Vesicle-fusing ATPase

NameVesicle-fusing ATPase
Smed IDSMED30019484
Length (bp)2372
Neoblast Clusters

Zeng et. al., 2018

▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population





Single cell RNA-seq of pluripotent neoblasts and its early progenies

We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)

Explore this single cell expression dataset with our NB Cluster Shiny App


Neoblast Population


t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.

Expression of Vesicle-fusing ATPase (SMED30019484) t-SNE clustered cells

Violin plots show distribution of expression levels for Vesicle-fusing ATPase (SMED30019484) in cells (dots) of each of the 12 neoblast clusters.


back to top


Sub-lethal Irradiated Surviving X1 and X2 Cell Population


t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Vesicle-fusing ATPase (SMED30019484) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Vesicle-fusing ATPase (SMED30019484) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.


back to top


Embryonic Expression

Davies et. al., 2017

Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods


back to top
Anatomical Expression

PAGE et. al., 2020


has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE

PAGE Curations: 7

Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30019484h1SMcG0020459 dd_Smed_v4_3364_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019484h1SMcG0020459 dd_Smed_v4_3364_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30019484h1SMcG0020459 dd_Smed_v4_3364_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30019484h1SMcG0020459 dd_Smed_v4_3364_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30019484h1SMcG0020459 dd_Smed_v4_3364_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019484h1SMcG0020459 Contig48532uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019484h1SMcG0020459 Contig48532newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
BLAST of Vesicle-fusing ATPase vs. Ensembl Human
Match: NSF (N-ethylmaleimide sensitive factor, vesicle fusing ATPase [Source:HGNC Symbol;Acc:HGNC:8016])

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 292/661 (44.18%), Postives = 429/661 (64.90%), Query Frame = 2
            DE S TN    N  D+    +  I  T+ ++++ F      SV  G +  +  QRKW    IG+ +E   Y+F         +     F++  S+  +P D+DK+A +++++F++   +  Q L+F++    F   +  I+ +D         + K  +IE G++  N+   F++   S   L G+ K +     +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPPE VE++G KHV+GILLYGPPG GKTL ARQIGKMLNAREPK+VNGP IL+KYVGESEANIRKLFADAEEE +++G  S LHIIIFDEIDAICK RG+++G + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+IDEALLRPGR+ V++E+ LP + GRLQI  IHT ++R   +L+ D+D+KELA  TKN+SGAE+E +V AA + A +        + + +E  +S ++ R  F+ ++++D+K  +G + +D   +  N ++KW   +++ L    LL++  K +D      +L+ G P +G +++A  +A+E+ F FI++CS   MIGFSE A+C A+KKIFDDA K+  S +++DD+ERL+DY  IGPRFS  ++  L+ ++    P+ +K+LIIGTT     + E+E  +AF    I +P I T
BLAST of Vesicle-fusing ATPase vs. Ensembl Human
Match: NSF (N-ethylmaleimide sensitive factor, vesicle fusing ATPase [Source:HGNC Symbol;Acc:HGNC:8016])

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 292/661 (44.18%), Postives = 429/661 (64.90%), Query Frame = 2
            DE S TN    N  D+    +  I  T+ ++++ F      SV  G +  +  QRKW    IG+ +E   Y+F         +     F++  S+  +P D+DK+A +++++F++   +  Q L+F++    F   +  I+ +D         + K  +IE G++  N+   F++   S   L G+ K +     +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPPE VE++G KHV+GILLYGPPG GKTL ARQIGKMLNAREPK+VNGP IL+KYVGESEANIRKLFADAEEE +++G  S LHIIIFDEIDAICK RG+++G + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+IDEALLRPGR+ V++E+ LP + GRLQI  IHT ++R   +L+ D+D+KELA  TKN+SGAE+E +V AA + A +        + + +E  +S ++ R  F+ ++++D+K  +G + +D   +  N ++KW   +++ L    LL++  K +D      +L+ G P +G +++A  +A+E+ F FI++CS   MIGFSE A+C A+KKIFDDA K+  S +++DD+ERL+DY  IGPRFS  ++  L+ ++    P+ +K+LIIGTT     + E+E  +AF    I +P I T
BLAST of Vesicle-fusing ATPase vs. Ensembl Human
Match: NSF (N-ethylmaleimide sensitive factor, vesicle fusing ATPase [Source:HGNC Symbol;Acc:HGNC:8016])

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 292/661 (44.18%), Postives = 429/661 (64.90%), Query Frame = 2
            DE S TN    N  D+    +  I  T+ ++++ F      SV  G +  +  QRKW    IG+ +E   Y+F         +     F++  S+  +P D+DK+A +++++F++   +  Q L+F++    F   +  I+ +D         + K  +IE G++  N+   F++   S   L G+ K +     +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPPE VE++G KHV+GILLYGPPG GKTL ARQIGKMLNAREPK+VNGP IL+KYVGESEANIRKLFADAEEE +++G  S LHIIIFDEIDAICK RG+++G + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+IDEALLRPGR+ V++E+ LP + GRLQI  IHT ++R   +L+ D+D+KELA  TKN+SGAE+E +V AA + A +        + + +E  +S ++ R  F+ ++++D+K  +G + +D   +  N ++KW   +++ L    LL++  K +D      +L+ G P +G +++A  +A+E+ F FI++CS   MIGFSE A+C A+KKIFDDA K+  S +++DD+ERL+DY  IGPRFS  ++  L+ ++    P+ +K+LIIGTT     + E+E  +AF    I +P I T
BLAST of Vesicle-fusing ATPase vs. Ensembl Human
Match: NSF (N-ethylmaleimide sensitive factor, vesicle fusing ATPase [Source:HGNC Symbol;Acc:HGNC:8016])

HSP 1 Score: 582.022 bits (1499), Expect = 0.000e+0
Identity = 292/661 (44.18%), Postives = 429/661 (64.90%), Query Frame = 2
            DE S TN    N  D+    +  I  T+ ++++ F      SV  G +  +  QRKW    IG+ +E   Y+F         +     F++  S+  +P D+DK+A +++++F++   +  Q L+F++    F   +  I+ +D         + K  +IE G++  N+   F++   S   L G+ K +     +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPPE VE++G KHV+GILLYGPPG GKTL ARQIGKMLNAREPK+VNGP IL+KYVGESEANIRKLFADAEEE +++G  S LHIIIFDEIDAICK RG+++G + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+IDEALLRPGR+ V++E+ LP + GRLQI  IHT ++R   +L+ D+D+KELA  TKN+SGAE+E +V AA + A +        + + +E  +S ++ R  F+ ++++D+K  +G + +D   +  N ++KW   +++ L    LL++  K +D      +L+ G P +G +++A  +A+E+ F FI++CS   MIGFSE A+C A+KKIFDDA K+  S +++DD+ERL+DY  IGPRFS  ++  L+ ++    P+ +K+LIIGTT     + E+E  +AF    I +P I T
BLAST of Vesicle-fusing ATPase vs. Ensembl Human
Match: NSF (N-ethylmaleimide sensitive factor, vesicle fusing ATPase [Source:HGNC Symbol;Acc:HGNC:8016])

HSP 1 Score: 582.022 bits (1499), Expect = 0.000e+0
Identity = 292/661 (44.18%), Postives = 429/661 (64.90%), Query Frame = 2
            DE S TN    N  D+    +  I  T+ ++++ F      SV  G +  +  QRKW    IG+ +E   Y+F         +     F++  S+  +P D+DK+A +++++F++   +  Q L+F++    F   +  I+ +D         + K  +IE G++  N+   F++   S   L G+ K +     +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPPE VE++G KHV+GILLYGPPG GKTL ARQIGKMLNAREPK+VNGP IL+KYVGESEANIRKLFADAEEE +++G  S LHIIIFDEIDAICK RG+++G + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+IDEALLRPGR+ V++E+ LP + GRLQI  IHT ++R   +L+ D+D+KELA  TKN+SGAE+E +V AA + A +        + + +E  +S ++ R  F+ ++++D+K  +G + +D   +  N ++KW   +++ L    LL++  K +D      +L+ G P +G +++A  +A+E+ F FI++CS   MIGFSE A+C A+KKIFDDA K+  S +++DD+ERL+DY  IGPRFS  ++  L+ ++    P+ +K+LIIGTT     + E+E  +AF    I +P I T
BLAST of Vesicle-fusing ATPase vs. Ensembl Celegans
Match: nsf-1 (Vesicle-fusing ATPase [Source:UniProtKB/Swiss-Prot;Acc:Q94392])

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 291/690 (42.17%), Postives = 437/690 (63.33%), Query Frame = 2
            F+V+K   +E +  N  + N SD+   + K + V    ++ +IF    D S+K G +      RKW    + + V   P++FQ    V  +I+  D   K     +P+++D +A ++  +F     +K   + F +E      +      + SI+G D+                ++K  +IE G +  N+V  F +   S   L G+ K ++A   +INP+WDF  +G+GGLD EFS IF+ AF SR+FPPEF+E+LG+KHVRGILL+GPPGTGKTL ARQIGKMLNAREPKIVNGP ILDKYVGESE+N+RKLFADAEEE+++ G  S LHIIIFDEIDAICK RG+++G S+V DTVVNQLL+KMDGVEQLNNIL+IGMTNRRDMIDEALLRPGR+ VQ+EV LP + GRLQI +IHT ++RE N +  ++DL++++  TKN+SGAE+E +V AA ++A +             + ++   IN   F +A+++D+K  +GR D+ L  F    ++ W P+++K L    LL  ++K  +N   + +++ G   TG +S+A  +AK + F F+++ S  + +GFSE A+C+A+KK F+DA ++  SV+++D++ERLIDY  +GPR+S  ++  L+ ++N   P   ++ +I T+     + ++     F  + I IP++ T  ++++V
BLAST of Vesicle-fusing ATPase vs. Ensembl Celegans
Match: nsf-1 (Vesicle-fusing ATPase [Source:UniProtKB/Swiss-Prot;Acc:Q94392])

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 291/690 (42.17%), Postives = 437/690 (63.33%), Query Frame = 2
            F+V+K   +E +  N  + N SD+   + K + V    ++ +IF    D S+K G +      RKW    + + V   P++FQ    V  +I+  D   K     +P+++D +A ++  +F     +K   + F +E      +      + SI+G D+                ++K  +IE G +  N+V  F +   S   L G+ K ++A   +INP+WDF  +G+GGLD EFS IF+ AF SR+FPPEF+E+LG+KHVRGILL+GPPGTGKTL ARQIGKMLNAREPKIVNGP ILDKYVGESE+N+RKLFADAEEE+++ G  S LHIIIFDEIDAICK RG+++G S+V DTVVNQLL+KMDGVEQLNNIL+IGMTNRRDMIDEALLRPGR+ VQ+EV LP + GRLQI +IHT ++RE N +  ++DL++++  TKN+SGAE+E +V AA ++A +             + ++   IN   F +A+++D+K  +GR D+ L  F    ++ W P+++K L    LL  ++K  +N   + +++ G   TG +S+A  +AK + F F+++ S  + +GFSE A+C+A+KK F+DA ++  SV+++D++ERLIDY  +GPR+S  ++  L+ ++N   P   ++ +I T+     + ++     F  + I IP++ T  ++++V
BLAST of Vesicle-fusing ATPase vs. Ensembl Celegans
Match: nsf-1 (Vesicle-fusing ATPase [Source:UniProtKB/Swiss-Prot;Acc:Q94392])

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 291/690 (42.17%), Postives = 437/690 (63.33%), Query Frame = 2
            F+V+K   +E +  N  + N SD+   + K + V    ++ +IF    D S+K G +      RKW    + + V   P++FQ    V  +I+  D   K     +P+++D +A ++  +F     +K   + F +E      +      + SI+G D+                ++K  +IE G +  N+V  F +   S   L G+ K ++A   +INP+WDF  +G+GGLD EFS IF+ AF SR+FPPEF+E+LG+KHVRGILL+GPPGTGKTL ARQIGKMLNAREPKIVNGP ILDKYVGESE+N+RKLFADAEEE+++ G  S LHIIIFDEIDAICK RG+++G S+V DTVVNQLL+KMDGVEQLNNIL+IGMTNRRDMIDEALLRPGR+ VQ+EV LP + GRLQI +IHT ++RE N +  ++DL++++  TKN+SGAE+E +V AA ++A +             + ++   IN   F +A+++D+K  +GR D+ L  F    ++ W P+++K L    LL  ++K  +N   + +++ G   TG +S+A  +AK + F F+++ S  + +GFSE A+C+A+KK F+DA ++  SV+++D++ERLIDY  +GPR+S  ++  L+ ++N   P   ++ +I T+     + ++     F  + I IP++ T  ++++V
BLAST of Vesicle-fusing ATPase vs. Ensembl Celegans
Match: cdc-48.1 (Transitional endoplasmic reticulum ATPase homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:P54811])

