F-box only protein 10

Overview
NameF-box only protein 10
Smed IDSMED30019474
Length (bp)3413
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of F-box only protein 10 (SMED30019474) t-SNE clustered cells

Violin plots show distribution of expression levels for F-box only protein 10 (SMED30019474) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of F-box only protein 10 (SMED30019474) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for F-box only protein 10 (SMED30019474) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019474

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 26

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30019474h1SMcG0002006 Contig5042uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019474h1SMcG0002006 Contig5042newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019474h1SMcG0005878 Contig5042uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019474h1SMcG0005878 Contig5042newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019474h1SMcG0002006 Contig5042uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019474h1SMcG0002006 Contig5042newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019474h1SMcG0005878 Contig5042uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019474h1SMcG0005878 Contig5042newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
head regionSMED30019474h1SMcG0005878 SmedASXL_016706SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30019474h1SMcG0005878 SmedASXL_016706SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30019474h1SMcG0005878 dd_Smed_v4_14221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30019474h1SMcG0005878 dd_Smed_v4_14221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30019474h1SMcG0005878 dd_Smed_v6_14221_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30019474h1SMcG0005878 dd_Smed_v6_14221_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
whole organismSMED30019474h1SMcG0005878 Contig29097newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30019474h1SMcG0005878 Contig29097uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30019474h1SMcG0005878 Contig29097newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30019474h1SMcG0005878 Contig29097uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
oocyteSMED30019474h1SMcG0005878 Contig46359newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30019474h1SMcG0005878 Contig46359uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30019474h1SMcG0005878 Contig46359newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30019474h1SMcG0005878 Contig46359uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30019474h1SMcG0005878 Contig46359newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30019474h1SMcG0005878 Contig46359uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30019474h1SMcG0005878 Contig46359newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30019474h1SMcG0005878 Contig46359uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of F-box only protein 10 vs. Ensembl Human
Match: FBXO10 (F-box protein 10 [Source:HGNC Symbol;Acc:HGNC:13589])

HSP 1 Score: 135.961 bits (341), Expect = 1.068e-31
Identity = 85/306 (27.78%), Postives = 142/306 (46.41%), Query Frame = 1
Query:  121 LSADLLLLIMEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDE-KTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPNGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGINSQMTIYFDCDT--SAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNLNNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFLLNQIKKSLPF 1029
            L  +L  +I+ YL   DL RCS V  +WY +I  LD+T W++L L    G    R                       N   + D E ++W+E ++ H++    W   + ++ +  C  + R   ++  + VGP G  + S+  A++    Y  +++ PG Y+EQ +I + +P +++G G   ++ +    D   S  R+CNL   P WFS IM +   G  Q ++C+  NG + V  PG   +++C   N  I         +E+CEF  +   N  + VEG P  ++     +LL  IK S  F
Sbjct:    6 LPLELWRMILAYLHLPDLGRCSLVCRAWYELILSLDSTRWRQLCL----GCTECRHP---------------------NWPNQPDVEPESWREAFKQHYLASKTWTKNALDLESSICFSLFRRRRERRTLSVGP-GREFDSLGSALAMASLYDRIVLFPGVYEEQGEIILKVPVEIVGQGKLGEVALLASIDQHCSTTRLCNLVFTPAWFSPIMYKTTSGHVQFDNCNFENGHIQVHGPGTCQVKFCTFKNTHIFLHNVPLCVLENCEFVGSE--NNSVTVEGHPSADKNWAYKYLLGLIKSSPTF 283          

HSP 2 Score: 122.479 bits (306), Expect = 1.697e-27
Identity = 94/374 (25.13%), Postives = 165/374 (44.12%), Query Frame = 1
Query: 1453 EVKQIMNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNR-VGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDL----NRISGDEKWICRKHGLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISLV 2556
            E   + N++ G L+  C F   K  V         +      +    +R    SK  +  N ++    + I L+     +I GN IY   E  ++IRK ++P +L N+IH   + GI  + N  G +  N I  N+  GI IL+  NP++  N I    + GI +NE    ++ +N+I +N+   + IR+   PV+  NLI   ++DG+++ D  KG I  N I  N   G+ +++  LP++  N +  N  +G+ +                          +     SSE       R   +F++ DGD       +  ++  + R   +  +E NSI  N   G+   ++  + ++ N IHAN + GI++ 
Sbjct:  419 EAMALANSVQGCLIRKCLFRDGKGGVFVCSHGRAKMEGNIFRNLTYAVRCIHNSKIIMLRNDIYRCRASGIFLRLEGGGLIAGNNIYHNAEAGVDIRKKSNPLILCNQIHHGLRSGIVVLGNGKGIIRNNQIFSNKEAGIYILYHGNPVVSGNHIFKGRAAGIAVNENGKGLITENVIRENQWGGVDIRRGGIPVLRSNLICFGYSDGVVVGDEGKGLIEGNTIYANKGCGVWMMSSSLPHVTSNHVSYNGLYGVAV--------------------------FSQKDGSSELPRGH--RAQENFSE-DGDAILWETELEKEDDPLRRPITIALVESNSINHNGASGLYVQSSEALHVITNVIHANGDRGITVA 763          
BLAST of F-box only protein 10 vs. Ensembl Human
Match: FBXO10 (F-box protein 10 [Source:HGNC Symbol;Acc:HGNC:13589])

HSP 1 Score: 133.265 bits (334), Expect = 1.302e-31
Identity = 85/306 (27.78%), Postives = 142/306 (46.41%), Query Frame = 1
Query:  121 LSADLLLLIMEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDE-KTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPNGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGINSQMTIYFDCDT--SAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNLNNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFLLNQIKKSLPF 1029
            L  +L  +I+ YL   DL RCS V  +WY +I  LD+T W++L L    G    R                       N   + D E ++W+E ++ H++    W   + ++ +  C  + R   ++  + VGP G  + S+  A++    Y  +++ PG Y+EQ +I + +P +++G G   ++ +    D   S  R+CNL   P WFS IM +   G  Q ++C+  NG + V  PG   +++C   N  I         +E+CEF  +   N  + VEG P  ++     +LL  IK S  F
Sbjct:    6 LPLELWRMILAYLHLPDLGRCSLVCRAWYELILSLDSTRWRQLCL----GCTECRHP---------------------NWPNQPDVEPESWREAFKQHYLASKTWTKNALDLESSICFSLFRRRRERRTLSVGP-GREFDSLGSALAMASLYDRIVLFPGVYEEQGEIILKVPVEIVGQGKLGEVALLASIDQHCSTTRLCNLVFTPAWFSPIMYKTTSGHVQFDNCNFENGHIQVHGPGTCQVKFCTFKNTHIFLHNVPLCVLENCEFVGSE--NNSVTVEGHPSADKNWAYKYLLGLIKSSPTF 283          

HSP 2 Score: 63.5438 bits (153), Expect = 1.589e-9
Identity = 45/150 (30.00%), Postives = 71/150 (47.33%), Query Frame = 1
Query: 1735 EIRKNTSPNVLANKIHS---------NGKCGISFVSNSGRVEFNDICFNRV--GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLL 2151
            E++K+     LAN +           +GK G+ FV + GR +     F  +   +  +H++  I+  N I    + GI +      ++  N IY N E+ + IRK S P+I CN I+     GI++    KG I NN I  N + GI +L
Sbjct:  413 ELQKDKEAMALANSVQGCLIRKCLFRDGKGGV-FVCSHGRAKMEGNIFRNLTYAVRCIHNSKIIMLRNDIYRCRASGIFLRLEGGGLIAGNNIYHNAEAGVDIRKKSNPLILCNQIHHGLRSGIVVLGNGKGIIRNNQIFSNKEAGIYIL 561          

HSP 3 Score: 58.151 bits (139), Expect = 7.192e-8
Identity = 42/151 (27.81%), Postives = 68/151 (45.03%), Query Frame = 1
Query: 1453 EVKQIMNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNR-VGINILHSANPIIR 1899
            E   + N++ G L+  C F   K  V         +      +    +R    SK  +  N ++    + I L+     +I GN IY   E  ++IRK ++P +L N+IH   + GI  + N  G +  N I  N+  GI IL+  NP++R
Sbjct:  419 EAMALANSVQGCLIRKCLFRDGKGGVFVCSHGRAKMEGNIFRNLTYAVRCIHNSKIIMLRNDIYRCRASGIFLRLEGGGLIAGNNIYHNAEAGVDIRKKSNPLILCNQIHHGLRSGIVVLGNGKGIIRNNQIFSNKEAGIYILYHGNPVVR 569          
BLAST of F-box only protein 10 vs. Ensembl Human
Match: FBXO11 (F-box protein 11 [Source:HGNC Symbol;Acc:HGNC:13590])

HSP 1 Score: 95.5153 bits (236), Expect = 3.480e-19
Identity = 60/211 (28.44%), Postives = 104/211 (49.29%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNRV--GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI 2217
            I++   S   + HN++H+     I +    + VI  NE+Y      + +   ++P +  N+IHS  + G+ F  N  G +E NDI +N +  G+ I   +NP IR N I    + GI++    +  ++DN I+ N  + +WI+  S P +  N I+   + GI + +G +G +  N I  N + G+L+     P +  N+I      GI I
Sbjct:  574 IQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDI-YNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGCIEDNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPILRKNRIFDGFAAGIEI 783          

HSP 2 Score: 80.1073 bits (196), Expect = 1.693e-14
Identity = 60/241 (24.90%), Postives = 103/241 (42.74%), Query Frame = 1
Query: 1498 NCNFSRSKFV-VNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGIS-FVSNSGRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGI 2211
            +CN  R++         +N  +V CE+H                     H  +G  I +        I N+IY      + I  N+ P +  N I +  + G+  F    G +E NDI  N + GI I  ++ PI+R N I      GI ++E+   ++++N +Y N  + +W+   S PV+  N I+     G+   D   G + +N I ++  +G+ +     P I  N+I   +  GI
Sbjct:  471 SCNIHRNRIAGFEVKAYANPTVVRCEIH---------------------HGQTG-GIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNSIFNGNQGGVYIFGDGRGLIEGNDIYGNALAGIQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQIRTGSNPKIRRNKIWGGQNGGI 689          

HSP 3 Score: 53.9138 bits (128), Expect = 1.847e-6
Identity = 38/146 (26.03%), Postives = 66/146 (45.21%), Query Frame = 1
Query: 1822 GRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI---ARVIMDNEDI 2247
            G  E N+I  N + GI + +  NPIIR N I      G+   +  +   +   I++NR +   ++ ++ P +    I+     GI + +  +G    N I  N   G+ + +   P I GN I    Q G++I    R +++  DI
Sbjct:  421 GIYEDNEISNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHRNRIAGFEVKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNSIFNGNQGGVYIFGDGRGLIEGNDI 566          
BLAST of F-box only protein 10 vs. Ensembl Human
Match: FBXO11 (F-box protein 11 [Source:HGNC Symbol;Acc:HGNC:13590])

HSP 1 Score: 95.1301 bits (235), Expect = 3.972e-19
Identity = 60/211 (28.44%), Postives = 104/211 (49.29%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNRV--GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI 2217
            I++   S   + HN++H+     I +    + VI  NE+Y      + +   ++P +  N+IHS  + G+ F  N  G +E NDI +N +  G+ I   +NP IR N I    + GI++    +  ++DN I+ N  + +WI+  S P +  N I+   + GI + +G +G +  N I  N + G+L+     P +  N+I      GI I
Sbjct:  490 IQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDI-YNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGCIEDNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPILRKNRIFDGFAAGIEI 699          

HSP 2 Score: 79.7221 bits (195), Expect = 2.117e-14
Identity = 51/193 (26.42%), Postives = 89/193 (46.11%), Query Frame = 1
Query: 1639 MHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGIS-FVSNSGRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGI 2211
            +H+     I +        I N+IY      + I  N+ P +  N I +  + G+  F    G +E NDI  N + GI I  ++ PI+R N I      GI ++E+   ++++N +Y N  + +W+   S PV+  N I+     G+   D   G + +N I ++  +G+ +     P I  N+I   +  GI
Sbjct:  413 IHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNSIFNGNQGGVYIFGDGRGLIEGNDIYGNALAGIQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQIRTGSNPKIRRNKIWGGQNGGI 605          

