEYF+QTDEE  +               IPKSQI FID F+ DMF +W  FAD+
Sbjct:  458 MENEDSWDFDIFSLEAATMKRPLTYLGLKIFSRFGVCEFLSCPEATLRSWLQVIEANYHSSNSYHNSSHAADVLHATAYFLCKERVKQSLDPIDEVAALIAATVHDVDHPGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLSTRDDKCNIFKNMERTEYRSLRQAIIDMVLATEMTKHFEHVNKFVNSI---NKPLAALEENGGNGDDEAVKGILSVPENRILVKRMLIKCADISNPCRPLELCIEWAGRISEEYFAQTDEEKRQGF-------------IPKSQISFIDYFITDMFDAWDAFADL 751          

HSP 2 Score: 63.929 bits (154), Expect = 6.042e-10
Identity = 67/363 (18.46%), Postives = 156/363 (42.98%), Query Frame = 1
Query:  277 MKILFVTVENSFEAQNIEQICAQLEINYKLSYSEVDAISALSQYIFHLIIIDRRNYKMESDYNPDGIAKNVKIKYRSEN---FKIILYDNRGQLNLSELWDLGYDEQWIISGRXXXXXXXXXXXXXXXXPRDFRNEKNALISSAFNKFTDSMEILKNDFSIEIVNETFKKVFKVSKREITGRSWFSFHDISDHRQSV---IKNELSLKKSWEGL--LSSKTDLPIDYPLNVYAVIKPLDVRENYYIVTLNAYFNNQGKSEPSFSFISMDREST---------TISIPRMKDSFFTSQQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLFITTVDALKSDKMSSNLIDGLLSN 1314
            +++L V  +   ++      C +      ++ +   A+ +  +    LIIID R+ +   +++ + + ++++    S+N     ++   +R +  +  L   G++ +++ +  +++  + L            +      I +A  +  D++EI   D  I+ VN  ++ V    + E+  +          ++  +   I N +   K W+GL     K    +   + +  VI       +Y  V++N   N+  KSE S   +  + ++          T S  R   S      ++I++PI K++ II++ QE S   +   L R++EIL + +L+   +     D  +++L+ GL+++
Sbjct:   61 LQVLLVFAKEDSQSSGFCWACERANFRVSVARTPESALHSFLEKHHDLIIIDHRHSR---NFDAEALCRSIRALSSSQNTVIVAVVKRPDREEATVMPLLSAGFNRRYVENSNMMACYNELIQLHHGEIRSQIKLRACNAIFTALEQSQDAIEISNEDQLIQYVNPAYESVMGYQQGELMAKENVEVPKSEKNKPDLLESINNCIRKGKEWQGLYYAKKKNGDSVQQNVKITPVIGQGGKVRHY--VSINRPLNDNNKSERSSERVQAESQTGKKLRASELHTRSSQRRHSSMARIHSMTIEAPITKVINIINAAQESSPMPVAEALDRVLEILRTTELYSPQLGTKDEDPHTNDLVGGLMTD 418          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: ENSAMXT00000006511.2 (pep primary_assembly:Astyanax_mexicanus-2.0:1:73945:82018:1 gene:ENSAMXG00000006345.2 transcript:ENSAMXT00000006511.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 188.348 bits (477), Expect = 6.808e-51
Identity = 97/304 (31.91%), Postives = 168/304 (55.26%), Query Frame = 1
Query: 1639 LEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSW 2550
            LED H+W  DI K+ + S N+PL      +F + +L  +  I    F  ++  +E NY     YHNS HAADV+QS+   L    +  +F   + + ++ A+ IHD+ HPG +N FLIN++  LA++YND +VLENHH +  FK+ L+++  +IF+N+++   +++R  ++D VLAT+M+KH   L      +              T        L L +  ++  + + ++ C+D++NPT+P  + ++W  RI  E+F+Q D E  + + +  P  ++    I KSQ+ FID  +  ++ +W
Sbjct:   81 LEDIHRWGVDIFKISKYSGNRPLTVTMYSIFQERDLLKMFKIPADTFITFMMALEENYRSDVAYHNSIHAADVVQSTNVLLSTPALEAVFTDLEILAALFASAIHDVDHPGVSNQFLINTNSELALMYNDASVLENHHLAVGFKL-LQEENCDIFQNLSKKQRQSLRKIVIDMVLATDMSKHMNLLADLKTMV-------------ETKKVTSLGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLELYRQWTDRIMVEFFTQGDRERERGMEIS-PMCDKHNASIEKSQVGFIDYIVHPLWETW 369          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde4cb (phosphodiesterase 4C [Source:NCBI gene;Acc:103044346])

HSP 1 Score: 182.185 bits (461), Expect = 3.304e-48
Identity = 95/304 (31.25%), Postives = 170/304 (55.92%), Query Frame = 1
Query: 1639 LEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSW 2550
            +ED ++W  DI K+ + S N+PL  I   +F + +L     I    F  ++  +E +Y+    YHN+ HAADV+QS+   L    +  +F   + + ++ A+ IHD+ HPG +N FLIN++  LA++YND +VLENHH +  FK+ L+++  +IF+N+++   +++R  ++D VLAT+M+KH   L      +              T        L L +  ++  + + ++ C+D++NPT+P  + ++W  RI  EYF+Q D E  + + +  P  ++ T  + KSQ+ FID  +  ++ +W
Sbjct:  171 VEDINRWGLDIFKIAEHSGNRPLTVIMYSIFQERDLLKSFKIPTDTFITFMMTLEDHYHADVAYHNNIHAADVVQSTHVLLSSPALEAVFTDLEIMAALFASAIHDVDHPGVSNQFLINTNSELALMYNDASVLENHHLAVGFKL-LQEENCDIFQNLSKKQRQSLRKMVIDMVLATDMSKHMNFLADLKTMV-------------ETKKVTSLGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLEIYRQWTDRIMVEYFTQGDRERDRGMEIS-PMCDKHTASVEKSQVGFIDYIVHPLWETW 459          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: PDE4D (phosphodiesterase 4D [Source:HGNC Symbol;Acc:HGNC:8783])

HSP 1 Score: 183.726 bits (465), Expect = 9.274e-48
Identity = 96/304 (31.58%), Postives = 168/304 (55.26%), Query Frame = 1
Query: 1639 LEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSW 2550
            LED +KW  ++ K+ + S N+PL  +   +F + +L     I    F  +L  +E +Y+    YHN+ HAADV QS+   L    +  +F   + + +I A+ IHD+ HPG +N FLIN++  LA++YND +VLENHH +  FK+ L+++  +IF+N+ +   +++R  ++D VLAT+M+KH   L      +              T        L L +  ++  + + ++ C+D++NPT+P  + ++W  RI EE+FSQ D E  + + +  P  ++    + KSQ+ FID  +  ++ +W
Sbjct:  327 LEDVNKWGLNVFKVTEFSGNRPLTVMMYTIFQERDLLKTFKIPLDTFITYLMTLEDHYHGDVAYHNNIHAADVTQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKL-LQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMV-------------ETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFSQGDRERERGMEIS-PMCDKHNASVEKSQVGFIDYIVHPLWETW 615          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: pde8a (phosphodiesterase 8A [Source:ZFIN;Acc:ZDB-GENE-070112-622])

HSP 1 Score: 333.183 bits (853), Expect = 2.857e-102
Identity = 151/320 (47.19%), Postives = 218/320 (68.12%), Query Frame = 1
Query: 1624 VIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILK-----PNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
             +  +L+    W FDI +LE  +  +PL Y+G+KVF +F +   L       + WL +IE NY+ SN YHNSTHAADVL ++ +FL +E++    D  D+V ++IAA +HD+ HPGRTN FL N+   LA+LYND AVLE+HH++ AF+++++D   NIF+NM+R ++R +R  I+D VLATEM KHFEH+ KF+N++ K       G ++S + + + ++        + PE + +++RMLIKC+DV NP RP  +C EWA RISEEYF+QTDEE  K LPVVMP F+R +C +PKSQI FID F+ DMF +W  +A++
Sbjct:  332 CVAFILDAEETWDFDIFELESSTHARPLVYLGLKVFARFGVCDFLGCSEATLRAWLSLIEANYHSSNSYHNSTHAADVLHATAYFLRKERVKSCLDQADEVAALIAATVHDVDHPGRTNSFLCNAGSELAVLYNDTAVLESHHAALAFQLSMRDRAANIFRNMDRSEFRTLRQAIIDMVLATEMTKHFEHVNKFVNSVNKMAAAGSTGDSVSLNGSSSEDDSGGGPGPPSTPEMRLLVKRMLIKCADVCNPCRPLALCVEWAGRISEEYFAQTDEEKRKGLPVVMPVFDRCSCSVPKSQISFIDYFITDMFDAWDAYAEL 651          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: PDE1C (phosphodiesterase 1C [Source:HGNC Symbol;Acc:HGNC:8776])