HSP 1 Score: 155.606 bits (392), Expect = 5.564e-39
Identity = 110/309 (35.60%), Postives = 166/309 (53.72%), Query Frame = 2
            + E A  C+++P+                   N IG   +GG+ ++ +QI +   L  L  P+  + +GIK  RGILL+GPPGTGKTL AR +     A E      ++NGP ++ K  GESE+N+RK F + E+      NQ A  I+  DEIDAI   R   +G   V+  +V+QLL  MDGV+  +N+++I  TNR + ID AL R GR   +I++ +P   GRL+I  IHTK ++    LADD+DL+++A     + GA++ ++   A      EK +    +   I  E L S  +  ++F FA

HSP 2 Score: 130.183 bits (326), Expect = 7.667e-31
Identity = 92/229 (40.17%), Postives = 127/229 (55.46%), Query Frame = 2
            PE   + G++  RG+L YGPPG GKTL A+ I     A    I  GP +L  + GESEAN+R +F  A          +A  ++ FDE+D+I KARG  +GG      D V+NQ+L +MDG+    N+ IIG TNR D+ID A+LRPGR+   I +PLP +  R QI +   +    K  L+ D+DL  LA  T  +SGA++  +   A   A  E  + +    IRIE
BLAST of Vesicle-fusing ATPase vs. Ensembl Celegans
Match: cdc-48.3 (ATPase family protein 2 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q21222])

HSP 1 Score: 150.214 bits (378), Expect = 2.192e-37
Identity = 105/285 (36.84%), Postives = 146/285 (51.23%), Query Frame = 2
            PN  +N IG    +EE     + A +     PE  E  GI    GILLYGPPG  KTL AR +     A E K+    V GP +  K+VG+SE  IR LF+ A         Q A  I+ FDEIDA+  +RG+    S V D V+ QLL ++DG+E+ + ++++  TNR D +D ALLRPGR+   I V LP +  R  I E+ TKK++  + +     + +L   T  YSGAE+ AV   A   A  E  D         E   +  ++R + ++  I  D KA
BLAST of Vesicle-fusing ATPase vs. Ensembl Fly
Match: comt (gene:FBgn0000346 transcript:FBtr0073754)

HSP 1 Score: 597.43 bits (1539), Expect = 0.000e+0
Identity = 305/679 (44.92%), Postives = 437/679 (64.36%), Query Frame = 2
             K  K   DE S TN+   N  D   F E  K+  ++ A  + FIF  +K   V  G +  + +QRKW    I + +E  PY F     V   V  E D   K    ++P DSD++A +++ +F    +T  Q L+FN++        + S++ +D KS      + M  +  G I  NTV +F++   S   L G+ K +     +INP+WDF  +G+GGLD+EF+ IF+ AF SR+FPPE VE+LG KHV+GILLYGPPGTGKTL ARQIG MLNAREPKIVNGP ILDKYVGESEAN+R+LFA+AEEE K++G  S LHIIIFDEIDAICK RG+++G S V DTVVNQLL K+DGV+QLNNIL+IGMTNRRDMIDEALLRPGR+ VQ+E+ LP++ GR+QI  IHTK++RE N + DD+D KE+AALTKN+SGAE+E +V AA ++A +        + +  E ++  K+NR  F+ +++HD+K  +G   + L       ++ W   +S  L    L ++  K  ++     +L+ G P +G +++A  LAK + F F+++CS  +M+G++E A+CL I+KIFDDA ++  S I++D+VERL+DY SIGPR+S   +  L+ ++    PK +K+LI+ T+     + E+E  +AF  + + +P +  P  +++V
BLAST of Vesicle-fusing ATPase vs. Ensembl Fly
Match: comt (gene:FBgn0000346 transcript:FBtr0333329)

HSP 1 Score: 597.43 bits (1539), Expect = 0.000e+0
Identity = 305/679 (44.92%), Postives = 437/679 (64.36%), Query Frame = 2
             K  K   DE S TN+   N  D   F E  K+  ++ A  + FIF  +K   V  G +  + +QRKW    I + +E  PY F     V   V  E D   K    ++P DSD++A +++ +F    +T  Q L+FN++        + S++ +D KS      + M  +  G I  NTV +F++   S   L G+ K +     +INP+WDF  +G+GGLD+EF+ IF+ AF SR+FPPE VE+LG KHV+GILLYGPPGTGKTL ARQIG MLNAREPKIVNGP ILDKYVGESEAN+R+LFA+AEEE K++G  S LHIIIFDEIDAICK RG+++G S V DTVVNQLL K+DGV+QLNNIL+IGMTNRRDMIDEALLRPGR+ VQ+E+ LP++ GR+QI  IHTK++RE N + DD+D KE+AALTKN+SGAE+E +V AA ++A +        + +  E ++  K+NR  F+ +++HD+K  +G   + L       ++ W   +S  L    L ++  K  ++     +L+ G P +G +++A  LAK + F F+++CS  +M+G++E A+CL I+KIFDDA ++  S I++D+VERL+DY SIGPR+S   +  L+ ++    PK +K+LI+ T+     + E+E  +AF  + + +P +  P  +++V
BLAST of Vesicle-fusing ATPase vs. Ensembl Fly
Match: Nsf2 (gene:FBgn0266464 transcript:FBtr0344766)

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 320/739 (43.30%), Postives = 471/739 (63.73%), Query Frame = 2
            K   DE S TNK   N SD+   + K++ ++      +IF  +K     +  G +  + +QRKW    I + ++  PY F     +  ++  E D   K  + ++P DSD++A ++L +F   P+T  Q L+F ++   F    + +++ +D ++      K   +  G I  NTV +F++   S   L GR K +     +INP+WDF  +G+GGLD+EF+ IF+ AF SR+FPPE VE+LGIKHV+GILLYGPPGTGKTL ARQIG MLNAREPKIVNGP ILDKYVGESEANIR+LFA+AEEE K++G  S LHIIIFDEIDAICKARG+++G S V DTVVNQLLAK+DGVEQLNNIL+IGMTNRRDMIDEALLRPGR+ VQ+E+ LP++ GR+QI  IHTK++R+ N +A D+D  E+AA TKN+SGAE+E +V AA + A +        + +  E ++  ++ R  F+ A+D+D+K  +G   + L+      ++ W P +++ L    L ++  K  ++     +LI G P +G S++A +LA+ + F F+++CS  +M+GF+E A+CL I+KIFDDA ++  S I++D+VERL+DY  IGPR+S   +  L+ ++    PK +K+LI+ T+     + E+E  SAF  + + +  + TP  +++VL D DL+S  +LQ I   +       L IGIK L+     ++  +P +RV + L K++     + 
BLAST of Vesicle-fusing ATPase vs. Ensembl Fly
Match: Nsf2 (gene:FBgn0266464 transcript:FBtr0344767)

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 320/739 (43.30%), Postives = 471/739 (63.73%), Query Frame = 2
            K   DE S TNK   N SD+   + K++ ++      +IF  +K     +  G +  + +QRKW    I + ++  PY F     +  ++  E D   K  + ++P DSD++A ++L +F   P+T  Q L+F ++   F    + +++ +D ++      K   +  G I  NTV +F++   S   L GR K +     +INP+WDF  +G+GGLD+EF+ IF+ AF SR+FPPE VE+LGIKHV+GILLYGPPGTGKTL ARQIG MLNAREPKIVNGP ILDKYVGESEANIR+LFA+AEEE K++G  S LHIIIFDEIDAICKARG+++G S V DTVVNQLLAK+DGVEQLNNIL+IGMTNRRDMIDEALLRPGR+ VQ+E+ LP++ GR+QI  IHTK++R+ N +A D+D  E+AA TKN+SGAE+E +V AA + A +        + +  E ++  ++ R  F+ A+D+D+K  +G   + L+      ++ W P +++ L    L ++  K  ++     +LI G P +G S++A +LA+ + F F+++CS  +M+GF+E A+CL I+KIFDDA ++  S I++D+VERL+DY  IGPR+S   +  L+ ++    PK +K+LI+ T+     + E+E  SAF  + + +  + TP  +++VL D DL+S  +LQ I   +       L IGIK L+     ++  +P +RV + L K++     + 
BLAST of Vesicle-fusing ATPase vs. Ensembl Fly
Match: Nsf2 (gene:FBgn0266464 transcript:FBtr0082883)

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 320/739 (43.30%), Postives = 471/739 (63.73%), Query Frame = 2
            K   DE S TNK   N SD+   + K++ ++      +IF  +K     +  G +  + +QRKW    I + ++  PY F     +  ++  E D   K  + ++P DSD++A ++L +F   P+T  Q L+F ++   F    + +++ +D ++      K   +  G I  NTV +F++   S   L GR K +     +INP+WDF  +G+GGLD+EF+ IF+ AF SR+FPPE VE+LGIKHV+GILLYGPPGTGKTL ARQIG MLNAREPKIVNGP ILDKYVGESEANIR+LFA+AEEE K++G  S LHIIIFDEIDAICKARG+++G S V DTVVNQLLAK+DGVEQLNNIL+IGMTNRRDMIDEALLRPGR+ VQ+E+ LP++ GR+QI  IHTK++R+ N +A D+D  E+AA TKN+SGAE+E +V AA + A +        + +  E ++  ++ R  F+ A+D+D+K  +G   + L+      ++ W P +++ L    L ++  K  ++     +LI G P +G S++A +LA+ + F F+++CS  +M+GF+E A+CL I+KIFDDA ++  S I++D+VERL+DY  IGPR+S   +  L+ ++    PK +K+LI+ T+     + E+E  SAF  + + +  + TP  +++VL D DL+S  +LQ I   +       L IGIK L+     ++  +P +RV + L K++     + 
BLAST of Vesicle-fusing ATPase vs. Ensembl Zebrafish
Match: nsfa (N-ethylmaleimide-sensitive factor a [Source:ZFIN;Acc:ZDB-GENE-030616-37])

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 311/727 (42.78%), Postives = 457/727 (62.86%), Query Frame = 2
            DE S TN    +  D  L   + +TV TT ++KF+F      SV  G +  +  QRKW    IG+ +E   Y+F ++   +  + +E+D   K ++   P DSDK+A ++++ F++   +  Q L+F++    F   I  I+ +D         S K  +IE G++  N+   F++   S   L G+ K + A   +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPP+ VE++G KHV+GILL+GPPG GKTL ARQIGKMLNAREPKIVNGP IL+KYVGESEANIRKLFADAEEE K++G  S LHIIIFDE+DAICK RG  +  + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+IDEAL+RPGR  V++E+ LP + GR+QI  IHT K+RE  +LA D+D+KELAA TKNYSGAE+E +V AA + A +        + + +E  +  ++ R  F+ ++++D+K  +G + +D   +  N ++KW   +++ L    LL++  K +D      +L+ G P +G +++A  +++++ F FI++CS   MIG SE ++C AIKKIFDDA K+  S +++DD+ERL+DY  IGPRFS  ++  L+ ++    P  +K+LIIGTT     + E+E   AF    I +  I +   ++  L     ++D++   I  H++      + IGIK L+   +    +D   RV + L  LK
BLAST of Vesicle-fusing ATPase vs. Ensembl Zebrafish
Match: nsfb (N-ethylmaleimide-sensitive factor b [Source:ZFIN;Acc:ZDB-GENE-050808-1])

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 292/666 (43.84%), Postives = 431/666 (64.71%), Query Frame = 2
            DE S TN +  +  D+   +   I  TT + KF+F      SV  G +  +  QRKW    + + VE   Y+F         +     F++  S+  +P DSDK+A+++++ F     + +Q  +F++    F   I  I+ +D         SSK ++I+ G++  N+   F++   S   L G+ K + +   +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPP+ VE++G KHV+GILLYGPPG GKTL ARQIGKMLNAREPK+VNGP IL+KYVGESEANIRKLFADAEEE K++G  S LHIIIFDEIDAICK RG+++G + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+IDEALLRPGR+ V++E+ LP + GR+QI  IHT K+++ N+LA D+D+KELA  TKNYSGAE+E +V AA + A +        + +  E  Q+ +++R  F+ ++++D+K  +G + +D   +  N ++KWS  +S  L    LL++  K ++      +L+ G   +G +++A  +A+++ F FI++CS   MIGF+E A+C AIKKIF+DA K+  S +++DD+ERL+D+  IGPRFS  ++  L+ ++    P+ +K+LI+GTT     + E+    +F    I IP I T   ++
BLAST of Vesicle-fusing ATPase vs. Ensembl Zebrafish
Match: nsfb (N-ethylmaleimide-sensitive factor b [Source:ZFIN;Acc:ZDB-GENE-050808-1])

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 291/659 (44.16%), Postives = 428/659 (64.95%), Query Frame = 2
            DE S TN +  +  D+   +   I  TT + KF+F      SV  G +  +  QRKW    + + VE   Y+F         +     F++  S+  +P DSDK+A+++++ F     + +Q  +F++    F   I  I+ +D         SSK ++I+ G++  N+   F++   S   L G+ K + +   +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPP+ VE++G KHV+GILLYGPPG GKTL ARQIGKMLNAREPK+VNGP IL+KYVGESEANIRKLFADAEEE K++G  S LHIIIFDEIDAICK RG+++G + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+IDEALLRPGR+ V++E+ LP + GR+QI  IHT K+++ N+LA D+D+KELA  TKNYSGAE+E +V AA + A +        + +  E  Q+ +++R  F+ ++++D+K  +G + +D   +  N ++KWS  +S  L    LL++  K ++      +L+ G   +G +++A  +A+++ F FI++CS   MIGF+E A+C AIKKIF+DA K+  S +++DD+ERL+D+  IGPRFS  ++  L+ ++    P+ +K+LI+GTT     + E+    +F    I IP I
BLAST of Vesicle-fusing ATPase vs. Ensembl Zebrafish
Match: nsfb (N-ethylmaleimide-sensitive factor b [Source:ZFIN;Acc:ZDB-GENE-050808-1])