HSP 3 Score: 53.9138 bits (128), Expect = 1.839e-6
Identity = 38/146 (26.03%), Postives = 66/146 (45.21%), Query Frame = 1
Query: 1822 GRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI---ARVIMDNEDI 2247
            G  E N+I  N + GI + +  NPIIR N I      G+   +  +   +   I++NR +   ++ ++ P +    I+     GI + +  +G    N I  N   G+ + +   P I GN I    Q G++I    R +++  DI
Sbjct:  337 GIYEDNEISNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHRNRIAGFEVKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNSIFNGNQGGVYIFGDGRGLIEGNDI 482          
BLAST of F-box only protein 10 vs. Ensembl Human
Match: FBXO11 (F-box protein 11 [Source:HGNC Symbol;Acc:HGNC:13590])

HSP 1 Score: 86.6557 bits (213), Expect = 1.106e-16
Identity = 62/209 (29.67%), Postives = 102/209 (48.80%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNSGR--VEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGI 2211
            + ++  S   I  N + N +   + +      +I GN+IYG     I+IR N+ P V  NKIH +G+ G  +V   G+  +E N++  N + G+ +   + P++R N I S    G+   +    +L+DN IY +  S + IR  S P I  N I+   N GI++ +   G I +N I DN   G+ +     P +  N+I   +  GI
Sbjct:  320 VWITSNSDPTIRGNSIFNGNQGGVYIFGDGRGLIEGNDIYGNALAGIQIRTNSCPIVRHNKIH-DGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGCIEDNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGI 527          

HSP 2 Score: 85.1149 bits (209), Expect = 3.367e-16
Identity = 51/181 (28.18%), Postives = 92/181 (50.83%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNRV--GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDN 2127
            I++   S   + HN++H+     I +    + VI  NE+Y      + +   ++P +  N+IHS  + G+ F  N  G +E NDI +N +  G+ I   +NP IR N I    + GI++    +  ++DN I+ N  + +WI+  S P +  N I+   + GI + +G +G + N  ++ N
Sbjct:  366 IQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDI-YNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGCIEDNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGICIFNGGRGIVVNFALVKN 545          

HSP 3 Score: 53.5286 bits (127), Expect = 2.175e-6
Identity = 38/149 (25.50%), Postives = 67/149 (44.97%), Query Frame = 1
Query: 1822 GRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI---ARVIMDNEDIISD 2256
            G  E N+I  N + GI + +  NPIIR N I      G+   +  +   +   I++NR +   ++ ++ P +    I+     GI + +  +G    N I  N   G+ + +   P I GN I    Q G++I    R +++  DI  +
Sbjct:  213 GIYEDNEISNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHRNRIAGFEVKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNSIFNGNQGGVYIFGDGRGLIEGNDIYGN 361          
BLAST of F-box only protein 10 vs. Ensembl Celegans
Match: BE0003N10.3 (pep chromosome:WBcel235:III:1045809:1053246:-1 gene:WBGene00015268.1 transcript:BE0003N10.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BE0003N10.3)

HSP 1 Score: 104.76 bits (260), Expect = 1.135e-22
Identity = 77/272 (28.31%), Postives = 132/272 (48.53%), Query Frame = 1
Query: 1492 LMNCN-FSRSKFVVNCL-LESNVVIVNCEMHD--CGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIY--------------GMVE---------GAIEIRKNTSPNVLANKIHSNGKCGISFV-SNSGRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIA 2220
              NC  ++  KF +     ++N  +  CE+H    G I      +  F+  NR+H++   AI +  G+  ++  NEI+              G++E           I +     P +  N +HS  + G+ F    SG +E N+I  N + G+ I   ANP +  N I  NN  G++++E  +   ++N I+ N  +N++I+  + PVI  N I+ +   GI + DG KG I +N I DN + G+L+L+   P + GN+I  N+  GI ++
Sbjct:  330 FQNCQIYANQKFAIELKSAQANPTVTECEIHHGMSGGICIHEDATGQFL-KNRLHHNEFLAIWISEGANPIVRKNEIFDGKHGGIFVHRYGKGLIEENKVYGNELAGIFVDTGAEPWIRNNHVHSGKQAGVYFYDGGSGVLESNEINGNTLTGVQIRTGANPRVIKNRIW-NNDNGVLVHEAGMGCFEENTIFDNSMTNVFIKTMATPVIRRNKIFGSRGTGISVTDGGKGLIEHNEIFDNAQAGVLVLSDSAPSLRGNRIHGNRSAGIEVS 599          
BLAST of F-box only protein 10 vs. Ensembl Celegans
Match: BE0003N10.3 (pep chromosome:WBcel235:III:1045809:1052783:-1 gene:WBGene00015268.1 transcript:BE0003N10.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BE0003N10.3)

HSP 1 Score: 103.605 bits (257), Expect = 2.361e-22
Identity = 76/272 (27.94%), Postives = 134/272 (49.26%), Query Frame = 1
Query: 1492 LMNCN-FSRSKFVVNCL-LESNVVIVNCEMHD--CGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIY--------------GMVE---------GAIEIRKNTSPNVLANKIHSNGKCGISFV-SNSGRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIA 2220
              NC  ++  KF +     ++N  +  CE+H    G I      +  F+  NR+H++   AI +  G+  ++  NEI+              G++E           I +     P +  N +HS  + G+ F    SG +E N+I  N + G+ I   ANP +  N I +N++ G++++E  +   ++N I+ N  +N++I+  + PVI  N I+ +   GI + DG KG I +N I DN + G+L+L+   P + GN+I  N+  GI ++
Sbjct:  268 FQNCQIYANQKFAIELKSAQANPTVTECEIHHGMSGGICIHEDATGQFL-KNRLHHNEFLAIWISEGANPIVRKNEIFDGKHGGIFVHRYGKGLIEENKVYGNELAGIFVDTGAEPWIRNNHVHSGKQAGVYFYDGGSGVLESNEINGNTLTGVQIRTGANPRVIKNRIWNNDN-GVLVHEAGMGCFEENTIFDNSMTNVFIKTMATPVIRRNKIFGSRGTGISVTDGGKGLIEHNEIFDNAQAGVLVLSDSAPSLRGNRIHGNRSAGIEVS 537          
BLAST of F-box only protein 10 vs. Ensembl Celegans
Match: dre-1 (F-box protein dre-1 [Source:UniProtKB/Swiss-Prot;Acc:Q94251])

HSP 1 Score: 94.3597 bits (233), Expect = 2.787e-19
Identity = 60/212 (28.30%), Postives = 101/212 (47.64%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNRV--GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIA 2220
            I++   S   +  N++H+     I +      +I  NE+YG     I +   +SP +  N+IHS  + G+ F     G +E NDI FN +  G+ I   +NP I  N I    + G+++       L+DN I+ N  + +WI+  S P +  N IY   + G+ + +  KG + +N I  N + G+L+     P +  N++   K  GI I 
Sbjct:  670 IQIRSQSDPIVRLNKIHDGLHGGIYVHEKGRGLIEENEVYGNTLAGIWVTTGSSPILRKNRIHSGKQVGVYFYDQGHGLLEENDI-FNHLYSGVQIRTGSNPKITRNKIWGGQNGGVLVYNGGKGCLEDNEIFDNAMAGVWIKTDSEPTLRRNKIYDGRDGGVCIFNRGKGLLEDNEIFRNAQAGVLISTESNPTLRRNRVFDGKSAGIEIT 880          

HSP 2 Score: 77.411 bits (189), Expect = 4.838e-14
Identity = 54/224 (24.11%), Postives = 98/224 (43.75%), Query Frame = 1
Query: 1546 SNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGIS-FVSNSGRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGI 2211
            +N V++ CE+H                     H  +G     + G     + N IY      I I  ++ P +  N+I +  + G+  F    G +E N+I  N + GI I   ++PI+R N I      GI ++E+   ++++N +Y N  + IW+   S+P++  N I+     G+   D   G +  N I ++  +G+ +     P I  N+I   +  G+
Sbjct:  584 ANPVVIRCEVH---------------------HGYTGGIYVHERG-RGQFMENRIYANAYAGIWITSHSDPTIRKNEIFTGQQGGVYIFGEGRGLIEQNNIYGNALAGIQIRSQSDPIVRLNKIHDGLHGGIYVHEKGRGLIEENEVYGNTLAGIWVTTGSSPILRKNRIHSGKQVGVYFYDQGHGLLEENDIFNHLYSGVQIRTGSNPKITRNKIWGGQNGGV 785          
BLAST of F-box only protein 10 vs. Ensembl Celegans
Match: dre-1 (F-box protein dre-1 [Source:UniProtKB/Swiss-Prot;Acc:Q94251])

HSP 1 Score: 94.3597 bits (233), Expect = 2.902e-19
Identity = 60/212 (28.30%), Postives = 101/212 (47.64%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNRV--GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIA 2220
            I++   S   +  N++H+     I +      +I  NE+YG     I +   +SP +  N+IHS  + G+ F     G +E NDI FN +  G+ I   +NP I  N I    + G+++       L+DN I+ N  + +WI+  S P +  N IY   + G+ + +  KG + +N I  N + G+L+     P +  N++   K  GI I 
Sbjct:  584 IQIRSQSDPIVRLNKIHDGLHGGIYVHEKGRGLIEENEVYGNTLAGIWVTTGSSPILRKNRIHSGKQVGVYFYDQGHGLLEENDI-FNHLYSGVQIRTGSNPKITRNKIWGGQNGGVLVYNGGKGCLEDNEIFDNAMAGVWIKTDSEPTLRRNKIYDGRDGGVCIFNRGKGLLEDNEIFRNAQAGVLISTESNPTLRRNRVFDGKSAGIEIT 794          

HSP 2 Score: 77.411 bits (189), Expect = 4.792e-14
Identity = 54/224 (24.11%), Postives = 98/224 (43.75%), Query Frame = 1
Query: 1546 SNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGIS-FVSNSGRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGI 2211
            +N V++ CE+H                     H  +G     + G     + N IY      I I  ++ P +  N+I +  + G+  F    G +E N+I  N + GI I   ++PI+R N I      GI ++E+   ++++N +Y N  + IW+   S+P++  N I+     G+   D   G +  N I ++  +G+ +     P I  N+I   +  G+
Sbjct:  498 ANPVVIRCEVH---------------------HGYTGGIYVHERG-RGQFMENRIYANAYAGIWITSHSDPTIRKNEIFTGQQGGVYIFGEGRGLIEQNNIYGNALAGIQIRSQSDPIVRLNKIHDGLHGGIYVHEKGRGLIEENEVYGNTLAGIWVTTGSSPILRKNRIHSGKQVGVYFYDQGHGLLEENDIFNHLYSGVQIRTGSNPKITRNKIWGGQNGGV 699          
BLAST of F-box only protein 10 vs. Ensembl Fly
Match: FBXO11 (gene:FBgn0037760 transcript:FBtr0334684)

HSP 1 Score: 103.99 bits (258), Expect = 4.133e-22
Identity = 61/211 (28.91%), Postives = 107/211 (50.71%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNRV--GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI 2217
            I++   S   + HN++H+     I +    + +I  NE+Y      + I   ++P +  N+IHS  + G+ F  N  G++E NDI FN +  G+ I   +NP+IR N I    + G+++    + +L+ N I+ N  + +WI+  S P +  N IY   + GI + +G KG +  N I  N + G+L+     P +  N+I   +  G+ I
Sbjct:  829 IQIRTNSDPIVRHNKIHHGQHGGIYVHEKGQGLIEENEVYSNTLAGVWITTGSTPVLRRNRIHSGKQVGVYFYDNGHGKLEDNDI-FNHLYSGVQIRTGSNPVIRGNKIWGGQNGGVLVYNGGLGLLEQNEIFDNAMAGVWIKTDSNPTLKRNKIYDGRDGGICIFNGGKGILEENDIFRNTQAGVLISTQSHPILRRNRIYDGQAAGVEI 1038          