HSP 1 Score: 167.548 bits (423), Expect = 5.280e-45
Identity = 96/304 (31.58%), Postives = 162/304 (53.29%), Query Frame = 1
Query: 1636 LLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYND-SNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFT 2544
            +L++  KWSFD+  L + S    L++I  ++FT+++L +   I      +++  +E  Y+   N YHNS HAADV Q+  + + +       +  + +  I AA IHD  H G TN F I +    AILYND +VLENHH S A+++  +D+ +NI  N+++DD+R +R  +V+ VLAT+M+ HF  L    N + +P G                    +  P+  +    +++  +D+++P + +N+ + W   + EE+F Q D+E    L    P  +R    +P+SQI FID  ++  FT
Sbjct:  137 VLKEVDKWSFDVFALHEASGEHALKFIVYELFTRYDLIARFKIPVSSVVSFVEALEAGYSKHKNPYHNSVHAADVTQTVHYLMLKTGTIHWLNELEILSMIFAAAIHDYEHTGTTNNFHIQTRSDSAILYNDRSVLENHHVSAAYRLMQEDEEMNILINLSKDDWRELRALVVETVLATDMSCHFHQLKSIKNLLQQPEG--------------------VEKPKAMS----LMLHTADISHPAKNWNLHRRWTMSLMEEFFRQGDKEAELGLS-FSPLCDRNATMVPQSQIGFIDYIVEPTFT 415          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: pde1a (phosphodiesterase 1A, calmodulin-dependent [Source:ZFIN;Acc:ZDB-GENE-090831-2])

HSP 1 Score: 167.162 bits (422), Expect = 3.743e-44
Identity = 95/299 (31.77%), Postives = 159/299 (53.18%), Query Frame = 1
Query: 1651 HKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYND-SNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFT 2544
            HKWSFD+  L + S    L+++  ++ T++EL S   I      +++  +E  Y+   N YHN  HAADV Q+  + L +  +       + +  I AA IHDL H G TN F I +   +A+LYND AVLENHH S A+++ ++DD +NIF N+++DD+R +R  +V+ VLAT+M+ HF+ +    + + +P                           +K+    +L+   D+++PT+ + + + W   + EE+F Q D E    LP   P  +R +  + +SQI F+D  ++  F+
Sbjct:  151 HKWSFDVFVLNEASGEHALKFVMHELLTRYELISRYKIPVAALVSFVEALEAGYSKHKNPYHNLAHAADVTQTVHYLLLQSGLMHWLSELETLAVIFAAAIHDLEHTGTTNNFHIQTRSDVALLYNDRAVLENHHVSAAYRL-MQDDDMNIFINLSKDDWRELRALVVEMVLATDMSCHFQQIKTMKSALQQPESI------------------------DKSKAMSLLLHAGDISHPTKEWPLHQRWTEALMEEFFRQGDREAKLGLP-FSPLCDRNSTMVAQSQIGFMDFIVEPTFS 423          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: pde7a (phosphodiesterase 7A [Source:ZFIN;Acc:ZDB-GENE-031222-10])

HSP 1 Score: 137.887 bits (346), Expect = 1.003e-35
Identity = 85/302 (28.15%), Postives = 154/302 (50.99%), Query Frame = 1
Query: 1657 WSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDR-INIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQF 2559
            WSFD+   ++L+    L  +   +F    L     +D    + +L +++ +Y++ N YHN+ HAADV Q+   +L   K+       D ++ ++AA  HD+ HPG   PFLI + H LA LY++ +VLENHH    ++ T+   R   +F ++  D+   +   +   +LAT++++  E L++F + + K +                   L L +  ++  I ++ +KC+D+ NP R ++  K W+ ++ EE+F Q D E    L +  P  +R T  +P  QI F+   ++ +F  W +F
Sbjct:    8 WSFDMFLFDRLTNGNSLVSLTCHLFNFHGLIQHFQLDMVKLRGFLVMVQEDYHNQNPYHNAVHAADVTQAMHCYLREPKLAVHLTRRDIMLGLLAASAHDVDHPGVNQPFLIKTHHHLASLYHNSSVLENHH----WRSTVGMLRESGLFAHLPMDERLQMERDLGSLILATDISRQNEFLSQFKSHLDKGD-------------------LCLEEAPHRHFILQIALKCADICNPCRVWDTSKRWSEKVCEEFFKQGDMERKWRLEIS-PLCDRYTQTVPNIQIGFMTFVVEPLFMEWARF 285          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007435.1 (pep scaffold:Pmarinus_7.0:GL486982:1709:8825:-1 gene:ENSPMAG00000006710.1 transcript:ENSPMAT00000007435.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.094 bits (305), Expect = 8.277e-32
Identity = 67/210 (31.90%), Postives = 119/210 (56.67%), Query Frame = 1
Query: 1903 IFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQ-IYFIDIFL 2529
            +F   + + +I A+ IHD+ HPG +N FLIN++  LA++YND +VLENHH +  FK+ L+++  +IF+N+++   + +R  ++D VLAT+M+KH   L      +              T        L L +  ++  + + ++ C+D++NPT+P ++ ++W  RI EE+F Q D E  + + +  P  ++ +  + KSQ I  ID  L
Sbjct:    7 VFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKL-LQEENCDIFQNLSKKQRQTLRKMVIDMVLATDMSKHMNLLADLKTMV-------------ETKKVTSSGVLLLDNYTDRIQVLQNMVHCADLSNPTKPLDVYRQWTERIMEEFFRQGDRERERGMEIS-PMCDKHSASVEKSQRINAIDFSL 201          
BLAST of Phosphodiesterase vs. Ensembl Yeast
Match: PDE2 (High-affinity cyclic AMP phosphodiesterase; component of the cAMP-dependent protein kinase signaling system, protects the cell from extracellular cAMP, contains readthrough motif surrounding termination codon [Source:SGD;Acc:S000005887])

HSP 1 Score: 70.8626 bits (172), Expect = 4.241e-13
Identity = 62/254 (24.41%), Postives = 113/254 (44.49%), Query Frame = 1
Query: 1657 WSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFK-NMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEY 2415
            W F  L L      + L + G  +  K    + + I        L  +E++Y+  N +HN  HA DV+Q++ W L    + +  +    ++  +AAI HD+GHPG  N  L N    +A  + ++++LEN H    F+  L +    +   +  + D+      I +A+LAT+MA H ++  + M+                             +P  +  +  ++IK +D++N TR  ++   WAY I+ E+
Sbjct:  211 WDFCALSLS----TQELIWCGFTLIKKLSKDAKVLIADNKLLLLLFTLESSYHQVNKFHNFRHAIDVMQAT-WRLCTYLLKD--NPVQTLLLCMAAIGHDVGHPGTNNQLLCNCESEVAQNFKNVSILENFHREL-FQQLLSEHWPQLLSISKKKFDF------ISEAILATDMALHSQYEDRLMH----------------------------ENPMKQITLISLIIKAADISNVTRTLSISARWAYLITLEF 422          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO32142 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVX8])