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 291/659 (44.16%), Postives = 428/659 (64.95%), Query Frame = 2
            DE S TN +  +  D+   +   I  TT + KF+F      SV  G +  +  QRKW    + + VE   Y+F         +     F++  S+  +P DSDK+A+++++ F     + +Q  +F++    F   I  I+ +D         SSK ++I+ G++  N+   F++   S   L G+ K + +   +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPP+ VE++G KHV+GILLYGPPG GKTL ARQIGKMLNAREPK+VNGP IL+KYVGESEANIRKLFADAEEE K++G  S LHIIIFDEIDAICK RG+++G + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+IDEALLRPGR+ V++E+ LP + GR+QI  IHT K+++ N+LA D+D+KELA  TKNYSGAE+E +V AA + A +        + +  E  Q+ +++R  F+ ++++D+K  +G + +D   +  N ++KWS  +S  L    LL++  K ++      +L+ G   +G +++A  +A+++ F FI++CS   MIGF+E A+C AIKKIF+DA K+  S +++DD+ERL+D+  IGPRFS  ++  L+ ++    P+ +K+LI+GTT     + E+    +F    I IP I
BLAST of Vesicle-fusing ATPase vs. Ensembl Zebrafish
Match: nsfb (N-ethylmaleimide-sensitive factor b [Source:ZFIN;Acc:ZDB-GENE-050808-1])

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 291/659 (44.16%), Postives = 428/659 (64.95%), Query Frame = 2
            DE S TN +  +  D+   +   I  TT + KF+F      SV  G +  +  QRKW    + + VE   Y+F         +     F++  S+  +P DSDK+A+++++ F     + +Q  +F++    F   I  I+ +D         SSK ++I+ G++  N+   F++   S   L G+ K + +   +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPP+ VE++G KHV+GILLYGPPG GKTL ARQIGKMLNAREPK+VNGP IL+KYVGESEANIRKLFADAEEE K++G  S LHIIIFDEIDAICK RG+++G + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+IDEALLRPGR+ V++E+ LP + GR+QI  IHT K+++ N+LA D+D+KELA  TKNYSGAE+E +V AA + A +        + +  E  Q+ +++R  F+ ++++D+K  +G + +D   +  N ++KWS  +S  L    LL++  K ++      +L+ G   +G +++A  +A+++ F FI++CS   MIGF+E A+C AIKKIF+DA K+  S +++DD+ERL+D+  IGPRFS  ++  L+ ++    P+ +K+LI+GTT     + E+    +F    I IP I
BLAST of Vesicle-fusing ATPase vs. Ensembl Xenopus
Match: fosl2 (FOS-like antigen 2 [Source:Xenbase;Acc:XB-GENE-6258093])

HSP 1 Score: 580.096 bits (1494), Expect = 0.000e+0
Identity = 303/732 (41.39%), Postives = 458/732 (62.57%), Query Frame = 2
            DE S TN    N  D+     + + V T+ N ++IF      ++  G +  +  QRKW    IG+ VE   Y+F         +     F++  S+  +P D+D++A +++++F++   +  Q L+F++    F   +  I+ +D         + K  +IE G++  N+   F++   S   L+G+ K       +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPPE VE++G KHV+GILL+GPPG GKTL ARQIGKMLNAREPK+VNGP IL+KYVGESEANIRKLFADAEEE +++G  S LHIIIFDEIDAICK RG+++G + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+IDEALLRPGR+ V++E+ LP + GRLQI  IHT ++RE ++L+ D+D+ ELA  TKN+SGAE+E +V AA + A +        + + +E  +  ++ +  F  ++ +D+K  +G + +D   +  N ++KW   +++ L    LL++  K +D      +L+ G P +G +++A  +++E+ F FI++CS   MIGFSE A+C AIKKIF+DA K+  S +++DD+ERL+DY  IGPRFS  ++  L+ ++    P+ +K+LIIGTT     + E+E   AF    I++P I T  +++  L     + D++   I   ++      + IGIK L+   +    +DP  RV + L  LK  ++ 
BLAST of Vesicle-fusing ATPase vs. Ensembl Xenopus
Match: fosl2 (FOS-like antigen 2 [Source:Xenbase;Acc:XB-GENE-6258093])

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 303/730 (41.51%), Postives = 457/730 (62.60%), Query Frame = 2
            DE S TN    N  D+     + + V T+ N ++IF      ++  G +  +  QRKW    IG+ VE   Y+F         +     F++  S+  +P D+D++A +++++F++   +  Q L+F++    F   +  I+ +D         + K  +IE G++  N+   F++   S   L+G+ K       +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPPE VE++G KHV+GILL+GPPG GKTL ARQIGKMLNAREPK+VNGP IL+KYVGESEANIRKLFADAEEE +++G  S LHIIIFDEIDAICK RG+++G + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+IDEALLRPGR+ V++E+ LP + GRLQI  IHT ++RE ++L+ D+D+ ELA  TKN+SGAE+E +V AA + A +        + + +E  +  ++ +  F  ++ +D+K  +G + +D   +  N ++KW   +++ L    LL++  K +D      +L+ G P +G +++A  +++E+ F FI++CS   MIGFSE A+C AIKKIF+DA K+  S +++DD+ERL+DY  IGPRFS  ++  L+ ++    P+ +K+LIIGTT     + E+E   AF    I++P I T  +++  L     + D++   I   ++      + IGIK L+   +    +DP  RV + L  LK  +
BLAST of Vesicle-fusing ATPase vs. Ensembl Xenopus
Match: fosl2 (FOS-like antigen 2 [Source:Xenbase;Acc:XB-GENE-6258093])

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 303/733 (41.34%), Postives = 459/733 (62.62%), Query Frame = 2
            DE S TN    N  D+     + + V T+ N ++IF      ++  G +  +  QRKW    IG+ VE   Y+F         +     F++  S+  +P D+D++A +++++F++   +  Q L+F++    F   +  I+ +D         + K  +IE G++  N+   F++   S   L+G+ K       +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPPE VE++G KHV+GILL+GPPG GKTL ARQIGKMLNAREPK+VNGP IL+KYVGESEANIRKLFADAEEE +++G  S LHIIIFDEIDAICK RG+++G + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+IDEALLRPGR+ V++E+ LP + GRLQI  IHT ++RE ++L+ D+D+ ELA  TKN+SGAE+E +V AA + A +        + + +E  +  ++ +  F  ++ +D+K  +G + +D   +  N ++KW   +++ L    LL++  K +D      +L+ G P +G +++A  +++E+ F FI++CS   MIGFSE A+C AIKKIF+DA K+  S +++DD+ERL+DY  IGPRFS  ++  L+ ++    P+ +K+LIIGTT     + E+E   AF    I++P I T  +++  L     + D++   I   ++      + IGIK L+   +    +DP  RV + L  LK  + ++
BLAST of Vesicle-fusing ATPase vs. Ensembl Xenopus
Match: fosl2 (FOS-like antigen 2 [Source:Xenbase;Acc:XB-GENE-6258093])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 303/730 (41.51%), Postives = 457/730 (62.60%), Query Frame = 2
            DE S TN    N  D+     + + V T+ N ++IF      ++  G +  +  QRKW    IG+ VE   Y+F         +     F++  S+  +P D+D++A +++++F++   +  Q L+F++    F   +  I+ +D         + K  +IE G++  N+   F++   S   L+G+ K       +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPPE VE++G KHV+GILL+GPPG GKTL ARQIGKMLNAREPK+VNGP IL+KYVGESEANIRKLFADAEEE +++G  S LHIIIFDEIDAICK RG+++G + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+IDEALLRPGR+ V++E+ LP + GRLQI  IHT ++RE ++L+ D+D+ ELA  TKN+SGAE+E +V AA + A +        + + +E  +  ++ +  F  ++ +D+K  +G + +D   +  N ++KW   +++ L    LL++  K +D      +L+ G P +G +++A  +++E+ F FI++CS   MIGFSE A+C AIKKIF+DA K+  S +++DD+ERL+DY  IGPRFS  ++  L+ ++    P+ +K+LIIGTT     + E+E   AF    I++P I T  +++  L     + D++   I   ++      + IGIK L+   +    +DP  RV + L  LK  +
BLAST of Vesicle-fusing ATPase vs. Ensembl Xenopus
Match: fosl2 (FOS-like antigen 2 [Source:Xenbase;Acc:XB-GENE-6258093])

HSP 1 Score: 578.556 bits (1490), Expect = 0.000e+0
Identity = 303/730 (41.51%), Postives = 457/730 (62.60%), Query Frame = 2
            DE S TN    N  D+     + + V T+ N ++IF      ++  G +  +  QRKW    IG+ VE   Y+F         +     F++  S+  +P D+D++A +++++F++   +  Q L+F++    F   +  I+ +D         + K  +IE G++  N+   F++   S   L+G+ K       +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPPE VE++G KHV+GILL+GPPG GKTL ARQIGKMLNAREPK+VNGP IL+KYVGESEANIRKLFADAEEE +++G  S LHIIIFDEIDAICK RG+++G + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+IDEALLRPGR+ V++E+ LP + GRLQI  IHT ++RE ++L+ D+D+ ELA  TKN+SGAE+E +V AA + A +        + + +E  +  ++ +  F  ++ +D+K  +G + +D   +  N ++KW   +++ L    LL++  K +D      +L+ G P +G +++A  +++E+ F FI++CS   MIGFSE A+C AIKKIF+DA K+  S +++DD+ERL+DY  IGPRFS  ++  L+ ++    P+ +K+LIIGTT     + E+E   AF    I++P I T  +++  L     + D++   I   ++      + IGIK L+   +    +DP  RV + L  LK  +
BLAST of Vesicle-fusing ATPase vs. Ensembl Mouse
Match: Nsf (N-ethylmaleimide sensitive fusion protein [Source:MGI Symbol;Acc:MGI:104560])

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 294/661 (44.48%), Postives = 431/661 (65.20%), Query Frame = 2
            DE S +N    N  D+    +  +  T+ ++K+IF      SV  GC+  +  QRKW    IG+ +E   YSF         +     F++  ++  +P D+DK+A +++++F++   +  Q L+F++    F   +  I+ +D         S K  +IE G++  N+   F++   S   L G+ K +     +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPPE VE++G KHV+GILLYGPPG GKTL ARQIGKMLNAREPK+VNGP IL+KYVGESEANIRKLFADAEEE +++G  S LHIIIFDEIDAICK RG+++G + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+IDEALLRPGR+ V++E+ LP + GRLQI  IHT ++R   +L+ D+D+KELA  TKN+SGAE+E +V AA + A +        + + +E  +S ++ R  F+ ++++D+K  +G + +D   +  N ++KW   +++ L    LL++  K +D      +L+ G P +G +++A  +A+E+ F FI++CS   MIGFSE A+C A+KKIFDDA K+  S +++DD+ERL+DY  IGPRFS  ++  L+ ++    P+ +K+LIIGTT     + E+E  +AF    I +P I T
BLAST of Vesicle-fusing ATPase vs. Ensembl Mouse
Match: Vcp (valosin containing protein [Source:MGI Symbol;Acc:MGI:99919])

HSP 1 Score: 164.081 bits (414), Expect = 2.135e-41
Identity = 129/417 (30.94%), Postives = 209/417 (50.12%), Query Frame = 2
             N +G   +GG  ++ +QI +   L  L  P   + +G+K  RGILLYGPPGTGKTL AR +     A    ++NGP I+ K  GESE+N+RK F +AE        ++A  II  DE+DAI   R    G   V+  +V+QLL  MDG++Q  +++++  TNR + ID AL R GR   ++++ +P   GRL+I +IHTK ++    LADD+DL+++A  T  + GA++ A+   A          L + +DE  D +    +A+ ++D      QS     +  +  +        G  +D  +E +E  L+++  +        G+             K +L YG P  G + +A  +A E    FI +     +    G SE      +++IFD A +A   V+  D+++ +

HSP 2 Score: 143.28 bits (360), Expect = 9.357e-35
Identity = 87/230 (37.83%), Postives = 133/230 (57.83%), Query Frame = 2
            +GGL++   ++ +        P +F++  G+   +G+L YGPPG GKTL A+ I     A    I  GP +L  + GESEAN+R++F  A         Q+A  ++ FDE+D+I KARG   G      D V+NQ+L +MDG+    N+ IIG TNR D+ID A+LRPGR+   I +PLP +  R+ I + + +    K+ +A D+DL+ LA +T  +SGA++  +   A
BLAST of Vesicle-fusing ATPase vs. Ensembl Mouse
Match: Psmc5 (protease (prosome, macropain) 26S subunit, ATPase 5 [Source:MGI Symbol;Acc:MGI:105047])