HSP 2 Score: 87.8113 bits (216), Expect = 3.751e-17
Identity = 77/270 (28.52%), Postives = 123/270 (45.56%), Query Frame = 1
Query: 1546 SNVVIVNCEMH--DCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIY--------------GMVE---------GAIEIRKNTSPNVLANKIHSNGKCGISFVSNSGR--VEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI---ARVIMDNEDIISDEQ 2262
            +N  +V CE+H    G I         FI  NR+H+++   + +   S   I  NEIY              G++E           I+IR N+ P V  NKIH +G+ G  +V   G+  +E N++  N + G+ I   + P++R N I S    G+   +     L+DN I+ +  S + IR  S PVI  N I+   N G+++ +G  G +  N I DN   G+ +     P +  N+I   +  GI I    + I++  DI  + Q
Sbjct:  743 ANPTVVKCEIHHGQTGGIYVHENGLGQFI-ENRIHSNNFAGVWITSNSNPTIRKNEIYNGHQGGVYIFGEGRGLIEHNNIYGNALAGIQIRTNSDPIVRHNKIH-HGQHGGIYVHEKGQGLIEENEVYSNTLAGVWITTGSTPVLRRNRIHSGKQVGVYFYDNGHGKLEDNDIFNHLYSGVQIRTGSNPVIRGNKIWGGQNGGVLVYNGGLGLLEQNEIFDNAMAGVWIKTDSNPTLKRNKIYDGRDGGICIFNGGKGILEENDIFRNTQ 1010          

HSP 3 Score: 83.5741 bits (205), Expect = 9.693e-16
Identity = 57/223 (25.56%), Postives = 100/223 (44.84%), Query Frame = 1
Query: 1618 AFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS------------------------GRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGI 2211
             +   N +HN+      +K G+   ++  EI+    G I + +N     + N+IHSN   G+   SNS                        G +E N+I  N + GI I  +++PI+R N I      GI ++E+   ++++N +Y N  + +WI   S PV+  N I+     G+   D   G + +N I ++  +G+ +     P I GN+I   +  G+
Sbjct:  722 GYFEKNDIHNNRIAGFEVKAGANPTVVKCEIHHGQTGGIYVHENGLGQFIENRIHSNNFAGVWITSNSNPTIRKNEIYNGHQGGVYIFGEGRGLIEHNNIYGNALAGIQIRTNSDPIVRHNKIHHGQHGGIYVHEKGQGLIEENEVYSNTLAGVWITTGSTPVLRRNRIHSGKQVGVYFYDNGHGKLEDNDIFNHLYSGVQIRTGSNPVIRGNKIWGGQNGGV 944          

HSP 4 Score: 53.5286 bits (127), Expect = 1.355e-6
Identity = 38/155 (24.52%), Postives = 73/155 (47.10%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGIS-FVSNSGRVEFNDICFN-RVGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIY 2052
            +++   S   I  N++       + + +G   ++  NEI+      + I+ +++P +  NKI+     GI  F    G +E NDI  N + G+ I   ++PI+R N I    + G+ I   + + L+ N I+KN+   + +     P+   N I+
Sbjct:  921 VQIRTGSNPVIRGNKIWGGQNGGVLVYNGGLGLLEQNEIFDNAMAGVWIKTDSNPTLKRNKIYDGRDGGICIFNGGKGILEENDIFRNTQAGVLISTQSHPILRRNRIYDGQAAGVEITNNATATLEHNQIFKNKFGGLCLASGVQPITRGNNIF 1075          
BLAST of F-box only protein 10 vs. Ensembl Fly
Match: FBXO11 (gene:FBgn0037760 transcript:FBtr0082155)

HSP 1 Score: 103.99 bits (258), Expect = 4.133e-22
Identity = 61/211 (28.91%), Postives = 107/211 (50.71%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNRV--GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI 2217
            I++   S   + HN++H+     I +    + +I  NE+Y      + I   ++P +  N+IHS  + G+ F  N  G++E NDI FN +  G+ I   +NP+IR N I    + G+++    + +L+ N I+ N  + +WI+  S P +  N IY   + GI + +G KG +  N I  N + G+L+     P +  N+I   +  G+ I
Sbjct:  829 IQIRTNSDPIVRHNKIHHGQHGGIYVHEKGQGLIEENEVYSNTLAGVWITTGSTPVLRRNRIHSGKQVGVYFYDNGHGKLEDNDI-FNHLYSGVQIRTGSNPVIRGNKIWGGQNGGVLVYNGGLGLLEQNEIFDNAMAGVWIKTDSNPTLKRNKIYDGRDGGICIFNGGKGILEENDIFRNTQAGVLISTQSHPILRRNRIYDGQAAGVEI 1038          

HSP 2 Score: 87.8113 bits (216), Expect = 3.751e-17
Identity = 77/270 (28.52%), Postives = 123/270 (45.56%), Query Frame = 1
Query: 1546 SNVVIVNCEMH--DCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIY--------------GMVE---------GAIEIRKNTSPNVLANKIHSNGKCGISFVSNSGR--VEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI---ARVIMDNEDIISDEQ 2262
            +N  +V CE+H    G I         FI  NR+H+++   + +   S   I  NEIY              G++E           I+IR N+ P V  NKIH +G+ G  +V   G+  +E N++  N + G+ I   + P++R N I S    G+   +     L+DN I+ +  S + IR  S PVI  N I+   N G+++ +G  G +  N I DN   G+ +     P +  N+I   +  GI I    + I++  DI  + Q
Sbjct:  743 ANPTVVKCEIHHGQTGGIYVHENGLGQFI-ENRIHSNNFAGVWITSNSNPTIRKNEIYNGHQGGVYIFGEGRGLIEHNNIYGNALAGIQIRTNSDPIVRHNKIH-HGQHGGIYVHEKGQGLIEENEVYSNTLAGVWITTGSTPVLRRNRIHSGKQVGVYFYDNGHGKLEDNDIFNHLYSGVQIRTGSNPVIRGNKIWGGQNGGVLVYNGGLGLLEQNEIFDNAMAGVWIKTDSNPTLKRNKIYDGRDGGICIFNGGKGILEENDIFRNTQ 1010          

HSP 3 Score: 83.5741 bits (205), Expect = 9.693e-16
Identity = 57/223 (25.56%), Postives = 100/223 (44.84%), Query Frame = 1
Query: 1618 AFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS------------------------GRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGI 2211
             +   N +HN+      +K G+   ++  EI+    G I + +N     + N+IHSN   G+   SNS                        G +E N+I  N + GI I  +++PI+R N I      GI ++E+   ++++N +Y N  + +WI   S PV+  N I+     G+   D   G + +N I ++  +G+ +     P I GN+I   +  G+
Sbjct:  722 GYFEKNDIHNNRIAGFEVKAGANPTVVKCEIHHGQTGGIYVHENGLGQFIENRIHSNNFAGVWITSNSNPTIRKNEIYNGHQGGVYIFGEGRGLIEHNNIYGNALAGIQIRTNSDPIVRHNKIHHGQHGGIYVHEKGQGLIEENEVYSNTLAGVWITTGSTPVLRRNRIHSGKQVGVYFYDNGHGKLEDNDIFNHLYSGVQIRTGSNPVIRGNKIWGGQNGGV 944          

HSP 4 Score: 53.5286 bits (127), Expect = 1.355e-6
Identity = 38/155 (24.52%), Postives = 73/155 (47.10%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGIS-FVSNSGRVEFNDICFN-RVGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIY 2052
            +++   S   I  N++       + + +G   ++  NEI+      + I+ +++P +  NKI+     GI  F    G +E NDI  N + G+ I   ++PI+R N I    + G+ I   + + L+ N I+KN+   + +     P+   N I+
Sbjct:  921 VQIRTGSNPVIRGNKIWGGQNGGVLVYNGGLGLLEQNEIFDNAMAGVWIKTDSNPTLKRNKIYDGRDGGICIFNGGKGILEENDIFRNTQAGVLISTQSHPILRRNRIYDGQAAGVEITNNATATLEHNQIFKNKFGGLCLASGVQPITRGNNIF 1075          
BLAST of F-box only protein 10 vs. Ensembl Zebrafish
Match: fbxo10 (F-box protein 10 [Source:ZFIN;Acc:ZDB-GENE-090313-270])

HSP 1 Score: 132.88 bits (333), Expect = 6.739e-31
Identity = 78/290 (26.90%), Postives = 130/290 (44.83%), Query Frame = 1
Query:  121 LSADLLLLIMEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDEKTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGP-NGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGI--NSQMTIYFDCDTSAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNL-NNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYER 978
            L  +L  LI+ YL   DL RC  V  +W  +I  LD+T W++L L    G    R      R                          +W+E  R H +    W     ++ + +C  + R   D+   HV    G  Y S+R A++   PY  V++HPG Y+EQV++++ +P +++G G   +  + + FD      R+CN+   P WFS ++ +   G  Q+++C+    ++H+  PG    R+C+    +   F     S ++ CEF      +  + VEG P  ER
Sbjct:    6 LPVELWRLILAYLPLPDLGRCCLVCRAWRELILSLDSTRWRQLCL----GCPECRHPNWPRRP--------------------HLPPASWREALRQHALASRTWTQNGSDLHSSACLHLFRRRKDRRVWHVATVAGGGYESLRGALAVAGPYDKVVLHPGVYEEQVEVALKVPVEIVGMGKLGDVSLLVSFDQQCPTARLCNVVFMPAWFSPVVYKTSSGHVQLDNCNFEGCQLHIRGPGTCQARFCSFAQGSSAHFLGVTISLMDSCEFSGGDSAS--VTVEGPPVSER 269          

HSP 2 Score: 112.849 bits (281), Expect = 9.332e-25
Identity = 89/382 (23.30%), Postives = 169/382 (44.24%), Query Frame = 1
Query: 1453 EVKQIMNNINGPLLMNCNFSRSKFVVN------CLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNR-VGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDLNRI-----SGDEKWICRKHGLIH-IEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISLV 2556
            E + +  ++ G LL  C     K  V+        LE+NV             +R  + +K  +  N +     + + L+  ++ +I  N I+   E  ++IRK  +P +L N+IHS  + GI  + N  G +  N I  N+  G+ IL + NP++  N I    + GI +NE    ++ +N+I +N+     IR+   PV+  N I   ++DG+++ +  +G +  N I  N   G+ +++  LP + GN I  N+ +G+ +                          +C     S  +   Y R   D  + +G+L        S DE++  R+   +  +E N I  N   G+   ++ P+ +++N + +N   G+ ++
Sbjct:  416 EARDLAASVQGCLLRRCLLRDGKGGVHLCNHAQARLEANV------FRGLNYAVRCIQNAKMVMLRNEVCGCKASGVFLRLSAQGLIAENNIHSNGEAGLDIRKGANPIILCNRIHSGLRSGIVVLGNGRGSIRSNQIYGNKEAGVYILFNGNPVVSGNHIFQGLAAGIAVNENGRGLITENVIRQNQWGGADIRRGGDPVLRNNFICYGYSDGVVVGERGRGLVEGNHIYGNRGCGVWVMSSSLPQLIGNHISHNRMYGLAV--------------------------FCRKDTESAVNREGYHRGERDNFNEEGELMAWESDIDSEDERFSSRRPITVALVENNCISQNGAVGVFVKSSEPLNVVSNMVKSNRGAGVCVI 765          
BLAST of F-box only protein 10 vs. Ensembl Zebrafish
Match: fbxo10 (F-box protein 10 [Source:ZFIN;Acc:ZDB-GENE-090313-270])