HSP 1 Score: 353.214 bits (905), Expect = 9.893e-108
Identity = 163/333 (48.95%), Postives = 231/333 (69.37%), Query Frame = 1
Query: 1570 RHSKINKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            R   I  +PE+P       +   + D   W FDILKLE+ S ++PL ++G+K+  +F +   LNI     +NWL +IE NY+  N YHNSTHAADVL ++  FL +E++  + +  D+V S+IAAI+HD+ HPG TN FL N+   LAILYNDIAVLE+HH++ AFK+T +DD+ NIF N++ +++R +R  I+D V+ATEM +HFEHL+KF+N+I K    +  +S+  T+         L  PEN+ +I+RMLIKC+D+ NP RP  +CKEWAYRI+EEYFSQTDEE  + LPVVMP F+R TC++P+SQ++FID F+ D++ +W  FA V
Sbjct:  499 RAVPIGHLPEIP-----AEVSNAMVDEADWDFDILKLEKASNHRPLYFLGLKILNRFRVCEKLNISEDYVKNWLQLIEANYHRKNAYHNSTHAADVLHATAVFLAKERVKAVLEPLDEVASLIAAIVHDVDHPGYTNSFLCNAGSELAILYNDIAVLESHHAALAFKLTARDDKSNIFSNLDVEEFRTVRQAIIDMVMATEMTRHFEHLSKFVNSINKRRSSSTPDSNTSTSTA-------LNTPENRTLIKRMLIKCADIANPARPRYLCKEWAYRIAEEYFSQTDEEKRRGLPVVMPVFDRATCNVPRSQVWFIDYFVSDLYDAWDAFAYV 819          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO37301 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGA1])

HSP 1 Score: 186.808 bits (473), Expect = 2.635e-52
Identity = 109/293 (37.20%), Postives = 161/293 (54.95%), Query Frame = 1
Query: 1654 KWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYN-DSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFL 2529
            +W+FD+  L +  E  PLRYIG +V  + ++     I       +L  +ET Y   SN YHN  HAADV  +  +FLE   +++     +    +++AIIHDL H G TN F INS   LA+LYND +VLENHH S AF++ L+DD  NI   +N + Y  +R  ++D VLAT+M+ HFE L + M   L    P                       EN+ ++ ++L+  +D++NPT+ + + ++W  +I EE+F+Q D EI   L  V P  +R T  IP+SQI FID  +
Sbjct:   80 EWTFDVFALSESCEGHPLRYIGYEVLHRRDMLRNFKIHAMTLDRFLQDVETGYKRHSNPYHNDCHAADVTHTVHYFLECMGVSKYLSDLEVFGLLLSAIIHDLEHTGTTNAFHINSRSDLALLYNDRSVLENHHVSCAFRI-LQDDEKNILSGLNLEQYADVRSLMIDTVLATDMSSHFEQL-RLMKVALVAGSPI----------------------ENREVV-QLLLHVADISNPTKDWTIHRQWTTKIMEEFFTQGDMEIELGLD-VSPLCDRSTTLIPESQIGFIDFIV 346          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO46133 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM4])

HSP 1 Score: 174.481 bits (441), Expect = 2.086e-46
Identity = 95/330 (28.79%), Postives = 171/330 (51.82%), Query Frame = 1
Query: 1573 HSKINKMPEVP-EIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQF 2559
            HS    +P    E++    +  +LE+ +KW FD   L + +   P+  +   +    +L  I  I    F N++ ++E +Y     +HN  HAADV Q++   L  +  + +F   + + +IIA+ +HD+ HPG  N FL+ ++  +A++YND +VLENHH + AF++ L+ +  +IF+N+++ + +  R  I++ VLAT+ AKH   L      +                       L L +  ++  + + L+ C+D++NPT+P  + ++W  R+ EE+F Q D+E   D   + P  +R    I KSQ+ FID   Q ++ +W + 
Sbjct:  183 HSFSGSVPRFGVEVQNESELATILENVNKWDFDAFALGEATNGHPMLAVSYTILQARDLLKIFKIKPTTFINYMTLVENHYLKDVPFHNCIHAADVTQTAHVLLSAQAFDNVFTDLEILSAIIASAVHDVDHPGVNNHFLVATNSEMALMYNDESVLENHHLAVAFQL-LQHEDCDIFENLSKQERQTARRMIIEMVLATDNAKHMSLLASLKTMV-----------ETKKVAGTGSGVLCLENYTDRMQVLKSLVHCADLSNPTKPLPIYRKWVDRLMEEFFRQGDKERDIDGMEISPMMDRHNASIEKSQVVFIDFVAQPLWETWGEL 500          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO32179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVS5])

HSP 1 Score: 135.191 bits (339), Expect = 1.979e-33
Identity = 89/295 (30.17%), Postives = 151/295 (51.19%), Query Frame = 1
Query: 1693 ENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQ---SSVWFLEREKINEIFDI---YDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQF 2559
            E   + Y+  +++    L     I+    Q++L  +  +YN +  +HN  HA  V Q     +W      + EIF+     D +I + +A+ HDL HPG  N + IN+   LA+ YNDI+ LENHH + AF + +K D+ NI +N++ + ++ IR G++  +L+T+MA+H + L KF   +LK                         D  +K+++ +++IK SDV+N  RP ++ + W   + +E+F Q+D E  + LPV  P  +R     P +QI FI   L  +F +  + 
Sbjct:  180 EEAEMLYLLQQMYIDLGLLDEFKIERSKLQHFLFEVYRHYNPTP-FHNFRHAFCVTQMMYGLIW------LTEIFNKITKQDLLIMLTSALCHDLDHPGYNNAYQINARTELALRYNDISPLENHHCAVAFDI-MKQDKSNILQNVSAETFKKIREGMIKCILSTDMARHSDILNKF-KELLKSG-------------------FKFDDEAHKSMLMQIMIKVSDVSNEARPMDVAEPWLDCLLQEFFIQSDVEKLEGLPVA-PFMDRDKVTKPSAQIGFIKFVLVPLFEALGEL 445          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO43748 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXZ4])

HSP 1 Score: 124.02 bits (310), Expect = 1.271e-30
Identity = 98/367 (26.70%), Postives = 164/367 (44.69%), Query Frame = 1
Query: 1597 EVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKI--------------NEI----------------------------FDIYDDVISII-------AAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSW 2550
            E+P  EE   +  L++    W+F I   +       L  +  ++F       I  I  R F N+   +E+ Y+ S  YHNS HA+DVLQ  V+FL   KI              NE                             +    DVI ++       AA +HD  HPGRTN FL+ +    A+LYND +VLENHH++ AF + + D + N    ++  +++  R   ++A+LAT++ +HF+ L+ F N      G                  +N     ++ +  +  IK SD++ P++  ++   W  RI EE++ Q D+E ++ +  V P  +RQ   + + Q  FI+  +  ++ S+
Sbjct:    9 ELPRSEE---LTRLMDKVTDWNFPIF--DACEHGNILVQVSYRIFQNAGFFEIFKIPERKFLNYFFALESGYH-SIPYHNSIHASDVLQG-VYFLTTAKIPGFCPPGTPQKLGDNESDSDSDSGITSGVLGEGEEDKKDDDGGGDYGALVDVIPLLELLSLYTAAAMHDYDHPGRTNAFLVATLSHQALLYNDRSVLENHHAAAAFTLLMSDPKYNFLCELSPAEFKRFRFLAIEAILATDLKRHFDILSDF-NAKTAEGG------------------VNWDSEADRLLTLQFCIKMSDISGPSKRRDIHTLWTERIVEEFYEQGDDERARGM-AVSPYMDRQQPHVAQLQDSFINHLVAPLYNSY 348          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde8b (phosphodiesterase 8B [Source:NCBI gene;Acc:101168385])

HSP 1 Score: 338.961 bits (868), Expect = 8.398e-103
Identity = 161/329 (48.94%), Postives = 221/329 (67.17%), Query Frame = 1
Query: 1582 INKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            +N +P  P I E      +L D   W F+IL+LE  +  +PL Y+G+K+FT F +   LN      ++WL +IE +Y+ SN YHNSTHAADVL ++ +FL RE++    D  D+V ++IAA +HD+ HPGRTN FL N+   LAILYND AVLE+HH++ AF++T +D + NIFKN++R+ YR +R  ++D VLATEM +HFEH++KF+N+I KP       S+   N+     +      EN+ +I+RMLIKC+DV NP RP  +C EWA RISEEYF+QTDEE    LPVVMP F+R TC +PKSQI F+D F+ DMF +   FA +
Sbjct:  415 LNDVP--PSIAE------MLNDEECWDFNILELEAATHKRPLTYLGLKIFTSFGVCDFLNCSEATLRSWLQLIEASYHSSNSYHNSTHAADVLHATAYFLRRERVKSSLDQLDEVAALIAATVHDVDHPGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTNRDSKSNIFKNIDRNQYRTLRQSVIDMVLATEMTRHFEHVSKFVNSINKPMAAIEETSTCSGNSESESQTNFRNSAENRLLIKRMLIKCADVANPCRPLELCIEWAGRISEEYFAQTDEEKRLGLPVVMPVFDRNTCSVPKSQISFMDYFITDMFDALDAFAGL 735          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde8b (phosphodiesterase 8B [Source:NCBI gene;Acc:101168385])