HSP 1 Score: 149.828 bits (377), Expect = 1.001e-38
Identity = 94/239 (39.33%), Postives = 137/239 (57.32%), Query Frame = 2
            +GGLD++  +I K      +  PE  E LGI   +G+LLYGPPGTGKTL AR +    +    + V+G  ++ K++GE    +R+LF         M  + A  II  DEID+I  +R  G   G S VQ T++ +LL ++DG E   NI +I  TNR D++D ALLRPGR+  +IE P P++  RL I +IH++K+     L   I+L+++A L    SGAE++ V   A   A  E+
BLAST of Vesicle-fusing ATPase vs. Ensembl Mouse
Match: Psmc1 (protease (prosome, macropain) 26S subunit, ATPase 1 [Source:MGI Symbol;Acc:MGI:106054])

HSP 1 Score: 150.599 bits (379), Expect = 1.362e-38
Identity = 90/231 (38.96%), Postives = 138/231 (59.74%), Query Frame = 2
            +GGLD +  +I +S  L  L  PE+ EE+GIK  +G++LYGPPGTGKTL A+ +    +A   ++V G  ++ KY+G+    +R+LF  AEE         A  I+  DEIDAI   R   N  G   +Q T++ +LL ++DG +   ++ +I  TNR + +D AL+RPGR+  +IE PLP +  + +IF+IHT ++     LADD+ L +L     + SGA+I+A+   A
BLAST of Vesicle-fusing ATPase vs. Ensembl Mouse
Match: Spata5 (spermatogenesis associated 5 [Source:MGI Symbol;Acc:MGI:1927170])

HSP 1 Score: 153.295 bits (386), Expect = 7.422e-38
Identity = 98/249 (39.36%), Postives = 137/249 (55.02%), Query Frame = 2
            PN  ++ IG  GL E      K A    L  P+    +GI+  +G+LLYGPPG  KT+ A+ +     A E  +    + GP +++KYVGESE  +R++F  A           A  II FDE+DA+   RG+ SG   V D V+ QLL +MDG+EQL N+ ++  TNR D ID+AL+RPGR+   I VPLP    R +I  +    +     +++++DL EL   T  YSGAEI AV   A   A +E

HSP 2 Score: 145.976 bits (367), Expect = 1.577e-35
Identity = 124/409 (30.32%), Postives = 191/409 (46.70%), Query Frame = 2
            +GGL+ +   I +   L  L  PE  +  GI   RG+LLYGPPGTGKT+ AR +   + A    ++NGP I+ K+ GE+EA +R++FA+A              II  DE+DA+C  R      S V+  VV  LL  MDG+    +   +L++G TNR   +D AL RPGR   +IE+ +P+   RL I +   K LR    L    +L  LA     Y GA+++A+           V+    N  D K      + I + D LQ     R   +  +  DV  +       L+  + K  + ++W  +  K+ +  G+             K +L+YG P    + +A  LA E+G  F+ +     M   +G SE     A+++IF  A     S+I  D+++ L
BLAST of Vesicle-fusing ATPase vs. UniProt/SwissProt
Match: sp|P46461|NSF1_DROME (Vesicle-fusing ATPase 1 OS=Drosophila melanogaster OX=7227 GN=comt PE=2 SV=1)

HSP 1 Score: 597.43 bits (1539), Expect = 0.000e+0
Identity = 305/679 (44.92%), Postives = 437/679 (64.36%), Query Frame = 2
             K  K   DE S TN+   N  D   F E  K+  ++ A  + FIF  +K   V  G +  + +QRKW    I + +E  PY F     V   V  E D   K    ++P DSD++A +++ +F    +T  Q L+FN++        + S++ +D KS      + M  +  G I  NTV +F++   S   L G+ K +     +INP+WDF  +G+GGLD+EF+ IF+ AF SR+FPPE VE+LG KHV+GILLYGPPGTGKTL ARQIG MLNAREPKIVNGP ILDKYVGESEAN+R+LFA+AEEE K++G  S LHIIIFDEIDAICK RG+++G S V DTVVNQLL K+DGV+QLNNIL+IGMTNRRDMIDEALLRPGR+ VQ+E+ LP++ GR+QI  IHTK++RE N + DD+D KE+AALTKN+SGAE+E +V AA ++A +        + +  E ++  K+NR  F+ +++HD+K  +G   + L       ++ W   +S  L    L ++  K  ++     +L+ G P +G +++A  LAK + F F+++CS  +M+G++E A+CL I+KIFDDA ++  S I++D+VERL+DY SIGPR+S   +  L+ ++    PK +K+LI+ T+     + E+E  +AF  + + +P +  P  +++V
BLAST of Vesicle-fusing ATPase vs. UniProt/SwissProt
Match: sp|P54351|NSF2_DROME (Vesicle-fusing ATPase 2 OS=Drosophila melanogaster OX=7227 GN=Nsf2 PE=2 SV=2)

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 320/739 (43.30%), Postives = 471/739 (63.73%), Query Frame = 2
            K   DE S TNK   N SD+   + K++ ++      +IF  +K     +  G +  + +QRKW    I + ++  PY F     +  ++  E D   K  + ++P DSD++A ++L +F   P+T  Q L+F ++   F    + +++ +D ++      K   +  G I  NTV +F++   S   L GR K +     +INP+WDF  +G+GGLD+EF+ IF+ AF SR+FPPE VE+LGIKHV+GILLYGPPGTGKTL ARQIG MLNAREPKIVNGP ILDKYVGESEANIR+LFA+AEEE K++G  S LHIIIFDEIDAICKARG+++G S V DTVVNQLLAK+DGVEQLNNIL+IGMTNRRDMIDEALLRPGR+ VQ+E+ LP++ GR+QI  IHTK++R+ N +A D+D  E+AA TKN+SGAE+E +V AA + A +        + +  E ++  ++ R  F+ A+D+D+K  +G   + L+      ++ W P +++ L    L ++  K  ++     +LI G P +G S++A +LA+ + F F+++CS  +M+GF+E A+CL I+KIFDDA ++  S I++D+VERL+DY  IGPR+S   +  L+ ++    PK +K+LI+ T+     + E+E  SAF  + + +  + TP  +++VL D DL+S  +LQ I   +       L IGIK L+     ++  +P +RV + L K++     + 
BLAST of Vesicle-fusing ATPase vs. UniProt/SwissProt
Match: sp|Q9QUL6|NSF_RAT (Vesicle-fusing ATPase OS=Rattus norvegicus OX=10116 GN=Nsf PE=1 SV=1)

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 294/661 (44.48%), Postives = 430/661 (65.05%), Query Frame = 2
            DE S +N    N  D+    +  +  T+ ++K+IF      SV  GC+  +  QRKW    IG+ +E   YSF         +     F++  ++  +P D+DK+A +++++F+    +  Q L+F++    F   +  I+ +D         S K  +IE G++  N+   F++   S   L G+ K +     +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPPE VE++G KHV+GILLYGPPG GKTL ARQIGKMLNAREPK+VNGP IL+KYVGESEANIRKLFADAEEE +++G  S LHIIIFDEIDAICK RG+++G + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+IDEALLRPGR+ V++E+ LP + GRLQI  IHT ++R   +L+ D+D+KELA  TKN+SGAE+E +V AA + A +        + + +E  +S ++ R  F+ ++++D+K  +G + +D   +  N ++KW   +++ L    LL++  K +D      +L+ G P +G +++A  +A+E+ F FI++CS   MIGFSE A+C A+KKIFDDA K+  S +++DD+ERL+DY  IGPRFS  ++  L+ ++    P+ +K+LIIGTT     + E+E  +AF    I +P I T
BLAST of Vesicle-fusing ATPase vs. UniProt/SwissProt
Match: sp|P46460|NSF_MOUSE (Vesicle-fusing ATPase OS=Mus musculus OX=10090 GN=Nsf PE=1 SV=2)

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 294/661 (44.48%), Postives = 431/661 (65.20%), Query Frame = 2
            DE S +N    N  D+    +  +  T+ ++K+IF      SV  GC+  +  QRKW    IG+ +E   YSF         +     F++  ++  +P D+DK+A +++++F++   +  Q L+F++    F   +  I+ +D         S K  +IE G++  N+   F++   S   L G+ K +     +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPPE VE++G KHV+GILLYGPPG GKTL ARQIGKMLNAREPK+VNGP IL+KYVGESEANIRKLFADAEEE +++G  S LHIIIFDEIDAICK RG+++G + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+IDEALLRPGR+ V++E+ LP + GRLQI  IHT ++R   +L+ D+D+KELA  TKN+SGAE+E +V AA + A +        + + +E  +S ++ R  F+ ++++D+K  +G + +D   +  N ++KW   +++ L    LL++  K +D      +L+ G P +G +++A  +A+E+ F FI++CS   MIGFSE A+C A+KKIFDDA K+  S +++DD+ERL+DY  IGPRFS  ++  L+ ++    P+ +K+LIIGTT     + E+E  +AF    I +P I T
BLAST of Vesicle-fusing ATPase vs. UniProt/SwissProt
Match: sp|P18708|NSF_CRIGR (Vesicle-fusing ATPase OS=Cricetulus griseus OX=10029 GN=NSF PE=1 SV=1)

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 293/661 (44.33%), Postives = 430/661 (65.05%), Query Frame = 2
            DE S +N    +  D+    +  I  T+ ++K+IF      SV  G +  +  QRKW    IG+ +E   YSF         +     F++  ++  +P D+DK+A +++++F++   +  Q L+F++    F   +  I+ +D         S K  +IE G++  N+   F++   S   L G+ K +     +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPPE VE++G KHV+GILLYGPPG GKTL ARQIGKMLNAREPK+VNGP IL+KYVGESEANIRKLFADAEEE +++G  S LHIIIFDEIDAICK RG+++G + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+IDEALLRPGR+ V++E+ LP + GRLQI  IHT ++R   +L+ D+D+KELA  TKN+SGAE+E +V AA + A +        + + +E  +S ++ R  F+ ++++D+K  +G + +D   +  N ++KW   +++ L    LL++  K +D      +L+ G P +G +++A  +A+E+ F FI++CS   MIGFSE A+C A+KKIFDDA K+  S +++DD+ERL+DY  IGPRFS  ++  L+ ++    P+ +K+LIIGTT     + E+E  +AF    I +P I T
BLAST of Vesicle-fusing ATPase vs. TrEMBL
Match: C1LF61 (NEM-sensitive fusion protein 2 OS=Schistosoma japonicum OX=6182 GN=Nsf2 PE=2 SV=1)

HSP 1 Score: 612.453 bits (1578), Expect = 0.000e+0
Identity = 323/741 (43.59%), Postives = 464/741 (62.62%), Query Frame = 2
            F   K   +E S TN++FFNP D   F +KF  + + T ++K+IF+    E+V +G +     QRKW    + E ++  PY+F      +   ++ +D   K  S+ +P+DSDK+A+++  +F DTP+T  QL+L+ +  I F  ++  +  L      ++  + G++  NTV  +   P+SK +L G+   E               +INPNWDFN +G+GGLD+EFS IF+  F SR+FPP   ++LG+KHVRGILLYGPPGTGKTL ARQIG MLNAREPKIVNGPSILDKYVGESEANIRKLFADAEEE K+MG +SALHIIIFDEIDAICK RG+  GG+ V DTVVNQLL  +DGV QLNNIL+IGMTNRRDMIDEALLRPGR  +Q+E+ LP + GR QI  IHT K+++   LA D+DLKELAA+TKN+SGAEIE +  AA   +  +   P     +  +      + R  F++A++HDVK  +G  +++L  +    ++ W   +S AL    L + ++K  D  + + L  L+ G P  G +++AV +A+ +GF F+++ +   MIGF+E A+C A+KKIFDD  K+P SV+I+D++E LI+Y+ +GPRFS F+V  +  +++  +   + ML++ TT    A+ +     AF  + + +  +  P  II+ L +   ++  + Q I+  L       L IGIK+L++    +   D   RV   L KL+
BLAST of Vesicle-fusing ATPase vs. TrEMBL
Match: A0A0N4ZGZ3 (Uncharacterized protein OS=Parastrongyloides trichosuri OX=131310 PE=4 SV=1)