HSP 1 Score: 132.494 bits (332), Expect = 7.612e-31
Identity = 78/290 (26.90%), Postives = 130/290 (44.83%), Query Frame = 1
Query:  121 LSADLLLLIMEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDEKTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGP-NGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGI--NSQMTIYFDCDTSAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNL-NNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYER 978
            L  +L  LI+ YL   DL RC  V  +W  +I  LD+T W++L L    G    R      R                          +W+E  R H +    W     ++ + +C  + R   D+   HV    G  Y S+R A++   PY  V++HPG Y+EQV++++ +P +++G G   +  + + FD      R+CN+   P WFS ++ +   G  Q+++C+    ++H+  PG    R+C+    +   F     S ++ CEF      +  + VEG P  ER
Sbjct:    6 LPVELWRLILAYLPLPDLGRCCLVCRAWRELILSLDSTRWRQLCL----GCPECRHPNWPRRP--------------------HLPPASWREALRQHALASRTWTQNGSDLHSSACLHLFRRRKDRRVWHVATVAGGGYESLRGALAVAGPYDKVVLHPGVYEEQVEVALKVPVEIVGMGKLGDVSLLVSFDQQCPTARLCNVVFMPAWFSPVVYKTSSGHVQLDNCNFEGCQLHIRGPGTCQARFCSFAQGSSAHFLGVTISLMDSCEFSGGDSAS--VTVEGPPVSER 269          

HSP 2 Score: 112.849 bits (281), Expect = 9.857e-25
Identity = 87/376 (23.14%), Postives = 167/376 (44.41%), Query Frame = 1
Query: 1453 EVKQIMNNINGPLLMNCNFSRSKFVVN------CLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNR-VGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDLNRISGDEKWICRKHGLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISLV 2556
            E + +  ++ G LL  C     K  V+        LE+NV             +R  + +K  +  N +     + + L+  ++ +I  N I+   E  ++IRK  +P +L N+IHS  + GI  + N  G +  N I  N+  G+ IL + NP++  N I    + GI +NE    ++ +N+I +N+     IR+   PV+  N I   ++DG+++ +  +G +  N I  N   G+ +++  LP + GN I  N+ +G+ +        D    E+DN  E   ++++ ++   SE + F   R                           +  +E N I  N   G+   ++ P+ +++N + +N   G+ ++
Sbjct:  388 EARDLAASVQGCLLRRCLLRDGKGGVHLCNHAQARLEANV------FRGLNYAVRCIQNAKMVMLRNEVCGCKASGVFLRLSAQGLIAENNIHSNGEAGLDIRKGANPIILCNRIHSGLRSGIVVLGNGRGSIRSNQIYGNKEAGVYILFNGNPVVSGNHIFQGLAAGIAVNENGRGLITENVIRQNQWGGADIRRGGDPVLRNNFICYGYSDGVVVGERGRGLVEGNHIYGNRGCGVWVMSSSLPQLIGNHISHNRMYGLAVFCRKDTESDRDRGERDNFNEEGELMAW-ESDIDSEDERFSSRRPIT------------------------VALVENNCISQNGAVGVFVKSSEPLNVVSNMVKSNRGAGVCVI 732          
BLAST of F-box only protein 10 vs. Ensembl Zebrafish
Match: fbxo10 (F-box protein 10 [Source:ZFIN;Acc:ZDB-GENE-090313-270])

HSP 1 Score: 132.494 bits (332), Expect = 8.057e-31
Identity = 78/290 (26.90%), Postives = 130/290 (44.83%), Query Frame = 1
Query:  121 LSADLLLLIMEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDEKTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGP-NGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGI--NSQMTIYFDCDTSAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNL-NNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYER 978
            L  +L  LI+ YL   DL RC  V  +W  +I  LD+T W++L L    G    R      R                          +W+E  R H +    W     ++ + +C  + R   D+   HV    G  Y S+R A++   PY  V++HPG Y+EQV++++ +P +++G G   +  + + FD      R+CN+   P WFS ++ +   G  Q+++C+    ++H+  PG    R+C+    +   F     S ++ CEF      +  + VEG P  ER
Sbjct:    6 LPVELWRLILAYLPLPDLGRCCLVCRAWRELILSLDSTRWRQLCL----GCPECRHPNWPRRP--------------------HLPPASWREALRQHALASRTWTQNGSDLHSSACLHLFRRRKDRRVWHVATVAGGGYESLRGALAVAGPYDKVVLHPGVYEEQVEVALKVPVEIVGMGKLGDVSLLVSFDQQCPTARLCNVVFMPAWFSPVVYKTSSGHVQLDNCNFEGCQLHIRGPGTCQARFCSFAQGSSAHFLGVTISLMDSCEFSGGDSAS--VTVEGPPVSER 269          

HSP 2 Score: 112.079 bits (279), Expect = 1.501e-24
Identity = 89/377 (23.61%), Postives = 172/377 (45.62%), Query Frame = 1
Query: 1453 EVKQIMNNINGPLLMNCNFSRSKFVVN------CLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNR-VGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDLNRISGDEKWICRKHGLIH-IEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISLV 2556
            E + +  ++ G LL  C     K  V+        LE+NV             +R  + +K  +  N +     + + L+  ++ +I  N I+   E  ++IRK  +P +L N+IHS  + GI  + N  G +  N I  N+  G+ IL + NP++  N I    + GI +NE    ++ +N+I +N+     IR+   PV+  N I   ++DG+++ +  +G +  N I  N   G+ +++  LP + GN I  N+ +G+ +     D E  ++ E     +              E D F+      +    + D++  S DE++  R+   +  +E N I  N   G+   ++ P+ +++N + +N   G+ ++
Sbjct:  416 EARDLAASVQGCLLRRCLLRDGKGGVHLCNHAQARLEANV------FRGLNYAVRCIQNAKMVMLRNEVCGCKASGVFLRLSAQGLIAENNIHSNGEAGLDIRKGANPIILCNRIHSGLRSGIVVLGNGRGSIRSNQIYGNKEAGVYILFNGNPVVSGNHIFQGLAAGIAVNENGRGLITENVIRQNQWGGADIRRGGDPVLRNNFICYGYSDGVVVGERGRGLVEGNHIYGNRGCGVWVMSSSLPQLIGNHISHNRMYGLAVF-CRKDTESAVNREGYRALQDRD---------RGERDNFN---EEGELMAWESDID--SEDERFSSRRPITVALVENNCISQNGAVGVFVKSSEPLNVVSNMVKSNRGAGVCVI 771          
BLAST of F-box only protein 10 vs. Ensembl Zebrafish
Match: fbxo10 (F-box protein 10 [Source:ZFIN;Acc:ZDB-GENE-090313-270])

HSP 1 Score: 132.109 bits (331), Expect = 1.074e-30
Identity = 78/290 (26.90%), Postives = 130/290 (44.83%), Query Frame = 1
Query:  121 LSADLLLLIMEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDEKTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGP-NGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGI--NSQMTIYFDCDTSAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNL-NNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYER 978
            L  +L  LI+ YL   DL RC  V  +W  +I  LD+T W++L L    G    R      R                          +W+E  R H +    W     ++ + +C  + R   D+   HV    G  Y S+R A++   PY  V++HPG Y+EQV++++ +P +++G G   +  + + FD      R+CN+   P WFS ++ +   G  Q+++C+    ++H+  PG    R+C+    +   F     S ++ CEF      +  + VEG P  ER
Sbjct:    6 LPVELWRLILAYLPLPDLGRCCLVCRAWRELILSLDSTRWRQLCL----GCPECRHPNWPRRP--------------------HLPPASWREALRQHALASRTWTQNGSDLHSSACLHLFRRRKDRRVWHVATVAGGGYESLRGALAVAGPYDKVVLHPGVYEEQVEVALKVPVEIVGMGKLGDVSLLVSFDQQCPTARLCNVVFMPAWFSPVVYKTSSGHVQLDNCNFEGCQLHIRGPGTCQARFCSFAQGSSAHFLGVTISLMDSCEFSGGDSAS--VTVEGPPVSER 269          

HSP 2 Score: 112.464 bits (280), Expect = 1.242e-24
Identity = 89/377 (23.61%), Postives = 172/377 (45.62%), Query Frame = 1
Query: 1453 EVKQIMNNINGPLLMNCNFSRSKFVVN------CLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNR-VGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDLNRISGDEKWICRKHGLIH-IEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISLV 2556
            E + +  ++ G LL  C     K  V+        LE+NV             +R  + +K  +  N +     + + L+  ++ +I  N I+   E  ++IRK  +P +L N+IHS  + GI  + N  G +  N I  N+  G+ IL + NP++  N I    + GI +NE    ++ +N+I +N+     IR+   PV+  N I   ++DG+++ +  +G +  N I  N   G+ +++  LP + GN I  N+ +G+ +     D E  ++ E     +              E D F+      +    + D++  S DE++  R+   +  +E N I  N   G+   ++ P+ +++N + +N   G+ ++
Sbjct:  416 EARDLAASVQGCLLRRCLLRDGKGGVHLCNHAQARLEANV------FRGLNYAVRCIQNAKMVMLRNEVCGCKASGVFLRLSAQGLIAENNIHSNGEAGLDIRKGANPIILCNRIHSGLRSGIVVLGNGRGSIRSNQIYGNKEAGVYILFNGNPVVSGNHIFQGLAAGIAVNENGRGLITENVIRQNQWGGADIRRGGDPVLRNNFICYGYSDGVVVGERGRGLVEGNHIYGNRGCGVWVMSSSLPQLIGNHISHNRMYGLAVF-CRKDTESAVNREGYRALQDRD---------RGERDNFN---EEGELMAWESDID--SEDERFSSRRPITVALVENNCISQNGAVGVFVKSSEPLNVVSNMVKSNRGAGVCVI 771          
BLAST of F-box only protein 10 vs. Ensembl Zebrafish
Match: fbxo10 (F-box protein 10 [Source:ZFIN;Acc:ZDB-GENE-090313-270])

HSP 1 Score: 128.257 bits (321), Expect = 2.648e-30
Identity = 78/293 (26.62%), Postives = 131/293 (44.71%), Query Frame = 1
Query:  112 ICHLSADLLLLIMEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDEKTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGP-NGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSG--INSQMTIYFDCDTSAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNL-NNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYER 978
            +  L  +L  LI+ YL   DL RC  V  +W  +I  LD+T W++L L    G    R      R                          +W+E  R H +    W     ++ + +C  + R   D+   HV    G  Y S+R A++   PY  V++HPG Y+EQV++++ +P +++G G   +  + + FD      R+CN+   P WFS ++ +   G  Q+++C+    ++H+  PG    R+C+    +   F     S ++ CEF      +  + VEG P  ER
Sbjct:    3 VGDLPVELWRLILAYLPLPDLGRCCLVCRAWRELILSLDSTRWRQLCL----GCPECRHPNWPRRP--------------------HLPPASWREALRQHALASRTWTQNGSDLHSSACLHLFRRRKDRRVWHVATVAGGGYESLRGALAVAGPYDKVVLHPGVYEEQVEVALKVPVEIVGMGKLGDVSLLVSFDQQCPTARLCNVVFMPAWFSPVVYKTSSGHVQLDNCNFEGCQLHIRGPGTCQARFCSFAQGSSAHFLGVTISLMDSCEFSGGDSAS--VTVEGPPVSER 269          
BLAST of F-box only protein 10 vs. Ensembl Xenopus
Match: itfg2 (integrin alpha FG-GAP repeat containing 2 [Source:Xenbase;Acc:XB-GENE-5748324])