HSP 1 Score: 338.961 bits (868), Expect = 1.500e-102
Identity = 161/329 (48.94%), Postives = 221/329 (67.17%), Query Frame = 1
Query: 1582 INKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            +N +P  P I E      +L D   W F+IL+LE  +  +PL Y+G+K+FT F +   LN      ++WL +IE +Y+ SN YHNSTHAADVL ++ +FL RE++    D  D+V ++IAA +HD+ HPGRTN FL N+   LAILYND AVLE+HH++ AF++T +D + NIFKN++R+ YR +R  ++D VLATEM +HFEH++KF+N+I KP       S+   N+     +      EN+ +I+RMLIKC+DV NP RP  +C EWA RISEEYF+QTDEE    LPVVMP F+R TC +PKSQI F+D F+ DMF +   FA +
Sbjct:  444 LNDVP--PSIAE------MLNDEECWDFNILELEAATHKRPLTYLGLKIFTSFGVCDFLNCSEATLRSWLQLIEASYHSSNSYHNSTHAADVLHATAYFLRRERVKSSLDQLDEVAALIAATVHDVDHPGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTNRDSKSNIFKNIDRNQYRTLRQSVIDMVLATEMTRHFEHVSKFVNSINKPMAAIEETSTCSGNSESESQTNFRNSAENRLLIKRMLIKCADVANPCRPLELCIEWAGRISEEYFAQTDEEKRLGLPVVMPVFDRNTCSVPKSQISFMDYFITDMFDALDAFAGL 764          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde8b (phosphodiesterase 8B [Source:NCBI gene;Acc:101168385])

HSP 1 Score: 340.502 bits (872), Expect = 2.237e-102
Identity = 161/329 (48.94%), Postives = 221/329 (67.17%), Query Frame = 1
Query: 1582 INKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            +N +P  P I E      +L D   W F+IL+LE  +  +PL Y+G+K+FT F +   LN      ++WL +IE +Y+ SN YHNSTHAADVL ++ +FL RE++    D  D+V ++IAA +HD+ HPGRTN FL N+   LAILYND AVLE+HH++ AF++T +D + NIFKN++R+ YR +R  ++D VLATEM +HFEH++KF+N+I KP       S+   N+     +      EN+ +I+RMLIKC+DV NP RP  +C EWA RISEEYF+QTDEE    LPVVMP F+R TC +PKSQI F+D F+ DMF +   FA +
Sbjct:  514 LNDVP--PSIAE------MLNDEECWDFNILELEAATHKRPLTYLGLKIFTSFGVCDFLNCSEATLRSWLQLIEASYHSSNSYHNSTHAADVLHATAYFLRRERVKSSLDQLDEVAALIAATVHDVDHPGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTNRDSKSNIFKNIDRNQYRTLRQSVIDMVLATEMTRHFEHVSKFVNSINKPMAAIEETSTCSGNSESESQTNFRNSAENRLLIKRMLIKCADVANPCRPLELCIEWAGRISEEYFAQTDEEKRLGLPVVMPVFDRNTCSVPKSQISFMDYFITDMFDALDAFAGL 834          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde8b (phosphodiesterase 8B [Source:NCBI gene;Acc:101168385])

HSP 1 Score: 338.576 bits (867), Expect = 2.910e-102
Identity = 161/329 (48.94%), Postives = 221/329 (67.17%), Query Frame = 1
Query: 1582 INKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            +N +P  P I E      +L D   W F+IL+LE  +  +PL Y+G+K+FT F +   LN      ++WL +IE +Y+ SN YHNSTHAADVL ++ +FL RE++    D  D+V ++IAA +HD+ HPGRTN FL N+   LAILYND AVLE+HH++ AF++T +D + NIFKN++R+ YR +R  ++D VLATEM +HFEH++KF+N+I KP       S+   N+     +      EN+ +I+RMLIKC+DV NP RP  +C EWA RISEEYF+QTDEE    LPVVMP F+R TC +PKSQI F+D F+ DMF +   FA +
Sbjct:  461 LNDVP--PSIAE------MLNDEECWDFNILELEAATHKRPLTYLGLKIFTSFGVCDFLNCSEATLRSWLQLIEASYHSSNSYHNSTHAADVLHATAYFLRRERVKSSLDQLDEVAALIAATVHDVDHPGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTNRDSKSNIFKNIDRNQYRTLRQSVIDMVLATEMTRHFEHVSKFVNSINKPMAAIEETSTCSGNSESESQTNFRNSAENRLLIKRMLIKCADVANPCRPLELCIEWAGRISEEYFAQTDEEKRLGLPVVMPVFDRNTCSVPKSQISFMDYFITDMFDALDAFAGL 781          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde8b (phosphodiesterase 8B [Source:NCBI gene;Acc:101168385])

HSP 1 Score: 338.576 bits (867), Expect = 6.033e-102
Identity = 162/329 (49.24%), Postives = 222/329 (67.48%), Query Frame = 1
Query: 1582 INKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKHFEHLTKFMNTILKPNGPXXXXXXXXXXXXXXXXXLNLADPENKAIIRRMLIKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQTCDIPKSQIYFIDIFLQDMFTSWHQFADV 2568
            +N +P  P I E      +L D   W F+IL+LE  +  +PL Y+G+K+FT F +   LN      ++WL +IE +Y+ SN YHNSTHAADVL ++ +FL RE++    D  D+V ++IAA +HD+ HPGRTN FL N+   LAILYND AVLE+HH++ AF++T +D + NIFKN++R+ YR +R  ++D VLATEM +HFEH++KF+N+I   N P  +     T +    +  N A  EN+ +I+RMLIKC+DV NP RP  +C EWA RISEEYF+QTDEE    LPVVMP F+R TC +PKSQI F+D F+ DMF +   FA +
Sbjct:  493 LNDVP--PSIAE------MLNDEECWDFNILELEAATHKRPLTYLGLKIFTSFGVCDFLNCSEATLRSWLQLIEASYHSSNSYHNSTHAADVLHATAYFLRRERVKSSLDQLDEVAALIAATVHDVDHPGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTNRDSKSNIFKNIDRNQYRTLRQSVIDMVLATEMTRHFEHVSKFVNSI---NKPMAAIEETSTCSESQTNFRNSA--ENRLLIKRMLIKCADVANPCRPLELCIEWAGRISEEYFAQTDEEKRLGLPVVMPVFDRNTCSVPKSQISFMDYFITDMFDALDAFAGL 808          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000054903.1 (SMESG000054903.1)