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 337/747 (45.11%), Postives = 481/747 (64.39%), Query Frame = 2
             KV+K   DE + +N    +  D+     K I V T  +++F F       + +G +      RKW    + + V+C P++     L+  + V++D F K     D +DSD ++ ++  +F     T+ QLL+F +++        F   +ISI G+DV ++        ++I  G +  N+V  F +R  ++  L G+ K + A   +I+P+WDF S+G+GGLD+EFS IF+ AF SRLFPPE VE+LG+KHVRGILLYGPPGTGKTL ARQIGKMLNAREPKIVNGP ILDKYVGESEANIRKLFADAEEEFK+ GN SALHIIIFDEIDAICK RG  +G S V DTVVNQ+L KMDGV+QLNNIL+IGMTNRRDMIDEALLRPGRM VQ+E+ LP ++GR+QI  IHT K+RE + L+ D+DLKELA  TKN+SGAE+E +V AA ++A +        + +  +  +  KI  + F +A+ +D+K  +G  D+ L+ F    +L WSP+ISK L T  + I   K+ D+     LL+ G    G S +A  +AK +GF F+++C+   M+G++E A+C A++KIFDDA ++P SVII+D+++RL+DY+S+GPR+S  ++  L+ ++    PK K++L++ T    S + EL+  SAFD + I +P +KT   I  VL D +++S+ D+Q I+  ++  GD     IGIK ++      K  DP  R    + K+ +++  Q+
BLAST of Vesicle-fusing ATPase vs. TrEMBL
Match: A0A0K0DX31 (Uncharacterized protein OS=Strongyloides stercoralis OX=6248 PE=4 SV=1)

HSP 1 Score: 609.757 bits (1571), Expect = 0.000e+0
Identity = 335/750 (44.67%), Postives = 478/750 (63.73%), Query Frame = 2
            I  KV+K   DE + +N    N  D+     K I V T  +++F F       V +G +      RKW    + + V+C P++     L+  + V++D F K     D +DSD ++ ++  +F     T+ Q L+F +++        F   +I I G+DV ++          +I  G +  N++  F +R  ++  L+G+ K + A   +I+P+WDF S+G+GGLD+EFS IF+ AF SRLFPPE VE+LG+KHVRGILLYGPPGTGKTL ARQIGKMLNAREPKIVNGP ILDKYVGESEANIRKLF DAEEEFK+ GN SALHIIIFDEIDAICK RG  +G S V DTVVNQ+L KMDGV+QLNNIL+IGMTNRRDMIDEALLRPGRM VQ+E+ LP ++GR+QI  IHT K+RE + L  D+DLK +A  TKN+SGAEIE +V AA ++A +        + +  +  +  KI  + F +A+ +D+K  +G  D+ L+ F    +L WSP+ISK L T  + I   K+ D+     LL+ G P  G S +A  +AK +GF F+++C+   M+G++E A+C A++KIF+DA ++P SVII+D+++RL+DY+S+GPRFS  ++  L+ ++    PK K++L++ T    + + EL+  +AFD + I +P ++T   I  VL D +++S  D+Q I+  L+  GD   + IGIK ++      K  DP  R    + K+ +S+  Q+
BLAST of Vesicle-fusing ATPase vs. TrEMBL
Match: G4VMW9 (Putative vesicular-fusion protein nsf OS=Schistosoma mansoni OX=6183 GN=Smp_057320 PE=4 SV=1)

HSP 1 Score: 609.757 bits (1571), Expect = 0.000e+0
Identity = 320/741 (43.18%), Postives = 469/741 (63.29%), Query Frame = 2
            F   K   +E S TN++FFNP D   F EK   + + TA++K++F+    + V +G +     QRKW    + E ++  PY+F      +   ++ +D   K  S+ +P+DSD++A+++  +F DTP+T  Q +L+ +  +    ++  +  L +    ++  + G++  NTV ++  +P+SK +L G+   ++              +INPNWDFN +G+GGLD+EFS IF+  F SR+FPP   ++LG+KHVRGILLYGPPGTGKTL ARQIGKMLNAREPKIVNGPSILDKYVGESEANIRKLFADAEEE K+MG +SALHIIIFDEIDAICK+RG+  GG+ V DTVVNQLL  MDGV QLNNIL+IGMTNRRDMIDEALLRPGR  +Q+E+ LP + GRLQI  IHT K+++   LA D+DLKELAA TKN+SGAEIE +  AA   +  +   P     +  +      + R  F++A++HDVK  +G  +++L  +    ++ W   +S AL    L + ++K  D  + +   LL+ G P  G +++AV +A+ +GF F+++ +   MIGF+E A+C A+KKIFDD  K+P SV+I+D++E LI+Y+ +GPRFS F+V  +  +++  +   ++ML++ TT    A+ +     AF  + + +  +  P  +I+ L +   ++  + Q I+  L       L IGIK+L++    +   DP  RV   L KL+
BLAST of Vesicle-fusing ATPase vs. TrEMBL
Match: A0A267EGJ4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016436g3 PE=4 SV=1)

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 315/738 (42.68%), Postives = 474/738 (64.23%), Query Frame = 2
            M  F+  K   DE S TNKIFFNP+D    K +FI + + S  + F  D + S+  G    + +QR+W    IG+ V      SF      +  V +E D  +K ++  DP +SD++ +++ + F   P+T  Q ++F ++  + +  ++ ++ ++    + + +  + G+I  NT+  F++ P+S  +L+G+ KA+     +INP+W+F+ +G+GGLD EFS IF+  F SR+FPP+ VE+LG+ HVRG+LLYGPPGTGKTL ARQIGKMLNAREPKIVNGPSILDKYVGESEA IR+LFADAEEEFK++GN SALHIIIFDEIDAICKARG++ GG+ V DTVVNQLL+K+DGVE LNNIL+IGMTNR+DMIDEALLRPGR  VQ+E+ LP +HGR QI  IHT K+R+   L+ D+D++ELAA TKN+SGAE+  +V AA   A +      + + +  + ++   + R  F+ A+++D++  +G  +++L  +    L++W   ++  +   GLL       E+    D+     LL+ G   +G +++AVH+A++ GF+++R+ + +NM+GF+E A+C+A+KK FDDA KA  +V+ILD +E LIDYS +GPR+S +++  L  +I   +P+NK +L++GTT    A+ EL     F    I +  +  P  +++ L   D    ++ +    +  +  C  L IGIK L++  +    V+   RV   L +L
BLAST of Vesicle-fusing ATPase vs. Ensembl Cavefish
Match: nsfa (vesicle-fusing ATPase [Source:NCBI gene;Acc:103037152])

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 296/667 (44.38%), Postives = 434/667 (65.07%), Query Frame = 2
            DE S TN    +  D  L   + +TV TT ++KF+F      +V  G +  +  QRKW    IG+ VE   Y+F ++   +  + +E+D   K ++   P DSDK+A +++++F++   + +Q L+F++    F   +  ++ +D         S K  +IE G++  N+   F++   S   L G+ K + A   +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPP+ VE++G KHV+GILL+GPPG GKTL ARQIGKMLNAREPKIVNGP IL+KYVGESEANIRKLFADAE+E K++G  S LHIIIFDE+DAICK RG  +  + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+ID+AL+RPGR  V++E+ LP + GR+QI  IHT K+RE N+LA D++LKELAA TKNYSGAE+E +V AA + A +        + + +E  +  ++ R  F+ ++++D+K  +G + +D   +  N ++KW   ++  L    LL++  K +D      +L+ G P +G +++A  +A+++ F FI++CS   MIG SE  +C AIKKIFDDA K+  S +++DD+ERL+DY  IGPRFS  ++  L+ ++    P+ +K+LIIGTT     + E+E   AF    I IP I +   ++
BLAST of Vesicle-fusing ATPase vs. Ensembl Cavefish
Match: nsfa (vesicle-fusing ATPase [Source:NCBI gene;Acc:103037152])

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 296/667 (44.38%), Postives = 434/667 (65.07%), Query Frame = 2
            DE S TN    +  D  L   + +TV TT ++KF+F      +V  G +  +  QRKW    IG+ VE   Y+F ++   +  + +E+D   K ++   P DSDK+A +++++F++   + +Q L+F++    F   +  ++ +D         S K  +IE G++  N+   F++   S   L G+ K + A   +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPP+ VE++G KHV+GILL+GPPG GKTL ARQIGKMLNAREPKIVNGP IL+KYVGESEANIRKLFADAE+E K++G  S LHIIIFDE+DAICK RG  +  + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+ID+AL+RPGR  V++E+ LP + GR+QI  IHT K+RE N+LA D++LKELAA TKNYSGAE+E +V AA + A +        + + +E  +  ++ R  F+ ++++D+K  +G + +D   +  N ++KW   ++  L    LL++  K +D      +L+ G P +G +++A  +A+++ F FI++CS   MIG SE  +C AIKKIFDDA K+  S +++DD+ERL+DY  IGPRFS  ++  L+ ++    P+ +K+LIIGTT     + E+E   AF    I IP I +   ++
BLAST of Vesicle-fusing ATPase vs. Ensembl Cavefish
Match: nsfa (vesicle-fusing ATPase [Source:NCBI gene;Acc:103037152])

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 296/667 (44.38%), Postives = 434/667 (65.07%), Query Frame = 2
            DE S TN    +  D  L   + +TV TT ++KF+F      +V  G +  +  QRKW    IG+ VE   Y+F ++   +  + +E+D   K ++   P DSDK+A +++++F++   + +Q L+F++    F   +  ++ +D         S K  +IE G++  N+   F++   S   L G+ K + A   +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPP+ VE++G KHV+GILL+GPPG GKTL ARQIGKMLNAREPKIVNGP IL+KYVGESEANIRKLFADAE+E K++G  S LHIIIFDE+DAICK RG  +  + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+ID+AL+RPGR  V++E+ LP + GR+QI  IHT K+RE N+LA D++LKELAA TKNYSGAE+E +V AA + A +        + + +E  +  ++ R  F+ ++++D+K  +G + +D   +  N ++KW   ++  L    LL++  K +D      +L+ G P +G +++A  +A+++ F FI++CS   MIG SE  +C AIKKIFDDA K+  S +++DD+ERL+DY  IGPRFS  ++  L+ ++    P+ +K+LIIGTT     + E+E   AF    I IP I +   ++
BLAST of Vesicle-fusing ATPase vs. Ensembl Cavefish
Match: nsfb (N-ethylmaleimide-sensitive factor b [Source:ZFIN;Acc:ZDB-GENE-050808-1])

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 289/665 (43.46%), Postives = 428/665 (64.36%), Query Frame = 2
            D+ S TN +  N  D    +   I  TT ++K++F     +SV  G +  +  QRKW    + + V+   Y+F T       + +E+D   K  +  +P D+DK+++++++ F+       Q  +F++    F   I  ++ +D       +SSK  +I+ G++  N+   F++   S   L G+ K   A   +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPP+ VE++G KHV+GILL+GPPG GKTL ARQIGKMLNAREPK+VNGP IL+KYVGESEANIRKLFADAE+E K++G  S LHIIIFDEIDAICK RG+++G + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+IDEALLRPGR+ V++E+ LP + GR+QI  IHT ++R+ N+L  D+D+KELA  TKNYSGAE+E +V AA + A +        + +  E  Q  +++R  F  ++++D+K  +G + +D   +  N ++KWS  ++  L    LL++  K ++      +L+ G P  G +++A  +A+++ F FI++CS   MIGFSE A+C AIKKIFDDA K+  S +++DD+ERL+D+  IGPRFS  ++  L+ ++    P+ +K+LI+GTT     M E+    +F    I IP I     ++
BLAST of Vesicle-fusing ATPase vs. Ensembl Cavefish
Match: nsfa (vesicle-fusing ATPase [Source:NCBI gene;Acc:103037152])

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 295/675 (43.70%), Postives = 433/675 (64.15%), Query Frame = 2
            DE S TN    +  D  L   + +TV TT ++KF+F      +V  G +  +  QRKW    IG+ VE   Y+F ++   +  + +E+D   K ++   P DSDK+A +++++F++   + +Q L+F++    F   +  ++ +D         S K  +IE G++  N+   F++   S   L G+ K + A   +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPP+ VE++G KHV+GILL+GPPG GKTL ARQIGKMLNAREPKIVNGP IL+KYVGESEANIRKLFADAE+E K++ N           LHIIIFDE+DAICK RG  +  + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+ID+AL+RPGR  V++E+ LP + GR+QI  IHT K+RE N+LA D++LKELAA TKNYSGAE+E +V AA + A +        + + +E  +  ++ R  F+ ++++D+K  +G + +D   +  N ++KW   ++  L    LL++  K +D      +L+ G P +G +++A  +A+++ F FI++CS   MIG SE  +C AIKKIFDDA K+  S +++DD+ERL+DY  IGPRFS  ++  L+ ++    P+ +K+LIIGTT     + E+E   AF    I IP I +   ++
BLAST of Vesicle-fusing ATPase vs. Ensembl Sea Lamprey
Match: nsfa (N-ethylmaleimide-sensitive factor a [Source:ZFIN;Acc:ZDB-GENE-030616-37])

HSP 1 Score: 354.369 bits (908), Expect = 1.674e-113
Identity = 196/543 (36.10%), Postives = 306/543 (56.35%), Query Frame = 2
            A K  +   DE S TN    + SD  L       +T    +++F      SV  G +  +  QRKW    +G+ V+  P+ F +T   +  + +E+D   K  +  +P DSDK+A  ++ +F     +  Q L+F++    F   +  I+ +D         S K N+I TG+   NT   F++   S   L+G+ K +     +INP+W+F  +G+GGLD EFS IF+ AF SR+FPP+ VE++ + HV+ + + G P T K++   ++G  +  R P   +G     + VG+ E   R+         ++    G  S LHIIIFDEIDAICK RG+++G + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+IDEALLRPGR+ V++E+ LP   GR+QI  IHT ++R+  +LA D+D+ ELA  TKN+SGAE+E +V AA + A +        + + +E  +  ++ R+ F+ A+D D+K  +G + +D Q +  N ++ W   + + L    LL++  K ++      +L+ G
BLAST of Vesicle-fusing ATPase vs. Ensembl Sea Lamprey
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6547])