HSP 1 Score: 262.692 bits (670), Expect = 1.364e-72
Identity = 212/832 (25.48%), Postives = 374/832 (44.95%), Query Frame = 1
Query:  112 ICHLSADLLLLIMEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDE-KTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPNGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGI--NSQMTIYFDCDTSAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNLNNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFLLNQIKKSLPFHIDSHNVIKCNANTNEYLFPILRKTKSCDNLHFLRXXXXXXXXXXTIQRGRLNSLQSDFSKIQKIHTQVNLALLKDHRILHLLPISLDEXXXXXXXXXXXXXXXFDDLQFDFHKASVNDSSAKSIERKSYS------------KFIKKCCCKD-EVKQIMNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFV-SNSGRVEFNDICFNR-VGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDLNRISGDEKWICRKHGLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISL 2553
            I  L  +L  LI+ YL  +DL RC  V  SWY +I  LDNT W++L L    G +  R                       N   + D E ++W+E ++ H++    W   ++++ + +C  + R   D+  ++VG  G  Y ++R A++S + Y  +I+ PG Y+EQ +I++ +P +++G G   +  + +  D      R+CNL   P WF+ +M +   G  Q ++C+  NG++ + +PG   +++C  N + I F     S +E+CEF ++   N  + VEG+P  ++   C  L +   KS     ++     C   + +Y    L        +H      + +   S +     + L  D +  ++     N+   K+   + L     D +            S +   +  +H   ++   AKSI  +  +            K ++    +D E++ ++N I G L+  C F   K  V    +    +      D    +R  + SK  +  N +++   + + L+  +  +I  N I+   E  ++IRK  +P VL NKIHS  + GI  + S  G +  N I  N+  GI IL++ NPI+  N I    + GI +NE     + +N+I +N+   + IR+   PV+  NLI   ++DG+++ +  KG I  N I  N   G+ +++  LP+I  NQI  N  +G+ +     D  D ++++  NE                  +  D    AN  NDLD +  R S       R   +  IE NSI  N   G+   ++  + I+ NAIHAN + G+++
Sbjct:    3 IGGLPLELWRLILAYLPLRDLGRCGLVCRSWYDLILSLDNTRWRQLCL----GCVECRHP---------------------NWPIQPDVEPRSWREAFKQHYVASRTWTKNAQDLESSNCLYLFRRKKDRRVLYVG-YGCEYENLRTALASANIYDRIILLPGVYEEQNEITLKIPVEIMGQGKLGDVALLVCIDQQCPTSRLCNLVFMPAWFTPVMYKTSIGHVQFDNCNFENGQLQIHAPGTCQVKFCTFNQSSIHFHNVALSVLENCEFVSSE--NASVTVEGSPTSDKNWACKHL-SACAKSRNILFNASEASHCGPGSTDYFGNGL------SGVHLRTCEIMVNSDQSYLLSHAKSQLLGDKASDKENEINGNIYRCKEEEAMTLDTDYSDSDVSTISENEDDEQSVY---KLSYHSHGLSHMLAKSIHCRPQTNRLLTLQGDMSLKSLQHELQRDKELQTLVNTIQGCLIRKCLFRDGKGGVFICSQGQARLEGSIFRDLTYAVRCIQNSKVIMLKNDIYHCKASGVFLRLAAGGLIADNNIHSNTEAGVDIRKGANPVVLCNKIHSGLRSGIVVLGSGKGNIRSNQIFGNKEAGIYILYNGNPIVSGNHIFQGLAAGIAVNENGRGQITENVIRENQWGGVDIRRGGDPVLRSNLICCGYSDGVVVGERGKGLIEGNTIYGNKGCGVWIMSSSLPHITSNQIGHNGIYGVAVFCRKDDASDYLANQAGNE------------------NFNDDGEAANWENDLDSEDERFSSR-----RPMNVALIESNSINHNGAAGLYIKSSEALNIMANAIHANQDCGVAV 773          
BLAST of F-box only protein 10 vs. Ensembl Xenopus
Match: itfg2 (integrin alpha FG-GAP repeat containing 2 [Source:Xenbase;Acc:XB-GENE-5748324])

HSP 1 Score: 207.223 bits (526), Expect = 1.357e-54
Identity = 172/685 (25.11%), Postives = 307/685 (44.82%), Query Frame = 1
Query:  550 AISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGI--NSQMTIYFDCDTSAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNLNNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFLLNQIKKSLPFHIDSHNVIKCNANTNEYLFPILRKTKSCDNLHFLRXXXXXXXXXXTIQRGRLNSLQSDFSKIQKIHTQVNLALLKDHRILHLLPISLDEXXXXXXXXXXXXXXXFDDLQFDFHKASVNDSSAKSIERKSYS------------KFIKKCCCKD-EVKQIMNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFV-SNSGRVEFNDICFNR-VGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDLNRISGDEKWICRKHGLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISL 2553
            A++S + Y  +I+ PG Y+EQ +I++ +P +++G G   +  + +  D      R+CNL   P WF+ +M +   G  Q ++C+  NG++ + +PG   +++C  N + I F     S +E+CEF ++   N  + VEG+P  ++   C  L +   KS     ++     C   + +Y    L        +H      + +   S +     + L  D +  ++     N+   K+   + L     D +            S +   +  +H   ++   AKSI  +  +            K ++    +D E++ ++N I G L+  C F   K  V    +    +      D    +R  + SK  +  N +++   + + L+  +  +I  N I+   E  ++IRK  +P VL NKIHS  + GI  + S  G +  N I  N+  GI IL++ NPI+  N I    + GI +NE     + +N+I +N+   + IR+   PV+  NLI   ++DG+++ +  KG I  N I  N   G+ +++  LP+I  NQI  N  +G+ +     D  D ++++  NE                  +  D    AN  NDLD +  R S       R   +  IE NSI  N   G+   ++  + I+ NAIHAN + G+++
Sbjct:    3 ALASANIYDRIILLPGVYEEQNEITLKIPVEIMGQGKLGDVALLVCIDQQCPTSRLCNLVFMPAWFTPVMYKTSIGHVQFDNCNFENGQLQIHAPGTCQVKFCTFNQSSIHFHNVALSVLENCEFVSSE--NASVTVEGSPTSDKNWACKHL-SACAKSRNILFNASEASHCGPGSTDYFGNGL------SGVHLRTCEIMVNSDQSYLLSHAKSQLLGDKASDKENEINGNIYRCKEEEAMTLDTDYSDSDVSTISENEDDEQSVY---KLSYHSHGLSHMLAKSIHCRPQTNRLLTLQGDMSLKSLQHELQRDKELQTLVNTIQGCLIRKCLFRDGKGGVFICSQGQARLEGSIFRDLTYAVRCIQNSKVIMLKNDIYHCKASGVFLRLAAGGLIADNNIHSNTEAGVDIRKGANPVVLCNKIHSGLRSGIVVLGSGKGNIRSNQIFGNKEAGIYILYNGNPIVSGNHIFQGLAAGIAVNENGRGQITENVIRENQWGGVDIRRGGDPVLRSNLICCGYSDGVVVGERGKGLIEGNTIYGNKGCGVWIMSSSLPHITSNQIGHNGIYGVAVFCRKDDASDYLANQAGNE------------------NFNDDGEAANWENDLDSEDERFSSR-----RPMNVALIESNSINHNGAAGLYIKSSEALNIMANAIHANQDCGVAV 652          
BLAST of F-box only protein 10 vs. Ensembl Xenopus
Match: itfg2 (integrin alpha FG-GAP repeat containing 2 [Source:Xenbase;Acc:XB-GENE-5748324])

HSP 1 Score: 199.134 bits (505), Expect = 1.002e-51
Identity = 194/832 (23.32%), Postives = 346/832 (41.59%), Query Frame = 1
Query:  112 ICHLSADLLLLIMEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDE-KTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPNGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGI--NSQMTIYFDCDTSAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNLNNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFLLNQIKKSLPFHIDSHNVIKCNANTNEYLFPILRKTKSCDNLHFLRXXXXXXXXXXTIQRGRLNSLQSDFSKIQKIHTQVNLALLKDHRILHLLPISLDEXXXXXXXXXXXXXXXFDDLQFDFHKASVNDSSAKSIERKSYS------------KFIKKCCCKD-EVKQIMNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNR-VGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDLNRISGDEKWICRKHGLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISL 2553
            I  L  +L  LI+ YL  +DL RC  V  SWY +I  LDNT W++L L    G +  R                       N   + D E ++W+E ++ H++    W   ++++ + +C  + R   D+  ++VG  G  Y ++R A++S + Y  +I+ PG Y+EQ +I++ +P +++G G   +  + +  D      R+CNL   P WF+ +M +   G  Q ++C+  NG++ + +PG   +++C  N + I F     S +E+CEF ++   N  + VEG+P  ++   C   L+   KS     ++     C   + +Y    L        +H      + +   S +     + L  D +  ++     N+   K+   + L     D +            S +   +  +H   ++   AKSI  +  +            K ++    +D E++ ++N I G L+  C F   K  V    +    +      D    +R  + SK     N++H+   + I +    +  I  N+I+G  E  I I  N +P V  N I      GI+   N  G++  N I  N+  G++I    +P++RSN I    S G+++ ER   +++ N IY N+   +WI   S P IT                                               NQI  N  +G+ +     D  D ++++  NE       ++ D   ++ ++           NDLD +  R S       R   +  IE NSI  N   G+   ++  + I+ NAIHAN + G+++
Sbjct:    3 IGGLPLELWRLILAYLPLRDLGRCGLVCRSWYDLILSLDNTRWRQLCL----GCVECRHP---------------------NWPIQPDVEPRSWREAFKQHYVASRTWTKNAQDLESSNCLYLFRRKKDRRVLYVG-YGCEYENLRTALASANIYDRIILLPGVYEEQNEITLKIPVEIMGQGKLGDVALLVCIDQQCPTSRLCNLVFMPAWFTPVMYKTSIGHVQFDNCNFENGQLQIHAPGTCQVKFCTFNQSSIHFHNVALSVLENCEFVSSE--NASVTVEGSPTSDKNWACKH-LSACAKSRNILFNASEASHCGPGSTDYFGNGL------SGVHLRTCEIMVNSDQSYLLSHAKSQLLGDKASDKENEINGNIYRCKEEEAMTLDTDYSDSDVSTISENEDDEQSVY---KLSYHSHGLSHMLAKSIHCRPQTNRLLTLQGDMSLKSLQHELQRDKELQTLVNTIQGCLIRKCLFRDGKGGVFICSQGQARLEGSIFRDLTYAVRCIQNSKC----NKIHSGLRSGIVVLGSGKGNIRSNQIFGNKEAGIYILYNGNPIVSGNHIFQGLAAGIAVNENGRGQITENVIRENQWGGVDIRRGGDPVLRSNLICCGYSDGVVVGERGKGLIEGNTIYGNKGCGVWIMSSSLPHIT----------------------------------------------SNQIGHNGIYGVAVFCRKDDASDYLANQAGNE-------NFNDDGEAANWE-----------NDLDSEDERFSSR-----RPMNVALIESNSINHNGAAGLYIKSSEALNIMANAIHANQDCGVAV 723          
BLAST of F-box only protein 10 vs. Ensembl Xenopus
Match: smad2 (SMAD family member 2 [Source:Xenbase;Acc:XB-GENE-482930])

HSP 1 Score: 96.2857 bits (238), Expect = 1.825e-19
Identity = 60/211 (28.44%), Postives = 104/211 (49.29%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNRV--GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI 2217
            I++   S   + HN++H+     I +    + VI  NE+Y      + +   ++P +  N+IHS  + G+ F  N  G +E NDI +N +  G+ I   +NP IR N I    + GI++    +  ++DN I+ N  + +WI+  S P +  N I+   + GI + +G +G +  N I  N + G+L+     P +  N+I      GI I
Sbjct:  527 IQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDI-YNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGFIEDNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPILRKNRIFDGFAAGIEI 736          

HSP 2 Score: 78.9518 bits (193), Expect = 3.402e-14
Identity = 50/193 (25.91%), Postives = 89/193 (46.11%), Query Frame = 1
Query: 1639 MHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGIS-FVSNSGRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGI 2211
            +H+     I +        + N+IY      + I  N+ P +  N I +  + G+  F    G +E NDI  N + GI I  ++ PI+R N I      GI ++E+   ++++N +Y N  + +W+   S PV+  N I+     G+   D   G + +N I ++  +G+ +     P I  N+I   +  GI
Sbjct:  450 IHHGQTGGIYVHEKGRGQFLENKIYANNFAGVWITSNSDPTIRGNAIFNGNQGGVYIFGDGRGLIEENDIYGNALAGIQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQIRTGSNPKIRRNKIWGGQNGGI 642          