HSP 1 Score: 1297.72 bits (3357), Expect = 0.000e+0
Identity = 670/671 (99.85%), Postives = 670/671 (99.85%), Query Frame = 1
Query:  106 VKNFKIPKIMNSKESNDNGYYQPTNHELETQIVRPDGVNLKLVKAWYSSGQETFISPMKILFVTVENSFEAQNIEQICAQLEINYKLSYSEVDAISALSQYIFHLIIIDRRNYKMESDYNPDGIAKNVKIKYRSENFKIILYDNRGQLNLSELWDLGYDEQWIISGRXXXXXXXXXXXXXXXXPRDFRNEKNALISSAFNKFTDSMEILKNDFSIEIVNETFKKVFKVSKREITGRSWFSFHDISDHRQSVIKNELSLKKSWEGLLSSKTDLPIDYPLNVYAVIKPLDVRENYYIVTLNAYFNNQGKSEPSFSFISMDRESTTISIPRMKDSFFTSQQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLFITTVDALKSDKMSSNLIDGLLSNHATMFAQTENRRHSSSLTKRRQTRVNSEVIHDHITQVLGKAVKILSSVYICMALDKCYLQYATPNXXXXXXXXXXXXXXXLTAKPRHSKINKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNR 2118
            VKNFKIPKIMNSKESNDNGYYQPTNHELETQIVRPDGVNLKLVKAWYSSGQETFISPMKILFVTVENSFEAQNIEQICAQLEINYKLSYSEVDAISALSQYIFHLIIIDRRNYKMESDYNPDGIAKNVKIKYRSENFKIILYDNRGQLNLSELWDLGYDEQWIISGRLLSLSHYLESYLKYHYPRDFRNEKNALISSAFNKFTDSMEILKNDFSIEIVNETFKKVFKVSKREITGRSWFSFHDISDHRQSVIKNELSLKKSWEGLLSSKTDLPIDYPLNVYAVIKPLDVRENYYIVTLNAYFNNQGKSEPSFSFISMDRESTTISIPRMKDSFFTSQQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLFITTVDALKSDKMSSNLIDGLLSNHATMFAQTENRRHSSSLTKRRQTRVNSEVIHDHITQVLGKAVKILSSVYICMALDKCYLQYATPNIIIIL IILCYAISILTAKPRHSKINKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNR
Sbjct:    6 VKNFKIPKIMNSKESNDNGYYQPTNHELETQIVRPDGVNLKLVKAWYSSGQETFISPMKILFVTVENSFEAQNIEQICAQLEINYKLSYSEVDAISALSQYIFHLIIIDRRNYKMESDYNPDGIAKNVKIKYRSENFKIILYDNRGQLNLSELWDLGYDEQWIISGRLLSLSHYLESYLKYHYPRDFRNEKNALISSAFNKFTDSMEILKNDFSIEIVNETFKKVFKVSKREITGRSWFSFHDISDHRQSVIKNELSLKKSWEGLLSSKTDLPIDYPLNVYAVIKPLDVRENYYIVTLNAYFNNQGKSEPSFSFISMDRESTTISIPRMKDSFFTSQQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLFITTVDALKSDKMSSNLIDGLLSNHATMFAQTENRRHSSSLTKRRQTRVNSEVIHDHITQVLGKAVKILSSVYICMALDKCYLQYATPNIIIILHIILCYAISILTAKPRHSKINKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNR 676          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000054903.1 (SMESG000054903.1)

HSP 1 Score: 1206.82 bits (3121), Expect = 0.000e+0
Identity = 621/671 (92.55%), Postives = 621/671 (92.55%), Query Frame = 1
Query:  106 VKNFKIPKIMNSKESNDNGYYQPTNHELETQIVRPDGVNLKLVKAWYSSGQETFISPMKILFVTVENSFEAQNIEQICAQLEINYKLSYSEVDAISALSQYIFHLIIIDRRNYKMESDYNPDGIAKNVKIKYRSENFKIILYDNRGQLNLSELWDLGYDEQWIISGRXXXXXXXXXXXXXXXXPRDFRNEKNALISSAFNKFTDSMEILKNDFSIEIVNETFKKVFKVSKREITGRSWFSFHDISDHRQSVIKNELSLKKSWEGLLSSKTDLPIDYPLNVYAVIKPLDVRENYYIVTLNAYFNNQGKSEPSFSFISMDRESTTISIPRMKDSFFTSQQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLFITTVDALKSDKMSSNLIDGLLSNHATMFAQTENRRHSSSLTKRRQTRVNSEVIHDHITQVLGKAVKILSSVYICMALDKCYLQYATPNXXXXXXXXXXXXXXXLTAKPRHSKINKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNR 2118
            VKNFKIPKIMNSKESNDNGYYQPTNHELETQIVRPDGVNLKLVKAWYSSGQETFISPMKILFVTVENSFEAQNIEQICAQLEINYKLSYSEVDAISALSQYIFHLIIIDRRNYKMESDYNPDGIAKNVKIKYRSENFKIILYDNRGQLNLSELWDLGYDEQWIISGRLLSLSHYLESYLKYHYPRDFRNEKNALISSAFNKFTDSMEILKNDFSIEIVNETFKKVFKVSKREITGRSWFSFHDISDHRQSVIKNELSLKKSWEGLLSSKTDLPIDYPLNVYAVIKPLDVRENYYIVTLNAYFNNQGKSEPSFSFISMDRESTTISIPRMKDSFFTSQQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLFITTVDALKSDKMSSNLIDGLLSNHATMFAQTENRRHSSSLTKRRQTRVNSEVIHDHITQVL K                                                 INKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNR
Sbjct:    8 VKNFKIPKIMNSKESNDNGYYQPTNHELETQIVRPDGVNLKLVKAWYSSGQETFISPMKILFVTVENSFEAQNIEQICAQLEINYKLSYSEVDAISALSQYIFHLIIIDRRNYKMESDYNPDGIAKNVKIKYRSENFKIILYDNRGQLNLSELWDLGYDEQWIISGRLLSLSHYLESYLKYHYPRDFRNEKNALISSAFNKFTDSMEILKNDFSIEIVNETFKKVFKVSKREITGRSWFSFHDISDHRQSVIKNELSLKKSWEGLLSSKTDLPIDYPLNVYAVIKPLDVRENYYIVTLNAYFNNQGKSEPSFSFISMDRESTTISIPRMKDSFFTSQQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLFITTVDALKSDKMSSNLIDGLLSNHATMFAQTENRRHSSSLTKRRQTRVNSEVIHDHITQVLAK-------------------------------------------------INKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNR 629          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000054903.1 (SMESG000054903.1)

HSP 1 Score: 1205.28 bits (3117), Expect = 0.000e+0
Identity = 621/671 (92.55%), Postives = 621/671 (92.55%), Query Frame = 1
Query:  106 VKNFKIPKIMNSKESNDNGYYQPTNHELETQIVRPDGVNLKLVKAWYSSGQETFISPMKILFVTVENSFEAQNIEQICAQLEINYKLSYSEVDAISALSQYIFHLIIIDRRNYKMESDYNPDGIAKNVKIKYRSENFKIILYDNRGQLNLSELWDLGYDEQWIISGRXXXXXXXXXXXXXXXXPRDFRNEKNALISSAFNKFTDSMEILKNDFSIEIVNETFKKVFKVSKREITGRSWFSFHDISDHRQSVIKNELSLKKSWEGLLSSKTDLPIDYPLNVYAVIKPLDVRENYYIVTLNAYFNNQGKSEPSFSFISMDRESTTISIPRMKDSFFTSQQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLFITTVDALKSDKMSSNLIDGLLSNHATMFAQTENRRHSSSLTKRRQTRVNSEVIHDHITQVLGKAVKILSSVYICMALDKCYLQYATPNXXXXXXXXXXXXXXXLTAKPRHSKINKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNR 2118
            VKNFKIPKIMNSKESNDNGYYQPTNHELETQIVRPDGVNLKLVKAWYSSGQETFISPMKILFVTVENSFEAQNIEQICAQLEINYKLSYSEVDAISALSQYIFHLIIIDRRNYKMESDYNPDGIAKNVKIKYRSENFKIILYDNRGQLNLSELWDLGYDEQWIISGRLLSLSHYLESYLKYHYPRDFRNEKNALISSAFNKFTDSMEILKNDFSIEIVNETFKKVFKVSKREITGRSWFSFHDISDHRQSVIKNELSLKKSWEGLLSSKTDLPIDYPLNVYAVIKPLDVRENYYIVTLNAYFNNQGKSEPSFSFISMDRESTTISIPRMKDSFFTSQQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLFITTVDALKSDKMSSNLIDGLLSNHATMFAQTENRRHSSSLTKRRQTRVNSEVIHDHITQVL K                                                 INKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNR
Sbjct:    6 VKNFKIPKIMNSKESNDNGYYQPTNHELETQIVRPDGVNLKLVKAWYSSGQETFISPMKILFVTVENSFEAQNIEQICAQLEINYKLSYSEVDAISALSQYIFHLIIIDRRNYKMESDYNPDGIAKNVKIKYRSENFKIILYDNRGQLNLSELWDLGYDEQWIISGRLLSLSHYLESYLKYHYPRDFRNEKNALISSAFNKFTDSMEILKNDFSIEIVNETFKKVFKVSKREITGRSWFSFHDISDHRQSVIKNELSLKKSWEGLLSSKTDLPIDYPLNVYAVIKPLDVRENYYIVTLNAYFNNQGKSEPSFSFISMDRESTTISIPRMKDSFFTSQQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLFITTVDALKSDKMSSNLIDGLLSNHATMFAQTENRRHSSSLTKRRQTRVNSEVIHDHITQVLAK-------------------------------------------------INKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNR 627          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000054903.1 (SMESG000054903.1)