HSP 1 Score: 149.058 bits (375), Expect = 4.034e-39
Identity = 94/239 (39.33%), Postives = 136/239 (56.90%), Query Frame = 2
            +GGLD++  +I K      +  PE  E LGI   +G+LLYGPPGTGKTL AR +         + V+G  ++ K++GE    +R+LF         M  + A  II  DEID+I  +R  G   G S VQ T++ +LL ++DG E   NI +I  TNR D++D ALLRPGR+  +IE P P++  RL I +IH++K+     L   I+L+++A L    SGAE++ V   A   A  E+
BLAST of Vesicle-fusing ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010299.1 (pep scaffold:Pmarinus_7.0:GL479893:343:6144:1 gene:ENSPMAG00000009320.1 transcript:ENSPMAT00000010299.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 138.272 bits (347), Expect = 2.247e-35
Identity = 83/231 (35.93%), Postives = 135/231 (58.44%), Query Frame = 2
            VGGLD++  ++ ++  L       F E LGI+  +G+L+YGPPGTGKTL AR       A   K+  GP ++  ++G+    +R  FA A+E+        A  II  DE+DAI   R     +G   VQ T++ +LL ++DG +    + +I  TNR D++D ALLR GR+  +IE P+P++  R +I +IH++K+     ++ D++ +ELA  T +++GA+ +AV + A
BLAST of Vesicle-fusing ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001244.1 (pep scaffold:Pmarinus_7.0:GL482260:6416:9764:-1 gene:ENSPMAG00000001115.1 transcript:ENSPMAT00000001244.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.117 bits (344), Expect = 7.102e-35
Identity = 90/237 (37.97%), Postives = 131/237 (55.27%), Query Frame = 2
            D     VGG  E+  ++ +      L P  FV  LGI+  +G+LL+GPPGTGKTL AR +    +A   +++ G  ++ KYVGE    +R+LF        +M  ++ L  I FDEIDAI  AR      G + VQ T++ +L+ ++DG +   NI ++  TNR D +D AL+RPGR+  +IE  LP   GR  IF+IH + +     +  DI  + LA L  N +GAEI +V   A
BLAST of Vesicle-fusing ATPase vs. Ensembl Sea Lamprey
Match: nvl (nuclear VCP like [Source:ZFIN;Acc:ZDB-GENE-040426-2871])

HSP 1 Score: 135.576 bits (340), Expect = 9.547e-34
Identity = 93/247 (37.65%), Postives = 130/247 (52.63%), Query Frame = 2
             WD     +G L E   +    A L+ +  PE  + LG+    GILL GPPG GKT+ A+ I     A E  +    V GP +L+ YVGESE  +R++F  A          SA  +I FDEIDAIC  R +   G++V+  VVNQLL +MDG+E    + I+  TNR D++D A+LRPGR+   + V LP    R  I    T+    K  L  D+DL  +A    +  +SGA+++A+   A   A

HSP 2 Score: 88.1965 bits (217), Expect = 2.143e-18
Identity = 58/168 (34.52%), Postives = 90/168 (53.57%), Query Frame = 2
            V GP ++    GESE  +R+LF        ++ ++SA  ++  DEIDAI   R   S    ++  +V QLL  MDG+     +L IG TNR D +D AL R GR   +I + +P ++ R +I  +  + LR    L ++ + K LA LT  Y GA++ ++   A A+A
BLAST of Vesicle-fusing ATPase vs. Ensembl Yeast
Match: SEC18 (AAA ATPase and SNARE disassembly chaperone; required for vesicular transport between ER and Golgi, the 'priming' step in homotypic vacuole fusion, autophagy, and protein secretion; releases Sec17p from SNAP complexes; has similarity to mammalian N-ethylmaleimide-sensitive factor (NSF) [Source:SGD;Acc:S000000284])

HSP 1 Score: 490.345 bits (1261), Expect = 2.245e-163
Identity = 276/740 (37.30%), Postives = 437/740 (59.05%), Query Frame = 2
             KV     + ++  N    +P+D+      +I +    N F+F +     +  G +  NG QR W    + + V+   +           +  +D+ +    +  ++    D D+LA +++  +     +  Q L+  ++   F+ KI ++Q +D+      S+    IET GI+   T   F +  +    L         +  +I P++ F  +GVGGLD+EF++IF+ AF SR+FPP  +E+LGI HV+G+LLYGPPGTGKTL AR+IG MLNA+EPKIVNGP IL KYVG SE NIR LF DAE E++  G +S+LHIIIFDE+D++ K RG+   G+ V D VVNQLLAKMDGV+QLNNIL+IGMTNR+D+ID ALLRPGR  VQ+E+ LP + GRLQIF+I TKK+RE N+++DD++L ELAALTKN+SGAEIE +V +A + A ++  +  KG   +  +D+   K+ R+ F+ A+ +DV   +G  ++DL+   E  ++ +S +++  L      +  ++ +D      LLI+G   +G +++A  +A ++GF FIR+ S   + G SE A+   I   F DA K+P +++++D +E L+D+  IGPRFS    NN++ M+   +    P+++++LI+ TT   S + +++  S FD N I +P +    E+ +V+ + +   D+   ++ N L    C +  +GIK  + N +  +   DP   + EL+ +
BLAST of Vesicle-fusing ATPase vs. Ensembl Yeast
Match: CDC48 (AAA ATPase; subunit of polyUb-selective segregase complex involved in ERAD, INM-associated degradation (INMAD), mitotic spindle disassembly, macroautophagy, PMN, ribosome-associated degradation, ribophagy, homotypic ER membrane fusion, SCF complex disassembly, cell wall integrity during heat stress, and telomerase regulation; mobilizes membrane-anchored transcription factors by regulated Ub/proteasome-dependent processing (RUP); human ortholog VCP complements a cdc48 mutant [Source:SGD;Acc:S000002284])

HSP 1 Score: 176.792 bits (447), Expect = 1.448e-46
Identity = 151/458 (32.97%), Postives = 229/458 (50.00%), Query Frame = 2
            + N +G   +GG  ++ +QI +   L  L  P+  + +GIK  RG+L+YGPPGTGKTL AR +     A    ++NGP ++ K  GESE+N+RK F +AE        ++A  II  DEID+I   R   +G   V+  VV+QLL  MDG++  +N+++I  TNR + ID AL R GR   ++++ +P   GRL++  IHTK ++    LADD+DL+ LAA T  Y GA+I ++   A      EK D        I  E L S  +   +F FA+ +          V+++    DD   L E KE        ++ + +    L  +          K +L YG P TG + +A  +A E    FI      + SM    G SE      I+ IFD A  A  +V+ LD+++ +      S+G     S  +VN L+  ++    K K + +IG T

HSP 2 Score: 154.836 bits (390), Expect = 2.215e-39
Identity = 92/241 (38.17%), Postives = 134/241 (55.60%), Query Frame = 2
            +N  WD     VGGLDE   ++ ++     L P ++ +  G+   +G+L YGPPGTGKTL A+ +   ++A     V GP +L  + GESE+NIR +F  A          +A  ++  DE+D+I KARG +L       D VVNQLL +MDG+    N+ +IG TNR D ID A+LRPGR+   I VPLP ++ RL I     +    K  L   ++L  +A  T+ +SGA++  +V  A
BLAST of Vesicle-fusing ATPase vs. Ensembl Yeast
Match: AFG2 (ATPase of the CDC48/PAS1/SEC18 (AAA) family, forms a hexameric complex; is essential for pre-60S maturation and release of several preribosome maturation factors; releases Rlp24p from purified pre-60S particles in vitro; target of the ribosomal biosynthesis inhibitor diazaborine; may be involved in degradation of aberrant mRNAs [Source:SGD;Acc:S000004389])

HSP 1 Score: 152.525 bits (384), Expect = 1.040e-38
Identity = 122/402 (30.35%), Postives = 191/402 (47.51%), Query Frame = 2
             VGGLD+E   + KSA    L  P      G+   RGILL+GPPGTGKT+  R +    NA    I NGPSI+ KY+GE+EA +R +F +A         +    II  DEID+I   R N   G  V+  VV  LL  MDG+     +++I  TNR + +D AL RPGR   ++E+ +P    R  I      ++     + D   +K +A+ T  Y GA++ A+    VM  +      D   D K  + + ++D++S  ++ R   +  I  ++  +Y       +E K     +++   + S+  +  G+           + K +L+YG P    +  A  LA E+G  F+ +         +G SE     AI++IF  A  A  S+I  D+++ L

HSP 2 Score: 147.517 bits (371), Expect = 3.545e-37
Identity = 105/265 (39.62%), Postives = 136/265 (51.32%), Query Frame = 2
            +GG  EE     K      L   E    LGI   +G+LLYGPPG  KTLTA+ +     A E  I    V GP I +KYVGESE  IR++F  A          +A  II FDEIDA+   R   S  +A  + V+  LL ++DGVE+L  ++I+  TNR D ID ALLRPGR+   I V  P  + RL+I +  TKK    N     +DL ELA  T+ YSGAE+  +   A             G+A  +EDL   K+  +HF
BLAST of Vesicle-fusing ATPase vs. Ensembl Yeast
Match: RPT6 (ATPase of the 19S regulatory particle of the 26S proteasome; one of six ATPases of the regulatory particle; involved in the degradation of ubiquitinated substrates; bound by ubiquitin-protein ligases Ubr1p and Ufd4p; localized mainly to the nucleus throughout the cell cycle; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003016])

HSP 1 Score: 145.206 bits (365), Expect = 4.479e-38
Identity = 94/239 (39.33%), Postives = 134/239 (56.07%), Query Frame = 2
            VGGL ++  +I K      +  PE  E LGI   +G++LYGPPGTGKTL AR +    + +  + V+G  ++ KY+GE    +R+LF         M  + A  II  DEID+I   R   SGG  S VQ T++ +LL ++DG E   NI II  TNR D++D ALLRPGR+  +IE P PS   R +I  IH++K+     L   I+L+++A      SGA+++ V   A   A  E+
BLAST of Vesicle-fusing ATPase vs. Ensembl Yeast
Match: PEX6 (AAA-peroxin; heterodimerizes with AAA-peroxin Pex1p and participates in the recycling of peroxisomal signal receptor Pex5p from the peroxisomal membrane to the cystosol; mutations in human PEX6 can lead to severe peroxisomal disorders and early death [Source:SGD;Acc:S000005273])

HSP 1 Score: 150.984 bits (380), Expect = 5.969e-38
Identity = 95/246 (38.62%), Postives = 136/246 (55.28%), Query Frame = 2
            N  WD     +GG+D    +I  +  +    P  F    G+K   GIL YGPPGTGKTL A+ I    +      V GP +L+ Y+GESEAN+R++F  A E        +   +I FDEID++   RGN      V D +V+QLLA++DG+    + + +IG TNR D++DEALLRPGR    + + +P +   +L I E  T+K     +L +D+ L ELA L   NY+GA+  A+   A+ NA
BLAST of Vesicle-fusing ATPase vs. Ensembl Nematostella
Match: EDO36224 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ74])

HSP 1 Score: 544.273 bits (1401), Expect = 0.000e+0
Identity = 286/678 (42.18%), Postives = 425/678 (62.68%), Query Frame = 2
            M+  KV K   D+ S +N +  N +D    K K + V T   K FIF +   + + +G    + IQRKW    +   ++ IPY F     ++ + +E D   KS   +D  D+DK+A  + + F D   +  Q + F +        +I S++ +DV        S    +  G++  NT   F+R   S   L+G  K +     +I+ +WDF  +G+GGLD+EFS I + AF +RLFP + V+++G+KHV+GILL+GPPGTGKTL ARQIG MLN REPKI++GP +L+K+VGESEANIRKLFA+AEEE K+ G+ SALH+IIFDE DA+CK+R + +  + VQD+VVNQLLAK+DGVEQLNN+L+IGMTNRRD+ID+ALLRPGR+ VQ+E+ LP + GR+QI +IHT K+RE  +LADD+DL ELA  TKN++GAEIE +V AA + A +          I  +  Q   ++R+ F+ A++ D+K  +G  DD+L  +  N + +W   + + L    LL++  +  D  S   +L+ G    G +++A+ +A  + F FI++C+  NMIGF + A+C +IKKIFDDA K+  S II+DD+ERL+DY +IGPRFS  ++  L+ ++   + K +K++IIGTT     +  +    AF+   I +P + T   +++
BLAST of Vesicle-fusing ATPase vs. Ensembl Nematostella
Match: EDO39006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBC8])