HSP 3 Score: 53.9138 bits (128), Expect = 1.749e-6
Identity = 38/146 (26.03%), Postives = 66/146 (45.21%), Query Frame = 1
Query: 1822 GRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI---ARVIMDNEDI 2247
            G  E N+I  N + GI + +  NPIIR N I      G+   +  +   +   I++NR +   ++ ++ P +    I+     GI + +  +G    N I  N   G+ + +   P I GN I    Q G++I    R +++  DI
Sbjct:  374 GIYEDNEISNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHRNRIAGFEVKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFLENKIYANNFAGVWITSNSDPTIRGNAIFNGNQGGVYIFGDGRGLIEENDI 519          
BLAST of F-box only protein 10 vs. Ensembl Xenopus
Match: smad2 (SMAD family member 2 [Source:Xenbase;Acc:XB-GENE-482930])

HSP 1 Score: 95.9005 bits (237), Expect = 1.977e-19
Identity = 60/211 (28.44%), Postives = 104/211 (49.29%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNRV--GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI 2217
            I++   S   + HN++H+     I +    + VI  NE+Y      + +   ++P +  N+IHS  + G+ F  N  G +E NDI +N +  G+ I   +NP IR N I    + GI++    +  ++DN I+ N  + +WI+  S P +  N I+   + GI + +G +G +  N I  N + G+L+     P +  N+I      GI I
Sbjct:  497 IQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDI-YNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGFIEDNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPILRKNRIFDGFAAGIEI 706          

HSP 2 Score: 78.9518 bits (193), Expect = 3.301e-14
Identity = 59/241 (24.48%), Postives = 103/241 (42.74%), Query Frame = 1
Query: 1498 NCNFSRSKFV-VNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGIS-FVSNSGRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGI 2211
            +CN  R++         +N  +V CE+H                     H  +G  I +        + N+IY      + I  N+ P +  N I +  + G+  F    G +E NDI  N + GI I  ++ PI+R N I      GI ++E+   ++++N +Y N  + +W+   S PV+  N I+     G+   D   G + +N I ++  +G+ +     P I  N+I   +  GI
Sbjct:  394 SCNIHRNRIAGFEVKAYANPTVVRCEIH---------------------HGQTG-GIYVHEKGRGQFLENKIYANNFAGVWITSNSDPTIRGNAIFNGNQGGVYIFGDGRGLIEENDIYGNALAGIQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQIRTGSNPKIRRNKIWGGQNGGI 612          

HSP 3 Score: 53.9138 bits (128), Expect = 1.615e-6
Identity = 38/146 (26.03%), Postives = 66/146 (45.21%), Query Frame = 1
Query: 1822 GRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI---ARVIMDNEDI 2247
            G  E N+I  N + GI + +  NPIIR N I      G+   +  +   +   I++NR +   ++ ++ P +    I+     GI + +  +G    N I  N   G+ + +   P I GN I    Q G++I    R +++  DI
Sbjct:  344 GIYEDNEISNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHRNRIAGFEVKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFLENKIYANNFAGVWITSNSDPTIRGNAIFNGNQGGVYIFGDGRGLIEENDI 489          
BLAST of F-box only protein 10 vs. Ensembl Mouse
Match: Fbxo10 (F-box protein 10 [Source:MGI Symbol;Acc:MGI:2686937])

HSP 1 Score: 136.732 bits (343), Expect = 4.041e-32
Identity = 84/306 (27.45%), Postives = 142/306 (46.41%), Query Frame = 1
Query:  121 LSADLLLLIMEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDE-KTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPNGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGINSQMTIYFDCDT--SAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNLNNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFLLNQIKKSLPF 1029
            L  +L  +I+ YL   DL RCS V  +WY +I  LD+T W++L L    G    R                       N   + D E ++W+E ++ H++    W   + ++ +  C  + R   ++  + VGP G  + S+  A++    Y  +++ PG Y+EQ +I + +P +++G G   ++ +    D   S  R+CNL   P WFS IM +   G  Q ++C+  NG + V  PG   +++C   N  +         +E+CEF  +   N  + VEG P  ++     +LL  IK S  F
Sbjct:    6 LPLELWRMILAYLHLPDLGRCSLVCRAWYELILSLDSTRWRQLCL----GCTECRHP---------------------NWPNQPDVEPESWREAFKQHYLASKTWTKNALDLESSICFSLFRRKKERRTLSVGP-GHEFDSLGSALAMASLYDRIVLFPGVYEEQGEIILKVPVEIVGQGKLGEVALLASIDQHCSTTRVCNLVFMPAWFSPIMYKTTSGHIQFDNCNFENGHIQVHGPGTCQVKFCTFKNTHVFLHNVPLCMLENCEFVGSE--NNCVTVEGHPSADKNWAYKYLLGLIKSSPIF 283          

HSP 2 Score: 128.642 bits (322), Expect = 1.567e-29
Identity = 100/404 (24.75%), Postives = 175/404 (43.32%), Query Frame = 1
Query: 1363 FHKASVNDSSAKSIERKSYSKFIKKCCCKDEVKQIMNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNR-VGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDL----NRISGDEKWICRKHGLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISLV 2556
             H+    D  A ++        I+KC  +D    +           C++ R+K      +E NV        +    +R    SK  +  N ++    + I L+     +I GN IY   E  ++IRK ++P +L N+IH   + GI  + N  G +  N I  N+  GI IL+  NPI+  N I    + GI +NE    ++ +N+I +N+   + IR+   P++  NLI   ++DG+++ D  KG I  N I  N   G+ +++  LP++  N +  N  +G+ +                               +S +  EF     A +    DGD       +  ++  + R   +  +E NSI  N   GI   ++  ++++ N IHAN + GI++V
Sbjct:  406 LHQELQKDKEAMALASSVQGCLIRKCLFRDGKGGVFV---------CSYGRAK------MEGNV------FRNLTYAVRCIHNSKIVMLRNDIYRCRASGIFLRLEGGGLIAGNNIYHNAEAGVDIRKKSNPLILCNQIHHGLRSGIVVLGNGKGVIRNNQIFSNKEAGIYILYHGNPIVSGNHIFKGRAAGIAVNENGKGLITENVIRENQWGGVDIRRGGVPILRSNLICFGYSDGVVVGDEGKGLIEGNTIYANKGCGVWMMSSSLPHVTSNHVSYNGLYGVAV-------------------------------FSQKDGEFPGGHGAQENFSEDGDAILWEAELEKEDDPLRRPITVALVESNSINHNGASGIFVQSSEALQVVANVIHANGDRGITIV 757          
BLAST of F-box only protein 10 vs. Ensembl Mouse
Match: Fbxo10 (F-box protein 10 [Source:MGI Symbol;Acc:MGI:2686937])

HSP 1 Score: 126.716 bits (317), Expect = 3.107e-29
Identity = 100/404 (24.75%), Postives = 175/404 (43.32%), Query Frame = 1
Query: 1363 FHKASVNDSSAKSIERKSYSKFIKKCCCKDEVKQIMNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNR-VGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDL----NRISGDEKWICRKHGLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISLV 2556
             H+    D  A ++        I+KC  +D    +           C++ R+K      +E NV        +    +R    SK  +  N ++    + I L+     +I GN IY   E  ++IRK ++P +L N+IH   + GI  + N  G +  N I  N+  GI IL+  NPI+  N I    + GI +NE    ++ +N+I +N+   + IR+   P++  NLI   ++DG+++ D  KG I  N I  N   G+ +++  LP++  N +  N  +G+ +                               +S +  EF     A +    DGD       +  ++  + R   +  +E NSI  N   GI   ++  ++++ N IHAN + GI++V
Sbjct:  233 LHQELQKDKEAMALASSVQGCLIRKCLFRDGKGGVFV---------CSYGRAK------MEGNV------FRNLTYAVRCIHNSKIVMLRNDIYRCRASGIFLRLEGGGLIAGNNIYHNAEAGVDIRKKSNPLILCNQIHHGLRSGIVVLGNGKGVIRNNQIFSNKEAGIYILYHGNPIVSGNHIFKGRAAGIAVNENGKGLITENVIRENQWGGVDIRRGGVPILRSNLICFGYSDGVVVGDEGKGLIEGNTIYANKGCGVWMMSSSLPHVTSNHVSYNGLYGVAV-------------------------------FSQKDGEFPGGHGAQENFSEDGDAILWEAELEKEDDPLRRPITVALVESNSINHNGASGIFVQSSEALQVVANVIHANGDRGITIV 584          

HSP 2 Score: 70.8626 bits (172), Expect = 7.648e-12
Identity = 36/111 (32.43%), Postives = 53/111 (47.75%), Query Frame = 1
Query:  697 SAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNLNNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFLLNQIKKSLPF 1029
            S  R+CNL   P WFS IM +   G  Q ++C+  NG + V  PG   +++C   N  +         +E+CEF  +   N  + VEG P  ++     +LL  IK S  F
Sbjct:    2 STTRVCNLVFMPAWFSPIMYKTTSGHIQFDNCNFENGHIQVHGPGTCQVKFCTFKNTHVFLHNVPLCMLENCEFVGSE--NNCVTVEGHPSADKNWAYKYLLGLIKSSPIF 110          
BLAST of F-box only protein 10 vs. Ensembl Mouse
Match: Fbxo11 (F-box protein 11 [Source:MGI Symbol;Acc:MGI:2147134])

HSP 1 Score: 95.5153 bits (236), Expect = 2.002e-19
Identity = 60/211 (28.44%), Postives = 104/211 (49.29%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNRV--GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI 2217
            I++   S   + HN++H+     I +    + VI  NE+Y      + +   ++P +  N+IHS  + G+ F  N  G +E NDI +N +  G+ I   +NP IR N I    + GI++    +  ++DN I+ N  + +WI+  S P +  N I+   + GI + +G +G +  N I  N + G+L+     P +  N+I      GI I
Sbjct:  577 IQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDI-YNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGCIEDNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPVLRKNRIFDGFAAGIEI 786          

HSP 2 Score: 80.1073 bits (196), Expect = 1.165e-14
Identity = 60/241 (24.90%), Postives = 103/241 (42.74%), Query Frame = 1
Query: 1498 NCNFSRSKFV-VNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGIS-FVSNSGRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGI 2211
            +CN  R++         +N  +V CE+H                     H  +G  I +        I N+IY      + I  N+ P +  N I +  + G+  F    G +E NDI  N + GI I  ++ PI+R N I      GI ++E+   ++++N +Y N  + +W+   S PV+  N I+     G+   D   G + +N I ++  +G+ +     P I  N+I   +  GI
Sbjct:  474 SCNIHRNRIAGFEVKAYANPTVVRCEIH---------------------HGQTG-GIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNSIFNGNQGGVYIFGDGRGLIEGNDIYGNALAGIQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQIRTGSNPKIRRNKIWGGQNGGI 692          

HSP 3 Score: 53.9138 bits (128), Expect = 1.227e-6
Identity = 38/146 (26.03%), Postives = 66/146 (45.21%), Query Frame = 1
Query: 1822 GRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI---ARVIMDNEDI 2247
            G  E N+I  N + GI + +  NPIIR N I      G+   +  +   +   I++NR +   ++ ++ P +    I+     GI + +  +G    N I  N   G+ + +   P I GN I    Q G++I    R +++  DI
Sbjct:  424 GIYEDNEISNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHRNRIAGFEVKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNSIFNGNQGGVYIFGDGRGLIEGNDI 569          
BLAST of F-box only protein 10 vs. Ensembl Mouse
Match: Fbxo11 (F-box protein 11 [Source:MGI Symbol;Acc:MGI:2147134])

HSP 1 Score: 95.5153 bits (236), Expect = 2.335e-19
Identity = 60/212 (28.30%), Postives = 104/212 (49.06%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNRV--GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIA 2220
            I++   S   + HN++H+     I +    + VI  NE+Y      + +   ++P +  N+IHS  + G+ F  N  G +E NDI +N +  G+ I   +NP IR N I    + GI++    +  ++DN I+ N  + +WI+  S P +  N I+   + GI + +G +G +  N I  N + G+L+     P +  N+I      GI I 
Sbjct:  489 IQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDI-YNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGCIEDNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPVLRKNRIFDGFAAGIEIT 699          