HSP 1 Score: 1189.1 bits (3075), Expect = 0.000e+0
Identity = 612/662 (92.45%), Postives = 612/662 (92.45%), Query Frame = 1
Query:  133 MNSKESNDNGYYQPTNHELETQIVRPDGVNLKLVKAWYSSGQETFISPMKILFVTVENSFEAQNIEQICAQLEINYKLSYSEVDAISALSQYIFHLIIIDRRNYKMESDYNPDGIAKNVKIKYRSENFKIILYDNRGQLNLSELWDLGYDEQWIISGRXXXXXXXXXXXXXXXXPRDFRNEKNALISSAFNKFTDSMEILKNDFSIEIVNETFKKVFKVSKREITGRSWFSFHDISDHRQSVIKNELSLKKSWEGLLSSKTDLPIDYPLNVYAVIKPLDVRENYYIVTLNAYFNNQGKSEPSFSFISMDRESTTISIPRMKDSFFTSQQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLFITTVDALKSDKMSSNLIDGLLSNHATMFAQTENRRHSSSLTKRRQTRVNSEVIHDHITQVLGKAVKILSSVYICMALDKCYLQYATPNXXXXXXXXXXXXXXXLTAKPRHSKINKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNR 2118
            MNSKESNDNGYYQPTNHELETQIVRPDGVNLKLVKAWYSSGQETFISPMKILFVTVENSFEAQNIEQICAQLEINYKLSYSEVDAISALSQYIFHLIIIDRRNYKMESDYNPDGIAKNVKIKYRSENFKIILYDNRGQLNLSELWDLGYDEQWIISGRLLSLSHYLESYLKYHYPRDFRNEKNALISSAFNKFTDSMEILKNDFSIEIVNETFKKVFKVSKREITGRSWFSFHDISDHRQSVIKNELSLKKSWEGLLSSKTDLPIDYPLNVYAVIKPLDVRENYYIVTLNAYFNNQGKSEPSFSFISMDRESTTISIPRMKDSFFTSQQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLFITTVDALKSDKMSSNLIDGLLSNHATMFAQTENRRHSSSLTKRRQTRVNSEVIHDHITQVL K                                                 INKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNR
Sbjct:    1 MNSKESNDNGYYQPTNHELETQIVRPDGVNLKLVKAWYSSGQETFISPMKILFVTVENSFEAQNIEQICAQLEINYKLSYSEVDAISALSQYIFHLIIIDRRNYKMESDYNPDGIAKNVKIKYRSENFKIILYDNRGQLNLSELWDLGYDEQWIISGRLLSLSHYLESYLKYHYPRDFRNEKNALISSAFNKFTDSMEILKNDFSIEIVNETFKKVFKVSKREITGRSWFSFHDISDHRQSVIKNELSLKKSWEGLLSSKTDLPIDYPLNVYAVIKPLDVRENYYIVTLNAYFNNQGKSEPSFSFISMDRESTTISIPRMKDSFFTSQQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLFITTVDALKSDKMSSNLIDGLLSNHATMFAQTENRRHSSSLTKRRQTRVNSEVIHDHITQVLAK-------------------------------------------------INKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNR 613          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000054903.1 (SMESG000054903.1)

HSP 1 Score: 816.609 bits (2108), Expect = 0.000e+0
Identity = 424/431 (98.38%), Postives = 427/431 (99.07%), Query Frame = 1
Query:  106 VKNFKIPKIMNSKESNDNGYYQPTNHELETQIVRPDGVNLKLVKAWYSSGQETFISPMKILFVTVENSFEAQNIEQICAQLEINYKLSYSEVDAISALSQYIFHLIIIDRRNYKMESDYNPDGIAKNVKIKYRSENFKIILYDNRGQLNLSELWDLGYDEQWIISGRXXXXXXXXXXXXXXXXPRDFRNEKNALISSAFNKFTDSMEILKNDFSIEIVNETFKKVFKVSKREITGRSWFSFHDISDHRQSVIKNELSLKKSWEGLLSSKTDLPIDYPLNVYAVIKPLDVRENYYIVTLNAYFNNQGKSEPSFSFISMDRESTTISIPRMKDSFFTSQQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLFITTVDALKSDKMSSNLIDGLLSNHATMFAQTENRRHSSSLTKR--RQTRVN 1392
            VKNFKIPKIMNSKESNDNGYYQPTNHELETQIVRPDGVNLKLVKAWYSSGQETFISPMKILFVTVENSFEAQNIEQICAQLEINYKLSYSEVDAISALSQYIFHLIIIDRRNYKMESDYNPDGIAKNVKIKYRSENFKIILYDNRGQLNLSELWDLGYDEQWIISGRLLSLSHYLESYLKYHYPRDFRNEKNALISSAFNKFTDSMEILKNDFSIEIVNETFKKVFKVSKREITGRSWFSFHDISDHRQSVIKNELSLKKSWEGLLSSKTDLPIDYPLNVYAVIKPLDVRENYYIVTLNAYFNNQGKSEPSFSFISMDRESTTISIPRMKDSFFTSQQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLFITTVDALKSDKMSSNLIDGLLSNHATMFAQTENRRHSSSLTK   R +++N
Sbjct:    6 VKNFKIPKIMNSKESNDNGYYQPTNHELETQIVRPDGVNLKLVKAWYSSGQETFISPMKILFVTVENSFEAQNIEQICAQLEINYKLSYSEVDAISALSQYIFHLIIIDRRNYKMESDYNPDGIAKNVKIKYRSENFKIILYDNRGQLNLSELWDLGYDEQWIISGRLLSLSHYLESYLKYHYPRDFRNEKNALISSAFNKFTDSMEILKNDFSIEIVNETFKKVFKVSKREITGRSWFSFHDISDHRQSVIKNELSLKKSWEGLLSSKTDLPIDYPLNVYAVIKPLDVRENYYIVTLNAYFNNQGKSEPSFSFISMDRESTTISIPRMKDSFFTSQQVSIDSPILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLFITTVDALKSDKMSSNLIDGLLSNHATMFAQTENRRHSSSLTKTKPRHSKIN 436          