HSP 1 Score: 162.54 bits (410), Expect = 2.162e-42
Identity = 108/266 (40.60%), Postives = 144/266 (54.14%), Query Frame = 2
            VGG +E   +  K A    L  PE  + LGI+  RGIL+YGPPG  KTL AR +     A E  +    + GP +  K+VGESE  +R++F  A          +A  I+ FDE+DAI   R N +GGS V D V+ QLL ++DGVE L +++ I  TNR DMID+AL+RPGR+   I VPLP    R  I EIH      +      +DL++L   T+ YSGAEI AV   AALA  Q              E++Q+  +  +HF

HSP 2 Score: 123.25 bits (308), Expect = 2.346e-29
Identity = 114/416 (27.40%), Postives = 193/416 (46.39%), Query Frame = 2
            +GGL  +  Q  +      L  PE     G+   RGILLYGP GTGKT+ AR +     A E  +    +NGP +L +Y GE+EA +R++F +A+       N+S   I+  DE+DA+C  R  +   +  +  VV  LL  MDG+   +    ++++  TNR D +D AL RPGR   +IE+ +PS   R  I     K +   + L D+ D+  LA     Y GA++ A    A        L N  +      E+ D   K+ + +  ED++ +F+  R   +  +  +V  ++      +++ + K    ++W  +  +A    G+             + +L+YG P    + +A  LA E+G  FI +         +G SE     A++++F  A     S++  D+++
BLAST of Vesicle-fusing ATPase vs. Ensembl Nematostella
Match: EDO36218 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ61])

HSP 1 Score: 160.999 bits (406), Expect = 6.376e-41
Identity = 128/421 (30.40%), Postives = 205/421 (48.69%), Query Frame = 2
             N +G   +GG  ++ +QI +   L  L  P+  + +G+K  RGILL+GPPGTGKTL AR +     A    ++NGP I+ K  GESE+N+RK F +AE        +++  II  DEIDAI   R    G   V+  +V+QLL  MDG++Q ++++++  TNR + +D AL R GR   ++++ +P   GRL+I  IHTK ++    L DD+DL+++AA T  Y G+++ ++   A      EK D    +   I  E L S  ++   F +A+                     D+  L G    +LQE     L+++  +        G+             K +L YG P  G + +A  +A E    FI +     +    G SE      ++ +FD A  A   V+  D+++ +

HSP 2 Score: 135.576 bits (340), Expect = 7.309e-33
Identity = 87/240 (36.25%), Postives = 132/240 (55.00%), Query Frame = 2
            PN  ++ IG + G+  E  ++ +        P +F++  G+   +G+L YGPPG GKTL A+ I     A    I  GP +L  + GESEAN+R +F  A          +A  ++ FDE+D+I K+RG   G      D V+NQ+L +MDG+    N+ IIG TNR D+ID A+LRPGR+   I +PLP    R  I + + +    K+ +A D+DL  +A +T  +SGA++  +   A
BLAST of Vesicle-fusing ATPase vs. Ensembl Nematostella
Match: EDO49524 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGH4])

HSP 1 Score: 149.058 bits (375), Expect = 5.162e-39
Identity = 96/239 (40.17%), Postives = 135/239 (56.49%), Query Frame = 2
            VGGLD++  +I K      +  PE  E LGI   +G+LLYGPPGTGKTL AR +         + V+G  ++ K++GE    +R+LF         M  + A  II  DEID+I  +R  G   G S VQ T++ +LL ++DG E   NI +I  TNR D++D ALLRPGR+  +IE P P++  R  I +IH++K+     L   I+LK++A L    SGAEI+ V   A   A  E+
BLAST of Vesicle-fusing ATPase vs. Ensembl Nematostella
Match: EDO37473 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFJ3])

HSP 1 Score: 137.117 bits (344), Expect = 1.351e-34
Identity = 87/237 (36.71%), Postives = 129/237 (54.43%), Query Frame = 2
            D     +GG  E+  ++ +      L P  FV  LGI+  +G+LL+GPPGTGKTL AR +    +A   +++ G  ++ KYVGE    +R+LF        +M       I+ FDEIDAI  AR      G + VQ T++ +L+ ++DG +   NI ++  TNR D +D AL+RPGR+  ++E  LP   GR  IF+IH + +     +  DI  + LA L  N +GAEI +V   A
BLAST of Vesicle-fusing ATPase vs. Ensembl Medaka
Match: NSF (vesicle-fusing ATPase [Source:NCBI gene;Acc:101155094])

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 292/668 (43.71%), Postives = 428/668 (64.07%), Query Frame = 2
            DE S TN    +  D  L   + +TV TT ++K++F      +V  G +  +  QRKW    IG+ +E   Y+F         +     F++  S+   P DSDK+A ++L++F++   +  Q L+F++    F   +  I+ +D            K  +I+ G++  N+   F++   S   L G+ K + A   +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPP+ VE++G KHV+GILL+GPPG GKTL ARQIGKMLNAREPK+VNGP IL+KYVGESEANIRKLFADAEEE K++G  S LHIIIFDE+DAICK RG  +  + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+ID+AL+RPGR  V++E+ LP + GR+QI  IHT K+R  N+LA D+D+KELAA TKNYSGAE+E +V AA + A +        + + +E  +  ++ R  F+ ++++D+K  +G + +D   +  N ++KW   ++  L    LL++  K +D      +L+ G P +G +++A  +A+++ F FI++CS   MIG SE ++C AIKK+FDDA K+  S +++DD+ERL+DY  IGPRFS  ++  L+ ++    PK +K+LIIGTT     + E+E   AF    I +P I T  +++
BLAST of Vesicle-fusing ATPase vs. Ensembl Medaka
Match: NSF (vesicle-fusing ATPase [Source:NCBI gene;Acc:101155094])

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 292/668 (43.71%), Postives = 428/668 (64.07%), Query Frame = 2
            DE S TN    +  D  L   + +TV TT ++K++F      +V  G +  +  QRKW    IG+ +E   Y+F         +     F++  S+   P DSDK+A ++L++F++   +  Q L+F++    F   +  I+ +D            K  +I+ G++  N+   F++   S   L G+ K + A   +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPP+ VE++G KHV+GILL+GPPG GKTL ARQIGKMLNAREPK+VNGP IL+KYVGESEANIRKLFADAEEE K++G  S LHIIIFDE+DAICK RG  +  + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+ID+AL+RPGR  V++E+ LP + GR+QI  IHT K+R  N+LA D+D+KELAA TKNYSGAE+E +V AA + A +        + + +E  +  ++ R  F+ ++++D+K  +G + +D   +  N ++KW   ++  L    LL++  K +D      +L+ G P +G +++A  +A+++ F FI++CS   MIG SE ++C AIKK+FDDA K+  S +++DD+ERL+DY  IGPRFS  ++  L+ ++    PK +K+LIIGTT     + E+E   AF    I +P I T  +++
BLAST of Vesicle-fusing ATPase vs. Ensembl Medaka
Match: NSF (vesicle-fusing ATPase [Source:NCBI gene;Acc:101155094])

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 292/668 (43.71%), Postives = 428/668 (64.07%), Query Frame = 2
            DE S TN    +  D  L   + +TV TT ++K++F      +V  G +  +  QRKW    IG+ +E   Y+F         +     F++  S+   P DSDK+A ++L++F++   +  Q L+F++    F   +  I+ +D            K  +I+ G++  N+   F++   S   L G+ K + A   +INP+W+F  +G+GGLD+EFS IF+ AF SR+FPP+ VE++G KHV+GILL+GPPG GKTL ARQIGKMLNAREPK+VNGP IL+KYVGESEANIRKLFADAEEE K++G  S LHIIIFDE+DAICK RG  +  + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+ID+AL+RPGR  V++E+ LP + GR+QI  IHT K+R  N+LA D+D+KELAA TKNYSGAE+E +V AA + A +        + + +E  +  ++ R  F+ ++++D+K  +G + +D   +  N ++KW   ++  L    LL++  K +D      +L+ G P +G +++A  +A+++ F FI++CS   MIG SE ++C AIKK+FDDA K+  S +++DD+ERL+DY  IGPRFS  ++  L+ ++    PK +K+LIIGTT     + E+E   AF    I +P I T  +++
BLAST of Vesicle-fusing ATPase vs. Ensembl Medaka
Match: nsfb (vesicle-fusing ATPase [Source:NCBI gene;Acc:101174468])

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 308/734 (41.96%), Postives = 452/734 (61.58%), Query Frame = 2
              K  K   DE S TN    N  +     E  +TV     +F+F   K   V  GC+  +  QRKW    +G+  +   Y F ++   ++ + +E+D   K      P DSDK+A + ++RF +   T  Q L+F++    F   +  I+ +D       + +  ++ + G++ +N+   F++   S  +L G+ K       +I+P+W+F  +G+GGLD+EFS IF+ AF SR+FP + +E++G KHV+GILLYGPPG GKTL ARQIGKML AREPKIVNGP IL+KYVGESEANIRKLFADAEEE K++G  S LHIIIFDEIDAICK RG+++G + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+IDEALLRPGR+ V++E+ LP + GR+QI  IHT K+R+ N+LA D+D+KELA  TKNYSGAE+E +V AA + A +        + + I+  +   ++R  F+ A+++D+K  +G + +D   +  N +++W   +S  L    LL++  K +D      +L+ G   +G +++A  +++++ F FI++CS   MIGFSE A+C AIKKIF+DA K+  S +++DD+ERL+DY  IGPRFS  ++  L+ ++    PK +K+LIIGTT     + E+E   AF    + IP I    +++  L   D + + +   I   L+      L IGIK L+   +    +D   RV + L  LK
BLAST of Vesicle-fusing ATPase vs. Ensembl Medaka
Match: nsfb (vesicle-fusing ATPase [Source:NCBI gene;Acc:101174468])

HSP 1 Score: 421.779 bits (1083), Expect = 2.469e-138
Identity = 222/492 (45.12%), Postives = 314/492 (63.82%), Query Frame = 2
            +  +   K   DE S TN    N       KE+ +TV     +F+F   K   V  GC+  +  Q      +   C +        Y F ++   ++ + +E+D   K      P DSDK+A + ++RF +   T  Q L+F++    F   +  I+ +D       + +  ++ + G++ +N+   F++   S  +L G+ K       +I+P+W+F  +G+GGLD+EFS IF+ AF SR+FP + +E++G KHV+GILLYGPPG GKTL ARQIGKML AREPKIVNGP IL+KYVGESEANIRKLFADAEEE K++G  S LHIIIFDEIDAICK RG+++G + V DTVVNQLL+K+DGVEQLNNIL+IGMTNR D+IDEALLRPGR+ V++E+ LP + GR+QI  IHT K+R+ N+LA D+D+KELA  TKNYSGAE+E +V AA + A +        + + I+  +   ++R  F+ A+++D+K
BLAST of Vesicle-fusing ATPase vs. Planmine SMEST
Match: SMESG000019983.1 (SMESG000019983.1)

HSP 1 Score: 1447.18 bits (3745), Expect = 0.000e+0
Identity = 736/736 (100.00%), Postives = 736/736 (100.00%), Query Frame = 2
BLAST of Vesicle-fusing ATPase vs. Planmine SMEST
Match: SMESG000047180.1 (SMESG000047180.1)

HSP 1 Score: 157.147 bits (396), Expect = 1.453e-41
Identity = 100/239 (41.84%), Postives = 142/239 (59.41%), Query Frame = 2
            N D+NSIG  GL+E+  ++ +   L  L  PE    +GIK  +G+LLYGPPGTGKTL AR +   L+A   K+V+  SI+DK++GES   IR++FA A+E            +I  DEIDAI   R N   S    +Q T++ +LL +MDG + L  + II  TNR D +D ALLRPGR+  +IE+PLP + GRL I +IH+ K+ +      +ID   L  L+  ++GA++  V   A
BLAST of Vesicle-fusing ATPase vs. Planmine SMEST
Match: SMESG000009924.1 (SMESG000009924.1)

HSP 1 Score: 161.77 bits (408), Expect = 6.581e-41
Identity = 133/438 (30.37%), Postives = 210/438 (47.95%), Query Frame = 2
            E   V   + +   N +G   +GG  ++ +QI +   L  L  P+  + +G+K  RGILLYGPPGTGKTL AR +     A E      ++NGP I+ K  GESE+N+RK F +AE        +++  II  DE+DAI   R    G   V+  +V+QLL  MDG++Q ++++++  TNR + ID AL R GR   ++++ +P   GRL+I  IHTK +R    L DD+DL+++A+ T  + GA++ A+   A       K D    +   I  E L S  +  + F +A+                     D+  L G    +LQE     L+++  +        G+             K +L YG P  G + +A  +A E    FI +     +    G SE      ++ IFD A +A   V+  D+++ +

HSP 2 Score: 144.436 bits (363), Expect = 2.630e-35
Identity = 102/308 (33.12%), Postives = 166/308 (53.90%), Query Frame = 2
            PN  +  IG + G+  E  ++ +        P +F++  G+   +G+L YGPPG GKTL A+ I     A    I  GP +L  + GESEAN+R +F  A         Q+A  ++ FDE+D+I K+RG   G      D V+NQLL +MDG+    N+ IIG TNR D+ID A+LRPGR+   I +PLP +  R+QI + + +    K+ +A D+D+  +A +T  +SGA+            I   + A +  A+D++    KG     +D+    +I R+HF  A+ +  +++    D+D+++++
BLAST of Vesicle-fusing ATPase vs. Planmine SMEST
Match: SMESG000032352.1 (SMESG000032352.1)