HSP 2 Score: 79.7221 bits (195), Expect = 1.356e-14
Identity = 60/241 (24.90%), Postives = 103/241 (42.74%), Query Frame = 1
Query: 1498 NCNFSRSKFV-VNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGIS-FVSNSGRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGI 2211
            +CN  R++         +N  +V CE+H                     H  +G  I +        I N+IY      + I  N+ P +  N I +  + G+  F    G +E NDI  N + GI I  ++ PI+R N I      GI ++E+   ++++N +Y N  + +W+   S PV+  N I+     G+   D   G + +N I ++  +G+ +     P I  N+I   +  GI
Sbjct:  386 SCNIHRNRIAGFEVKAYANPTVVRCEIH---------------------HGQTG-GIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNSIFNGNQGGVYIFGDGRGLIEGNDIYGNALAGIQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQIRTGSNPKIRRNKIWGGQNGGI 604          

HSP 3 Score: 53.9138 bits (128), Expect = 1.240e-6
Identity = 38/146 (26.03%), Postives = 66/146 (45.21%), Query Frame = 1
Query: 1822 GRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI---ARVIMDNEDI 2247
            G  E N+I  N + GI + +  NPIIR N I      G+   +  +   +   I++NR +   ++ ++ P +    I+     GI + +  +G    N I  N   G+ + +   P I GN I    Q G++I    R +++  DI
Sbjct:  336 GIYEDNEISNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHRNRIAGFEVKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNSIFNGNQGGVYIFGDGRGLIEGNDI 481          
BLAST of F-box only protein 10 vs. Ensembl Mouse
Match: Fbxo11 (F-box protein 11 [Source:MGI Symbol;Acc:MGI:2147134])

HSP 1 Score: 95.5153 bits (236), Expect = 2.335e-19
Identity = 60/212 (28.30%), Postives = 104/212 (49.06%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNRV--GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIA 2220
            I++   S   + HN++H+     I +    + VI  NE+Y      + +   ++P +  N+IHS  + G+ F  N  G +E NDI +N +  G+ I   +NP IR N I    + GI++    +  ++DN I+ N  + +WI+  S P +  N I+   + GI + +G +G +  N I  N + G+L+     P +  N+I      GI I 
Sbjct:  489 IQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDI-YNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGCIEDNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPVLRKNRIFDGFAAGIEIT 699          

HSP 2 Score: 79.7221 bits (195), Expect = 1.356e-14
Identity = 60/241 (24.90%), Postives = 103/241 (42.74%), Query Frame = 1
Query: 1498 NCNFSRSKFV-VNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGIS-FVSNSGRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGI 2211
            +CN  R++         +N  +V CE+H                     H  +G  I +        I N+IY      + I  N+ P +  N I +  + G+  F    G +E NDI  N + GI I  ++ PI+R N I      GI ++E+   ++++N +Y N  + +W+   S PV+  N I+     G+   D   G + +N I ++  +G+ +     P I  N+I   +  GI
Sbjct:  386 SCNIHRNRIAGFEVKAYANPTVVRCEIH---------------------HGQTG-GIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNSIFNGNQGGVYIFGDGRGLIEGNDIYGNALAGIQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQIRTGSNPKIRRNKIWGGQNGGI 604          

HSP 3 Score: 53.9138 bits (128), Expect = 1.240e-6
Identity = 38/146 (26.03%), Postives = 66/146 (45.21%), Query Frame = 1
Query: 1822 GRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI---ARVIMDNEDI 2247
            G  E N+I  N + GI + +  NPIIR N I      G+   +  +   +   I++NR +   ++ ++ P +    I+     GI + +  +G    N I  N   G+ + +   P I GN I    Q G++I    R +++  DI
Sbjct:  336 GIYEDNEISNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHRNRIAGFEVKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNSIFNGNQGGVYIFGDGRGLIEGNDI 481          
BLAST of F-box only protein 10 vs. UniProt/SwissProt
Match: sp|Q7TQF2|FBX10_MOUSE (F-box only protein 10 OS=Mus musculus OX=10090 GN=Fbxo10 PE=1 SV=2)

HSP 1 Score: 136.732 bits (343), Expect = 2.827e-31
Identity = 84/306 (27.45%), Postives = 142/306 (46.41%), Query Frame = 1
Query:  121 LSADLLLLIMEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDE-KTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPNGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGINSQMTIYFDCDT--SAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNLNNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFLLNQIKKSLPF 1029
            L  +L  +I+ YL   DL RCS V  +WY +I  LD+T W++L L    G    R                       N   + D E ++W+E ++ H++    W   + ++ +  C  + R   ++  + VGP G  + S+  A++    Y  +++ PG Y+EQ +I + +P +++G G   ++ +    D   S  R+CNL   P WFS IM +   G  Q ++C+  NG + V  PG   +++C   N  +         +E+CEF  +   N  + VEG P  ++     +LL  IK S  F
Sbjct:    6 LPLELWRMILAYLHLPDLGRCSLVCRAWYELILSLDSTRWRQLCL----GCTECRHP---------------------NWPNQPDVEPESWREAFKQHYLASKTWTKNALDLESSICFSLFRRKKERRTLSVGP-GHEFDSLGSALAMASLYDRIVLFPGVYEEQGEIILKVPVEIVGQGKLGEVALLASIDQHCSTTRVCNLVFMPAWFSPIMYKTTSGHIQFDNCNFENGHIQVHGPGTCQVKFCTFKNTHVFLHNVPLCMLENCEFVGSE--NNCVTVEGHPSADKNWAYKYLLGLIKSSPIF 283          

HSP 2 Score: 128.642 bits (322), Expect = 1.096e-28
Identity = 100/404 (24.75%), Postives = 175/404 (43.32%), Query Frame = 1
Query: 1363 FHKASVNDSSAKSIERKSYSKFIKKCCCKDEVKQIMNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNR-VGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDL----NRISGDEKWICRKHGLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISLV 2556
             H+    D  A ++        I+KC  +D    +           C++ R+K      +E NV        +    +R    SK  +  N ++    + I L+     +I GN IY   E  ++IRK ++P +L N+IH   + GI  + N  G +  N I  N+  GI IL+  NPI+  N I    + GI +NE    ++ +N+I +N+   + IR+   P++  NLI   ++DG+++ D  KG I  N I  N   G+ +++  LP++  N +  N  +G+ +                               +S +  EF     A +    DGD       +  ++  + R   +  +E NSI  N   GI   ++  ++++ N IHAN + GI++V
Sbjct:  406 LHQELQKDKEAMALASSVQGCLIRKCLFRDGKGGVFV---------CSYGRAK------MEGNV------FRNLTYAVRCIHNSKIVMLRNDIYRCRASGIFLRLEGGGLIAGNNIYHNAEAGVDIRKKSNPLILCNQIHHGLRSGIVVLGNGKGVIRNNQIFSNKEAGIYILYHGNPIVSGNHIFKGRAAGIAVNENGKGLITENVIRENQWGGVDIRRGGVPILRSNLICFGYSDGVVVGDEGKGLIEGNTIYANKGCGVWMMSSSLPHVTSNHVSYNGLYGVAV-------------------------------FSQKDGEFPGGHGAQENFSEDGDAILWEAELEKEDDPLRRPITVALVESNSINHNGASGIFVQSSEALQVVANVIHANGDRGITIV 757          
BLAST of F-box only protein 10 vs. UniProt/SwissProt
Match: sp|Q9UK96|FBX10_HUMAN (F-box only protein 10 OS=Homo sapiens OX=9606 GN=FBXO10 PE=1 SV=3)

HSP 1 Score: 135.961 bits (341), Expect = 5.129e-31
Identity = 85/306 (27.78%), Postives = 142/306 (46.41%), Query Frame = 1
Query:  121 LSADLLLLIMEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDE-KTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPNGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGINSQMTIYFDCDT--SAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNLNNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFLLNQIKKSLPF 1029
            L  +L  +I+ YL   DL RCS V  +WY +I  LD+T W++L L    G    R                       N   + D E ++W+E ++ H++    W   + ++ +  C  + R   ++  + VGP G  + S+  A++    Y  +++ PG Y+EQ +I + +P +++G G   ++ +    D   S  R+CNL   P WFS IM +   G  Q ++C+  NG + V  PG   +++C   N  I         +E+CEF  +   N  + VEG P  ++     +LL  IK S  F
Sbjct:    6 LPLELWRMILAYLHLPDLGRCSLVCRAWYELILSLDSTRWRQLCL----GCTECRHP---------------------NWPNQPDVEPESWREAFKQHYLASKTWTKNALDLESSICFSLFRRRRERRTLSVGP-GREFDSLGSALAMASLYDRIVLFPGVYEEQGEIILKVPVEIVGQGKLGEVALLASIDQHCSTTRLCNLVFTPAWFSPIMYKTTSGHVQFDNCNFENGHIQVHGPGTCQVKFCTFKNTHIFLHNVPLCVLENCEFVGSE--NNSVTVEGHPSADKNWAYKYLLGLIKSSPTF 283          

HSP 2 Score: 122.479 bits (306), Expect = 8.147e-27
Identity = 94/374 (25.13%), Postives = 165/374 (44.12%), Query Frame = 1
Query: 1453 EVKQIMNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNR-VGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDL----NRISGDEKWICRKHGLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISLV 2556
            E   + N++ G L+  C F   K  V         +      +    +R    SK  +  N ++    + I L+     +I GN IY   E  ++IRK ++P +L N+IH   + GI  + N  G +  N I  N+  GI IL+  NP++  N I    + GI +NE    ++ +N+I +N+   + IR+   PV+  NLI   ++DG+++ D  KG I  N I  N   G+ +++  LP++  N +  N  +G+ +                          +     SSE       R   +F++ DGD       +  ++  + R   +  +E NSI  N   G+   ++  + ++ N IHAN + GI++ 
Sbjct:  419 EAMALANSVQGCLIRKCLFRDGKGGVFVCSHGRAKMEGNIFRNLTYAVRCIHNSKIIMLRNDIYRCRASGIFLRLEGGGLIAGNNIYHNAEAGVDIRKKSNPLILCNQIHHGLRSGIVVLGNGKGIIRNNQIFSNKEAGIYILYHGNPVVSGNHIFKGRAAGIAVNENGKGLITENVIRENQWGGVDIRRGGIPVLRSNLICFGYSDGVVVGDEGKGLIEGNTIYANKGCGVWMMSSSLPHVTSNHVSYNGLYGVAV--------------------------FSQKDGSSELPRGH--RAQENFSE-DGDAILWETELEKEDDPLRRPITIALVESNSINHNGASGLYVQSSEALHVITNVIHANGDRGITVA 763          
BLAST of F-box only protein 10 vs. UniProt/SwissProt
Match: sp|Q7TPD1|FBX11_MOUSE (F-box only protein 11 OS=Mus musculus OX=10090 GN=Fbxo11 PE=1 SV=3)

HSP 1 Score: 95.5153 bits (236), Expect = 1.401e-18
Identity = 60/211 (28.44%), Postives = 104/211 (49.29%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNRV--GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI 2217
            I++   S   + HN++H+     I +    + VI  NE+Y      + +   ++P +  N+IHS  + G+ F  N  G +E NDI +N +  G+ I   +NP IR N I    + GI++    +  ++DN I+ N  + +WI+  S P +  N I+   + GI + +G +G +  N I  N + G+L+     P +  N+I      GI I
Sbjct:  577 IQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDI-YNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGCIEDNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPVLRKNRIFDGFAAGIEI 786          