HSP 2 Score: 390.578 bits (1002), Expect = 3.980e-124
Identity = 185/186 (99.46%), Postives = 185/186 (99.46%), Query Frame = 1
Query: 1561 AKPRHSKINKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNR 2118
             KPRHSKINKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNR
Sbjct:  428 TKPRHSKINKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFTKFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLEREKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIAVLENHHSSFAFKVTLKDDRINIFKNMNR 613          
The following BLAST results are available for this feature:
BLAST of Phosphodiesterase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDE8A5.581e-11154.52phosphodiesterase 8A [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE8A7.523e-11154.52phosphodiesterase 8A [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE8A1.852e-11054.52phosphodiesterase 8A [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE8A1.852e-11054.52phosphodiesterase 8A [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE8B7.573e-11051.44phosphodiesterase 8B [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde-62.085e-7141.10Probable 3',5'-cyclic phosphodiesterase pde-6 [So... [more]
pde-61.807e-6941.10Probable 3',5'-cyclic phosphodiesterase pde-6 [So... [more]
pde-66.182e-5440.30Probable 3',5'-cyclic phosphodiesterase pde-6 [So... [more]
pde-12.229e-4531.37Probable 3',5'-cyclic phosphodiesterase pde-1 [So... [more]
pde-11.953e-4431.37Probable 3',5'-cyclic phosphodiesterase pde-1 [So... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pde81.618e-9347.60gene:FBgn0266377 transcript:FBtr0344176[more]
Pde88.716e-9047.60gene:FBgn0266377 transcript:FBtr0344177[more]
Pde85.329e-8947.60gene:FBgn0266377 transcript:FBtr0344178[more]
Pde85.561e-8947.60gene:FBgn0266377 transcript:FBtr0344179[more]
Pde85.810e-8947.60gene:FBgn0266377 transcript:FBtr0344182[more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde8b9.844e-10851.06phosphodiesterase 8B [Source:ZFIN;Acc:ZDB-GENE-091... [more]
pde8b5.077e-10751.06phosphodiesterase 8B [Source:ZFIN;Acc:ZDB-GENE-091... [more]
pde8a3.411e-6349.49phosphodiesterase 8A [Source:ZFIN;Acc:ZDB-GENE-070... [more]
pde4ca7.646e-4932.14phosphodiesterase 4C, cAMP-specific a [Source:ZFIN... [more]
pde4ca7.646e-4932.14phosphodiesterase 4C, cAMP-specific a [Source:ZFIN... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000055665.16.324e-11052.26phosphodiesterase 8A [Source:NCBI gene;Acc:1004970... [more]
ENSXETT00000055664.12.943e-10952.26phosphodiesterase 8A [Source:NCBI gene;Acc:1004970... [more]
ENSXETT00000055662.13.681e-10952.26phosphodiesterase 8A [Source:NCBI gene;Acc:1004970... [more]
ENSXETT00000055661.16.865e-10952.26phosphodiesterase 8A [Source:NCBI gene;Acc:1004970... [more]
ENSXETT00000055660.11.378e-10852.26phosphodiesterase 8A [Source:NCBI gene;Acc:1004970... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pde8a2.424e-10952.55phosphodiesterase 8A [Source:MGI Symbol;Acc:MGI:12... [more]
Pde8b2.977e-10652.10phosphodiesterase 8B [Source:MGI Symbol;Acc:MGI:24... [more]
Pde8b3.885e-10650.76phosphodiesterase 8B [Source:MGI Symbol;Acc:MGI:24... [more]
Pde8b4.666e-10650.76phosphodiesterase 8B [Source:MGI Symbol;Acc:MGI:24... [more]
Pde8b1.007e-10550.76phosphodiesterase 8B [Source:MGI Symbol;Acc:MGI:24... [more]
back to top
BLAST of Phosphodiesterase vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O60658|PDE8A_HUMAN8.892e-11054.52High affinity cAMP-specific and IBMX-insensitive 3... [more]
sp|O88502|PDE8A_MOUSE1.696e-10852.55High affinity cAMP-specific and IBMX-insensitive 3... [more]
sp|E9Q4S1|PDE8B_MOUSE7.717e-10550.76High affinity cAMP-specific and IBMX-insensitive 3... [more]
sp|O95263|PDE8B_HUMAN1.583e-10450.95High affinity cAMP-specific and IBMX-insensitive 3... [more]
sp|Q6NNF2|PDE8_DROME5.824e-8847.60High affinity cAMP-specific and IBMX-insensitive 3... [more]
back to top
BLAST of Phosphodiesterase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|183233501.093e-13438.29tr|A0A267GWB8|A0A267GWB8_9PLAT Phosphodiesterase O... [more]
gnl|BL_ORD_ID|157808042.449e-13438.29tr|A0A267EMK8|A0A267EMK8_9PLAT Phosphodiesterase O... [more]
gnl|BL_ORD_ID|203352374.699e-11941.65tr|A0A1S3IEX1|A0A1S3IEX1_LINUN Phosphodiesterase O... [more]
gnl|BL_ORD_ID|203194496.856e-11941.65tr|A0A1S3ICW6|A0A1S3ICW6_LINUN Phosphodiesterase O... [more]
gnl|BL_ORD_ID|203066447.267e-11941.65tr|A0A1S3IDS4|A0A1S3IDS4_LINUN Phosphodiesterase O... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde8b5.136e-10651.11phosphodiesterase 8B [Source:ZFIN;Acc:ZDB-GENE-091... [more]
pde8a1.619e-8648.39phosphodiesterase 8A [Source:ZFIN;Acc:ZDB-GENE-070... [more]
ENSAMXT00000006511.26.808e-5131.91pep primary_assembly:Astyanax_mexicanus-2.0:1:7394... [more]
pde4cb3.304e-4831.25phosphodiesterase 4C [Source:NCBI gene;Acc:1030443... [more]
PDE4D9.274e-4831.58phosphodiesterase 4D [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde8a2.857e-10247.19phosphodiesterase 8A [Source:ZFIN;Acc:ZDB-GENE-070... [more]
PDE1C5.280e-4531.58phosphodiesterase 1C [Source:HGNC Symbol;Acc:HGNC:... [more]
pde1a3.743e-4431.77phosphodiesterase 1A, calmodulin-dependent [Source... [more]
pde7a1.003e-3528.15phosphodiesterase 7A [Source:ZFIN;Acc:ZDB-GENE-031... [more]
ENSPMAT00000007435.18.277e-3231.90pep scaffold:Pmarinus_7.0:GL486982:1709:8825:-1 ge... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PDE24.241e-1324.41High-affinity cyclic AMP phosphodiesterase; compon... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO321429.893e-10848.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373012.635e-5237.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461332.086e-4628.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321791.979e-3330.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437481.271e-3026.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde8b8.398e-10348.94phosphodiesterase 8B [Source:NCBI gene;Acc:1011683... [more]
pde8b1.500e-10248.94phosphodiesterase 8B [Source:NCBI gene;Acc:1011683... [more]
pde8b2.237e-10248.94phosphodiesterase 8B [Source:NCBI gene;Acc:1011683... [more]
pde8b2.910e-10248.94phosphodiesterase 8B [Source:NCBI gene;Acc:1011683... [more]
pde8b6.033e-10249.24phosphodiesterase 8B [Source:NCBI gene;Acc:1011683... [more]
back to top
BLAST of Phosphodiesterase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054903.10.000e+099.85SMESG000054903.1[more]
SMESG000054903.10.000e+092.55SMESG000054903.1[more]
SMESG000054903.10.000e+092.55SMESG000054903.1[more]
SMESG000054903.10.000e+092.45SMESG000054903.1[more]
SMESG000054903.13.980e-12498.38SMESG000054903.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019487 ID=SMED30019487|Name=Phosphodiesterase|organism=Schmidtea mediterranea sexual|type=transcript|length=2866bp
TTCTGTTATTCTGTTAGAGTTTTTTAATTTTTGATTTGTTGTCATCAAAG
TCAAATCTGACTATTGTTTTTTTTATATAGATTAATGCTCATGTATAGAA
GATTAGTTAAAAATTTTAAAATTCCAAAAATAATGAACAGCAAAGAGAGT
AATGATAACGGGTACTATCAGCCGACCAATCATGAACTCGAAACGCAAAT
CGTTAGACCTGATGGAGTGAATTTAAAACTGGTCAAAGCTTGGTATAGTA
GTGGTCAAGAAACGTTTATTTCTCCAATGAAAATACTTTTTGTGACAGTC
GAAAACAGTTTTGAAGCTCAAAATATTGAACAAATTTGTGCTCAATTAGA
AATCAATTATAAATTAAGTTATTCCGAAGTTGATGCAATATCAGCTCTTT
CTCAATATATATTTCATTTGATCATCATTGACCGCAGAAATTATAAAATG
GAGTCCGACTATAATCCTGATGGAATAGCCAAAAATGTGAAAATTAAATA
CCGATCTGAAAATTTTAAAATCATTTTATATGACAACAGAGGTCAACTGA
ATCTTTCAGAACTTTGGGATCTAGGATACGACGAGCAATGGATTATCTCA
GGTCGACTGCTATCTTTGAGTCATTATTTAGAATCGTATTTGAAGTATCA
TTACCCCAGAGATTTTCGAAACGAAAAAAATGCTTTAATATCTTCAGCCT
TCAACAAATTCACTGATTCAATGGAAATTTTAAAAAACGATTTTTCAATT
GAAATCGTAAATGAGACATTTAAAAAAGTATTCAAAGTTTCTAAAAGAGA
GATTACAGGACGAAGTTGGTTTTCGTTTCATGATATATCTGACCATAGAC
AGAGTGTTATTAAAAATGAATTAAGTTTGAAAAAGTCATGGGAAGGCTTA
CTTTCATCTAAAACAGATCTCCCTATAGATTATCCCTTGAATGTTTATGC
AGTTATCAAACCATTAGATGTCAGAGAAAACTATTATATTGTTACACTTA
ACGCTTATTTCAATAATCAGGGTAAAAGTGAGCCATCATTTTCATTCATT
TCAATGGACAGAGAGTCTACAACAATATCAATCCCAAGAATGAAAGATAG
CTTCTTTACTTCACAACAAGTTTCAATAGATTCACCAATCTTGAAAATAA
TGAAAATTATTAGTTCAATCCAAGAAATGAGCAACCCTATGATTAATTAT
CAGCTACAGAGAATAATTGAGATTTTGTCATCAAAAGACCTCTTTATCAC
AACCGTTGACGCCTTGAAGTCTGATAAAATGTCTTCAAATCTCATTGATG
GTCTACTTTCGAATCATGCTACAATGTTTGCTCAAACCGAAAACCGTCGC
CATTCCAGCTCCCTTACAAAAAGAAGGCAAACGAGAGTAAATTCAGAAGT
TATACATGATCATATAACGCAGGTTTTGGGTAAGGCTGTCAAAATTCTGT
CCAGCGTATATATTTGCATGGCGCTAGATAAATGCTATTTGCAGTATGCA
ACGCCAAATATAATAATTATTTTACAAATTATTTTGTGTTATGCTATTTC
AATTTTAACAGCAAAGCCAAGACACTCAAAGATCAACAAGATGCCAGAAG
TCCCAGAAATTGAAGAGTACGGTGTCATTGATATATTGCTTGAAGACTAT
CATAAATGGTCGTTTGATATTTTAAAATTGGAGCAATTATCGGAAAATAA
GCCTCTGAGATATATCGGAATGAAAGTATTCACAAAGTTTGAATTAGGCA
GTATCCTCAATATCGATGGGAGATTATTCCAGAATTGGCTTCATGTCATA
GAAACTAATTACAACGACAGCAACTGTTATCATAATTCCACTCATGCTGC
TGATGTTTTGCAAAGCTCAGTTTGGTTTCTCGAACGAGAGAAAATAAATG
AAATATTTGACATATATGATGACGTGATATCCATTATAGCTGCAATCATT
CATGATTTAGGCCATCCAGGACGGACGAACCCATTCTTAATCAATAGCAG
TCACAGTTTAGCTATCCTATATAATGATATAGCGGTTTTGGAAAATCATC
ATTCATCTTTTGCCTTCAAAGTTACTCTAAAAGATGATAGAATTAACATT
TTCAAGAATATGAATAGAGATGATTATCGAGCAATTAGGCATGGCATAGT
CGATGCTGTTCTTGCTACAGAAATGGCAAAACATTTCGAGCATCTCACGA
AATTCATGAACACTATTCTTAAACCGAATGGTCCCAATTTGAGTAACTCG
TCAAACATAACTAATAATAACGAAATTAGAAGTTCCTTAAACTTAGCTGA
TCCAGAAAATAAAGCAATTATTCGTAGAATGTTAATAAAATGTAGCGATG
TTAACAATCCAACGCGACCCTTTAACATGTGTAAAGAATGGGCCTATCGA
ATCAGTGAAGAATATTTTAGTCAGACCGATGAAGAAATCAGCAAAGACCT
TCCAGTAGTAATGCCCCAGTTCAACCGCCAAACTTGTGATATACCTAAAT
CTCAAATATATTTTATAGATATTTTCCTTCAAGATATGTTTACATCATGG
CATCAATTCGCCGATGTAGAAGAATTGTTGATAAATTTGAAGGAGAACAA
AGAGAAATGGAAATTAATGTCAGAAACTCATAGCGACAGTGCCAAAACAT
TGAGTGATGCCTCAAAATAAATTTGATTGAATTTTCTATCTCATTGTAAA
GTAAATTTTATTAGACAATACTCTTTTGTTAGGATCAGATGAGATTCAAT
TATTCATTTAATTTTTACTTTTATTTATTGGTATTTTACATTTTCTATTA
TTTTTGATTCTGTATATCATTTGTAAATTGTCAAATTTGTATTTGACAAT
CGAGAGGTAAAAATTT
back to top