HSP 1 Score: 153.295 bits (386), Expect = 2.836e-40
Identity = 93/231 (40.26%), Postives = 136/231 (58.87%), Query Frame = 2
            +GGLD++  +I +   LS +  PE  E LGI H +G+LLYGPPGTGKTL AR +    +    + V+G  ++ KY+GE    +R +F        KM  + +  II  DEID+I  +R  G     S VQ T++ +LL ++DG +  NNI II  TNR D++D ALLRPGR+  +IE P P++  RL+I +IH++++  K      IDL+ +A      SGAE++ V   A
BLAST of Vesicle-fusing ATPase vs. Planmine SMEST
Match: SMESG000016085.1 (SMESG000016085.1)

HSP 1 Score: 159.458 bits (402), Expect = 3.285e-40
Identity = 95/230 (41.30%), Postives = 133/230 (57.83%), Query Frame = 2
            VGGLD    ++ +        P +F++  G+   +G+L YGPPG GKTL A+ I     A    I  GP +L  + GESEANIR+LF  A         Q+A  I+ FDE+D+I K+RG+  S G    D V+NQLL +MDG+    N+ IIG TNR D+ID A+LRPGR+   I +PLP +  R+QIF    K    K+ +A D+DL  L+ +T  +SGA++  +   A

HSP 2 Score: 158.688 bits (400), Expect = 6.389e-40
Identity = 141/463 (30.45%), Postives = 225/463 (48.60%), Query Frame = 2
             N IG   +GG  ++ +QI +   L  L  P+  + +G+K   GILLYGPPGTGKTL AR +     A E      ++NGP I+ K  GESE+N+RK F +AE        +++  II  DEIDAI   R    G   V+  +V+QLL  MDG++Q ++++++  TNR + ID AL R GR   ++++ +P   GRL+I  IHTK +R    L +++DL+ +A  T  + GA++ A+   A       K D    +   I  E L S  +  + F +A+D  +  AL               G  D+  +E +E  L+++  +        G+             K +L YG P  G + +A  +A E    FI +     +    G SE      I+++FD A +A   ++  D+++ +       +S G   S  ++N L+  ++    K K + IIG T
The following BLAST results are available for this feature:
BLAST of Vesicle-fusing ATPase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NSF0.000e+044.18N-ethylmaleimide sensitive factor, vesicle fusing ... [more]
NSF0.000e+044.18N-ethylmaleimide sensitive factor, vesicle fusing ... [more]
NSF0.000e+044.18N-ethylmaleimide sensitive factor, vesicle fusing ... [more]
NSF0.000e+044.18N-ethylmaleimide sensitive factor, vesicle fusing ... [more]
NSF0.000e+044.18N-ethylmaleimide sensitive factor, vesicle fusing ... [more]
back to top
BLAST of Vesicle-fusing ATPase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nsf-10.000e+042.17Vesicle-fusing ATPase [Source:UniProtKB/Swiss-Pro... [more]
nsf-10.000e+042.17Vesicle-fusing ATPase [Source:UniProtKB/Swiss-Pro... [more]
nsf-10.000e+042.17Vesicle-fusing ATPase [Source:UniProtKB/Swiss-Pro... [more]
cdc-48.15.564e-3935.60Transitional endoplasmic reticulum ATPase homolog ... [more]
cdc-48.32.192e-3736.84ATPase family protein 2 homolog [Source:UniProtKB... [more]
back to top
BLAST of Vesicle-fusing ATPase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
comt0.000e+044.92gene:FBgn0000346 transcript:FBtr0073754[more]
comt0.000e+044.92gene:FBgn0000346 transcript:FBtr0333329[more]
Nsf20.000e+043.30gene:FBgn0266464 transcript:FBtr0344766[more]
Nsf20.000e+043.30gene:FBgn0266464 transcript:FBtr0344767[more]
Nsf20.000e+043.30gene:FBgn0266464 transcript:FBtr0082883[more]
back to top
BLAST of Vesicle-fusing ATPase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nsfa0.000e+042.78N-ethylmaleimide-sensitive factor a [Source:ZFIN;A... [more]
nsfb0.000e+043.84N-ethylmaleimide-sensitive factor b [Source:ZFIN;A... [more]
nsfb0.000e+044.16N-ethylmaleimide-sensitive factor b [Source:ZFIN;A... [more]
nsfb0.000e+044.16N-ethylmaleimide-sensitive factor b [Source:ZFIN;A... [more]
nsfb0.000e+044.16N-ethylmaleimide-sensitive factor b [Source:ZFIN;A... [more]
back to top
BLAST of Vesicle-fusing ATPase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fosl20.000e+041.39FOS-like antigen 2 [Source:Xenbase;Acc:XB-GENE-625... [more]
fosl20.000e+041.51FOS-like antigen 2 [Source:Xenbase;Acc:XB-GENE-625... [more]
fosl20.000e+041.34FOS-like antigen 2 [Source:Xenbase;Acc:XB-GENE-625... [more]
fosl20.000e+041.51FOS-like antigen 2 [Source:Xenbase;Acc:XB-GENE-625... [more]
fosl20.000e+041.51FOS-like antigen 2 [Source:Xenbase;Acc:XB-GENE-625... [more]
back to top
BLAST of Vesicle-fusing ATPase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nsf0.000e+044.48N-ethylmaleimide sensitive fusion protein [Source:... [more]
Vcp2.135e-4130.94valosin containing protein [Source:MGI Symbol;Acc:... [more]
Psmc51.001e-3839.33protease (prosome, macropain) 26S subunit, ATPase ... [more]
Psmc11.362e-3838.96protease (prosome, macropain) 26S subunit, ATPase ... [more]
Spata57.422e-3839.36spermatogenesis associated 5 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Vesicle-fusing ATPase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P46461|NSF1_DROME0.000e+044.92Vesicle-fusing ATPase 1 OS=Drosophila melanogaster... [more]
sp|P54351|NSF2_DROME0.000e+043.30Vesicle-fusing ATPase 2 OS=Drosophila melanogaster... [more]
sp|Q9QUL6|NSF_RAT0.000e+044.48Vesicle-fusing ATPase OS=Rattus norvegicus OX=1011... [more]
sp|P46460|NSF_MOUSE0.000e+044.48Vesicle-fusing ATPase OS=Mus musculus OX=10090 GN=... [more]
sp|P18708|NSF_CRIGR0.000e+044.33Vesicle-fusing ATPase OS=Cricetulus griseus OX=100... [more]
back to top
BLAST of Vesicle-fusing ATPase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C1LF610.000e+043.59NEM-sensitive fusion protein 2 OS=Schistosoma japo... [more]
A0A0N4ZGZ30.000e+045.11Uncharacterized protein OS=Parastrongyloides trich... [more]
A0A0K0DX310.000e+044.67Uncharacterized protein OS=Strongyloides stercoral... [more]
G4VMW90.000e+043.18Putative vesicular-fusion protein nsf OS=Schistoso... [more]
A0A267EGJ40.000e+042.68Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Vesicle-fusing ATPase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nsfa0.000e+044.38vesicle-fusing ATPase [Source:NCBI gene;Acc:103037... [more]
nsfa0.000e+044.38vesicle-fusing ATPase [Source:NCBI gene;Acc:103037... [more]
nsfa0.000e+044.38vesicle-fusing ATPase [Source:NCBI gene;Acc:103037... [more]
nsfb0.000e+043.46N-ethylmaleimide-sensitive factor b [Source:ZFIN;A... [more]
nsfa0.000e+043.70vesicle-fusing ATPase [Source:NCBI gene;Acc:103037... [more]
back to top
BLAST of Vesicle-fusing ATPase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nsfa1.674e-11336.10N-ethylmaleimide-sensitive factor a [Source:ZFIN;A... [more]
psmc54.034e-3939.33proteasome 26S subunit, ATPase 5 [Source:ZFIN;Acc:... [more]
ENSPMAT00000010299.12.247e-3535.93pep scaffold:Pmarinus_7.0:GL479893:343:6144:1 gene... [more]
ENSPMAT00000001244.17.102e-3537.97pep scaffold:Pmarinus_7.0:GL482260:6416:9764:-1 ge... [more]
nvl9.547e-3437.65nuclear VCP like [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
back to top
BLAST of Vesicle-fusing ATPase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SEC182.245e-16337.30AAA ATPase and SNARE disassembly chaperone; requir... [more]
CDC481.448e-4632.97AAA ATPase; subunit of polyUb-selective segregase ... [more]
AFG21.040e-3830.35ATPase of the CDC48/PAS1/SEC18 (AAA) family, forms... [more]
RPT64.479e-3839.33ATPase of the 19S regulatory particle of the 26S p... [more]
PEX65.969e-3838.62AAA-peroxin; heterodimerizes with AAA-peroxin Pex1... [more]
back to top
BLAST of Vesicle-fusing ATPase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO362240.000e+042.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO390062.162e-4240.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362186.376e-4130.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495245.162e-3940.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374731.351e-3436.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Vesicle-fusing ATPase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NSF0.000e+043.71vesicle-fusing ATPase [Source:NCBI gene;Acc:101155... [more]
NSF0.000e+043.71vesicle-fusing ATPase [Source:NCBI gene;Acc:101155... [more]
NSF0.000e+043.71vesicle-fusing ATPase [Source:NCBI gene;Acc:101155... [more]
nsfb0.000e+041.96vesicle-fusing ATPase [Source:NCBI gene;Acc:101174... [more]
nsfb2.469e-13845.12vesicle-fusing ATPase [Source:NCBI gene;Acc:101174... [more]
back to top
BLAST of Vesicle-fusing ATPase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
back to top
The following sequences are available for this feature:

transcript sequence

>SMED30019484 ID=SMED30019484|Name=Vesicle-fusing ATPase|organism=Schmidtea mediterranea sexual|type=transcript|length=2372bp
back to top

protein sequence of SMED30019484-orf-1

>SMED30019484-orf-1 ID=SMED30019484-orf-1|Name=SMED30019484-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=165bp
back to top

protein sequence of SMED30019484-orf-2

>SMED30019484-orf-2 ID=SMED30019484-orf-2|Name=SMED30019484-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=737bp
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
GO:0005765lysosomal membrane
GO:0005886plasma membrane
GO:0043209myelin sheath
GO:0070062extracellular exosome
Vocabulary: molecular function
GO:0042802identical protein binding
GO:0044877macromolecular complex binding
GO:0005524ATP binding
GO:0000149SNARE binding
GO:0000166nucleotide binding
GO:0005515protein binding
GO:0016787hydrolase activity
GO:0016887ATPase activity
GO:0017075syntaxin-1 binding
GO:0019901protein kinase binding
GO:0019905syntaxin binding
GO:0030165PDZ domain binding
GO:0032403protein complex binding
GO:0035255ionotropic glutamate receptor binding
GO:0042623ATPase activity, coupled
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
Vocabulary: INTERPRO
Vocabulary: biological process
GO:0001921positive regulation of receptor recycling
GO:0006813potassium ion transport
GO:0006886intracellular protein transport
GO:0015031protein transport
GO:0035494SNARE complex disassembly
GO:0045732positive regulation of protein catabolic process
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 526..731
e-value: 1.3
score: 12.4
coord: 243..390
e-value: 1.4E-16
score: 71.1
IPR041569AAA ATPase, AAA+ lid domainPFAMPF17862AAA_lid_3coord: 414..452
e-value: 1.5E-10
score: 40.7
NoneNo IPR availableGENE3DG3DSA: 200..388
e-value: 8.1E-50
score: 171.0
NoneNo IPR availableGENE3DG3DSA:3.10.330.10coord: 85..186
e-value: 2.2E-11
score: 45.9
NoneNo IPR availableGENE3DG3DSA: 488..660
e-value: 4.2E-23
score: 83.9
NoneNo IPR availableGENE3DG3DSA: 389..479
e-value: 1.9E-15
score: 58.5
NoneNo IPR availableGENE3DG3DSA: 2..82
e-value: 2.3E-12
score: 48.5
NoneNo IPR availableCDDcd00009AAAcoord: 526..654
e-value: 7.88321E-4
score: 38.6663
NoneNo IPR availableCDDcd00009AAAcoord: 245..388
e-value: 6.34584E-22
score: 90.6683
IPR003959ATPase, AAA-type, corePFAMPF00004AAAcoord: 530..643
e-value: 3.7E-8
score: 33.9
coord: 247..388
e-value: 2.1E-39
score: 135.0
IPR039812Vesicle-fusing ATPasePANTHERPTHR23078VESICULAR-FUSION PROTEIN NSFcoord: 10..709
IPR003960ATPase, AAA-type, conserved sitePROSITEPS00674AAAcoord: 358..376
IPR009010Aspartate decarboxylase-like domain superfamilySUPERFAMILYSSF50692ADC-likecoord: 3..85
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 211..480
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 495..716
IPR029067CDC48 domain 2-like superfamilySUPERFAMILYSSF54585Cdc48 domain 2-likecoord: 90..189