protein sequence of SMED30019487-orf-1

>SMED30019487-orf-1 ID=SMED30019487-orf-1|Name=SMED30019487-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=862bp
MLMYRRLVKNFKIPKIMNSKESNDNGYYQPTNHELETQIVRPDGVNLKLV
KAWYSSGQETFISPMKILFVTVENSFEAQNIEQICAQLEINYKLSYSEVD
AISALSQYIFHLIIIDRRNYKMESDYNPDGIAKNVKIKYRSENFKIILYD
NRGQLNLSELWDLGYDEQWIISGRLLSLSHYLESYLKYHYPRDFRNEKNA
LISSAFNKFTDSMEILKNDFSIEIVNETFKKVFKVSKREITGRSWFSFHD
ISDHRQSVIKNELSLKKSWEGLLSSKTDLPIDYPLNVYAVIKPLDVRENY
YIVTLNAYFNNQGKSEPSFSFISMDRESTTISIPRMKDSFFTSQQVSIDS
PILKIMKIISSIQEMSNPMINYQLQRIIEILSSKDLFITTVDALKSDKMS
SNLIDGLLSNHATMFAQTENRRHSSSLTKRRQTRVNSEVIHDHITQVLGK
AVKILSSVYICMALDKCYLQYATPNIIIILQIILCYAISILTAKPRHSKI
NKMPEVPEIEEYGVIDILLEDYHKWSFDILKLEQLSENKPLRYIGMKVFT
KFELGSILNIDGRLFQNWLHVIETNYNDSNCYHNSTHAADVLQSSVWFLE
REKINEIFDIYDDVISIIAAIIHDLGHPGRTNPFLINSSHSLAILYNDIA
VLENHHSSFAFKVTLKDDRINIFKNMNRDDYRAIRHGIVDAVLATEMAKH
FEHLTKFMNTILKPNGPNLSNSSNITNNNEIRSSLNLADPENKAIIRRML
IKCSDVNNPTRPFNMCKEWAYRISEEYFSQTDEEISKDLPVVMPQFNRQT
CDIPKSQIYFIDIFLQDMFTSWHQFADVEELLINLKENKEKWKLMSETHS
DSAKTLSDASK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0002056medial muscle cell
PLANA:0002089reproductive organ
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036971PDEase_catalytic_dom_sf
IPR023088PDEase
IPR003607HD/PDEase_dom
IPR002073PDEase_catalytic_dom
IPR023174PDEase_CS
Vocabulary: molecular function
TermDefinition
GO:0008081phosphoric diester hydrolase activity
GO:00041143',5'-cyclic-nucleotide phosphodiesterase activity
GO:00041153',5'-cyclic-AMP phosphodiesterase activity
GO:0016787hydrolase activity
GO:0019900kinase binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0001934positive regulation of protein phosphorylation
GO:0060548negative regulation of cell death
GO:0070374positive regulation of ERK1 and ERK2 cascade
GO:0071364cellular response to epidermal growth factor stimulus
GO:1903206negative regulation of hydrogen peroxide-induced cell death
Vocabulary: cellular component
TermDefinition
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR0230883'5'-cyclic nucleotide phosphodiesterasePRINTSPR00387PDIESTERASE1coord: 623..638
score: 49.62
coord: 751..764
score: 25.86
coord: 768..784
score: 40.12
coord: 578..591
score: 50.57
IPR003607HD/PDEase domainSMARTSM00471hd_13coord: 580..769
e-value: 0.0024
score: 27.1
IPR003607HD/PDEase domainCDDcd00077HDccoord: 582..704
e-value: 2.4793E-6
score: 45.7933
IPR0369713'5'-cyclic nucleotide phosphodiesterase, catalytic domain superfamilyGENE3DG3DSA:1.10.1300.10coord: 513..847
e-value: 1.5E-112
score: 377.9
IPR0020733'5'-cyclic nucleotide phosphodiesterase, catalytic domainPFAMPF00233PDEase_Icoord: 582..835
e-value: 4.4E-78
score: 262.3
IPR0020733'5'-cyclic nucleotide phosphodiesterase, catalytic domainPROSITEPS51845PDEASE_I_2coord: 507..849
score: 105.31
NoneNo IPR availablePANTHERPTHR11347:SF85HIGH AFFINITY CAMP-SPECIFIC AND IBMX-INSENSITIVE 3',5'-CYCLIC PHOSPHODIESTERASE 8Acoord: 323..442
coord: 493..850
NoneNo IPR availablePANTHERPTHR11347CYCLIC NUCLEOTIDE PHOSPHODIESTERASEcoord: 493..850
NoneNo IPR availablePANTHERPTHR11347CYCLIC NUCLEOTIDE PHOSPHODIESTERASEcoord: 323..442
NoneNo IPR availableSUPERFAMILYSSF109604HD-domain/PDEase-likecoord: 518..849
NoneNo IPR availableTMHMMTMhelixcoord: 471..493
IPR0231743'5'-cyclic nucleotide phosphodiesterase, conserved sitePROSITEPS00126PDEASE_I_1coord: 623..634