HSP 2 Score: 80.1073 bits (196), Expect = 8.148e-14
Identity = 60/241 (24.90%), Postives = 103/241 (42.74%), Query Frame = 1
Query: 1498 NCNFSRSKFV-VNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGIS-FVSNSGRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGI 2211
            +CN  R++         +N  +V CE+H                     H  +G  I +        I N+IY      + I  N+ P +  N I +  + G+  F    G +E NDI  N + GI I  ++ PI+R N I      GI ++E+   ++++N +Y N  + +W+   S PV+  N I+     G+   D   G + +N I ++  +G+ +     P I  N+I   +  GI
Sbjct:  474 SCNIHRNRIAGFEVKAYANPTVVRCEIH---------------------HGQTG-GIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNSIFNGNQGGVYIFGDGRGLIEGNDIYGNALAGIQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQIRTGSNPKIRRNKIWGGQNGGI 692          

HSP 3 Score: 53.9138 bits (128), Expect = 8.581e-6
Identity = 38/146 (26.03%), Postives = 66/146 (45.21%), Query Frame = 1
Query: 1822 GRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI---ARVIMDNEDI 2247
            G  E N+I  N + GI + +  NPIIR N I      G+   +  +   +   I++NR +   ++ ++ P +    I+     GI + +  +G    N I  N   G+ + +   P I GN I    Q G++I    R +++  DI
Sbjct:  424 GIYEDNEISNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHRNRIAGFEVKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNSIFNGNQGGVYIFGDGRGLIEGNDI 569          
BLAST of F-box only protein 10 vs. UniProt/SwissProt
Match: sp|Q7TSL3|FBX11_RAT (F-box only protein 11 OS=Rattus norvegicus OX=10116 GN=Fbxo11 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.402e-18
Identity = 60/211 (28.44%), Postives = 104/211 (49.29%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNRV--GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI 2217
            I++   S   + HN++H+     I +    + VI  NE+Y      + +   ++P +  N+IHS  + G+ F  N  G +E NDI +N +  G+ I   +NP IR N I    + GI++    +  ++DN I+ N  + +WI+  S P +  N I+   + GI + +G +G +  N I  N + G+L+     P +  N+I      GI I
Sbjct:  490 IQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDI-YNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGCIEDNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPVLRKNRIFDGFAAGIEI 699          

HSP 2 Score: 80.1073 bits (196), Expect = 8.425e-14
Identity = 51/193 (26.42%), Postives = 89/193 (46.11%), Query Frame = 1
Query: 1639 MHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGIS-FVSNSGRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGI 2211
            +H+     I +        I N+IY      + I  N+ P +  N I +  + G+  F    G +E NDI  N + GI I  ++ PI+R N I      GI ++E+   ++++N +Y N  + +W+   S PV+  N I+     G+   D   G + +N I ++  +G+ +     P I  N+I   +  GI
Sbjct:  413 IHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNSIFNGNQGGVYIFGDGRGLIEGNDIYGNALAGIQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQIRTGSNPKIRRNKIWGGQNGGI 605          

HSP 3 Score: 54.299 bits (129), Expect = 7.577e-6
Identity = 38/146 (26.03%), Postives = 66/146 (45.21%), Query Frame = 1
Query: 1822 GRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI---ARVIMDNEDI 2247
            G  E N+I  N + GI + +  NPIIR N I      G+   +  +   +   I++NR +   ++ ++ P +    I+     GI + +  +G    N I  N   G+ + +   P I GN I    Q G++I    R +++  DI
Sbjct:  337 GIYEDNEISNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHRNRIAGFEVKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNSIFNGNQGGVYIFGDGRGLIEGNDI 482          
BLAST of F-box only protein 10 vs. UniProt/SwissProt
Match: sp|Q86XK2|FBX11_HUMAN (F-box only protein 11 OS=Homo sapiens OX=9606 GN=FBXO11 PE=1 SV=3)

HSP 1 Score: 95.5153 bits (236), Expect = 1.671e-18
Identity = 60/211 (28.44%), Postives = 104/211 (49.29%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNRV--GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI 2217
            I++   S   + HN++H+     I +    + VI  NE+Y      + +   ++P +  N+IHS  + G+ F  N  G +E NDI +N +  G+ I   +NP IR N I    + GI++    +  ++DN I+ N  + +WI+  S P +  N I+   + GI + +G +G +  N I  N + G+L+     P +  N+I      GI I
Sbjct:  574 IQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDI-YNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGCIEDNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPILRKNRIFDGFAAGIEI 783          

HSP 2 Score: 80.1073 bits (196), Expect = 8.133e-14
Identity = 60/241 (24.90%), Postives = 103/241 (42.74%), Query Frame = 1
Query: 1498 NCNFSRSKFV-VNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGIS-FVSNSGRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGI 2211
            +CN  R++         +N  +V CE+H                     H  +G  I +        I N+IY      + I  N+ P +  N I +  + G+  F    G +E NDI  N + GI I  ++ PI+R N I      GI ++E+   ++++N +Y N  + +W+   S PV+  N I+     G+   D   G + +N I ++  +G+ +     P I  N+I   +  GI
Sbjct:  471 SCNIHRNRIAGFEVKAYANPTVVRCEIH---------------------HGQTG-GIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNSIFNGNQGGVYIFGDGRGLIEGNDIYGNALAGIQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQIRTGSNPKIRRNKIWGGQNGGI 689          

HSP 3 Score: 53.9138 bits (128), Expect = 8.869e-6
Identity = 38/146 (26.03%), Postives = 66/146 (45.21%), Query Frame = 1
Query: 1822 GRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI---ARVIMDNEDI 2247
            G  E N+I  N + GI + +  NPIIR N I      G+   +  +   +   I++NR +   ++ ++ P +    I+     GI + +  +G    N I  N   G+ + +   P I GN I    Q G++I    R +++  DI
Sbjct:  421 GIYEDNEISNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHRNRIAGFEVKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNSIFNGNQGGVYIFGDGRGLIEGNDI 566          
BLAST of F-box only protein 10 vs. TrEMBL
Match: A0A1U7RYX5 (F-box only protein 10 isoform X4 OS=Alligator sinensis OX=38654 GN=FBXO10 PE=4 SV=2)

HSP 1 Score: 266.929 bits (681), Expect = 1.763e-70
Identity = 217/859 (25.26%), Postives = 382/859 (44.47%), Query Frame = 1
Query:   82 LWLLMLEKCSICHLSADLLLLIMEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDE-KTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPNGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGI--NSQMTIYFDCDTSAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNLNNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFL---------LNQIKKSLPFHIDSH---------NVIKCN---ANTNEYLFPILRKTKSCDNLHFLRXXXXXXXXXXTIQRGRLNSLQSDFSKIQKIHTQVNLA--------LLKDHRILHLLPISLDEXXXXXXXXXXXXXXXFDDLQFDFHKASVNDSSAKSIERKSYSKFIKKCCCKDEVKQIMNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNR-VGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDLNRISGDEKWICRKH-GLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISL 2553
            +WL+ ++   I  L  +L  LI+ YL   DL RCS V  +WY +I  LDNT W++L L    G +  R                       N   + D E ++W+E ++ H++    W   ++++ + +C  + R   D+  + VGP G+ + S+R A+++ +PY  +++ PG Y+EQ +I + +P +++G G   +  + +  D      R+CN+   P WF+ ++ +   G  Q ++C+  NG++ + +PG   +++C  N   I+F       +E+CEF  +   N  + VEG+P  +R   C  L         L Q   S P     H         N+  C       +  L P LR   + +      K +  +    T + G   +L +D S  +      N            + H + H+L               +   +  + LQ DF             E KS  + +++     E + + N++ G L+  C F   K  +    +    +      D    +R  + SK  +  N +H+   + I L+  +  +I  N I+   E  ++IRK  +P +L NKIHS  + GI  + N  G +  N I  N+  GI IL++ NPI+  N I      GI +NE     + +N+I +N+     IR+   PV+  NLI   ++DG+++ +  KG I  N I  N   G+ ++   LP+I  NQI  N  +G+ +     D  D ++++  NE       S+ D   ++ ++           NDLD      S DE++  R+   +  +E NSI  N   G+   ++  + I+ NAIHAN ++G+++
Sbjct:   49 VWLVTMD---ISGLPVELWRLILSYLHLPDLGRCSMVCRAWYELILSLDNTRWRQLCL----GCIECRHP---------------------NWPNQPDVEPQSWREAFKQHYLASKTWSKNTQDLESSNCFYLFRRKKDRRVLCVGP-GYEFESLRVALAAANPYDRIVLLPGVYEEQSEIVLKVPVEIVGQGKLGDVALLVSIDQHCQTTRLCNVVFMPAWFTPVVYKTTSGHVQFDNCNFENGQLQIHAPGTCQVKFCTFNQCSINFHSVALCVLENCEFIGSE--NASVTVEGSPTSDRNWACKHLTMLAKSRSVLLQAPDSSPCSRSKHEDWGDSPVGNIRTCEIVVGGDHSNLPPALRTPPALE--QTCEKEAELNGNLYTAKEGEAMTLDTDSSDSELSTGSENEGDDQSMYKLSYQAHSLSHML---------TKVIYSRPQTNGLNALQNDF-------------ELKSLQQELQR---DKEAQSLANSLQGCLIRRCLFRDGKGGIFVCSQGQAKMEGSIFRDLTYAVRCIQSSKVIMLKNDIHHCKASGIFLRLSAGGLIADNNIHSNCEAGVDIRKGANPLILCNKIHSGLRSGIVVLGNGKGIIRSNQIYGNKEAGIYILYNGNPIVSGNHIFQGLEAGIAVNENGRGQIIENVIRENQWGGADIRRGGDPVLRNNLICCGYSDGVVVGERGKGLIEGNTIYGNKGCGVWIMASSLPHITNNQIGHNSIYGVAVFCRKDDANDYLANQGGNE-------SFNDEGEAAIWE-----------NDLD------SEDERFASRRLISVALVESNSINHNGAAGLYIKSSEALNIIANAIHANQDSGVTV 825          
BLAST of F-box only protein 10 vs. TrEMBL
Match: A0A151NDU8 (F-box only protein 10 OS=Alligator mississippiensis OX=8496 GN=FBXO10 PE=4 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 3.280e-70
Identity = 213/850 (25.06%), Postives = 378/850 (44.47%), Query Frame = 1
Query:  112 ICHLSADLLLLIMEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDE-KTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPNGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGI--NSQMTIYFDCDTSAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNLNNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFLLNQIKKSLPFHIDSHNVIKCNANTNE----------------------YLFPILRKTKSCDNLHFLRXXXXXXXXXXTIQRGRLNSLQSDFSKIQKIHTQVNLA--------LLKDHRILHLLPISLDEXXXXXXXXXXXXXXXFDDLQFDFHKASVNDSSAKSIERKSYSKFIKKCCCKDEVKQIMNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNR-VGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDLNRISGDEKWICRKH-GLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISL 2553
            I  L  +L  LI+ YL   DL RCS V  +WY +I  LDNT W++L L    G +  R                       N   + D E ++W+E ++ H++    W   ++++ + +C  + R   D+  + VGP G+ + S+R A+++ +PY  +++ PG Y+EQ +I + +P +++G G   +  + +  D      R+CN+   P WF+ ++ +   G  Q ++C+  NG++ + +PG   +++C  N   I+F       +E+CEF  +   N  + VEG+P  +R   C  L   + KS    + + +   C+ + +E                       L P LR   + +      K +  +    T + G   +L +D S  +      N            + H + H+L                 +   +   Q +   A  ND   KS+E++             E + + N++ G L+  C F   K  +    +    +      D    +R  + SK  +  N +H+   + I L+  +  +I  N I+   E  ++IRK  SP +L NKIHS  + GI  + N  G +  N I  N+  GI IL++ NPI+  N I    + GI +NE     + +N+I +N+     IR+   PV+  NLI   ++DG+++ +  KG I  N I  N   G+ ++   LP+I  NQI  N  +G+ +     D  D ++++  NE       S+ D   ++ ++           NDLD      S DE++  R+   +  +E NSI  N   G+   ++  + I+ NAIHAN ++G+++
Sbjct:   29 ISGLPVELWRLILSYLHLPDLGRCSMVCRAWYELILSLDNTRWRQLCL----GCIECRHP---------------------NWPNQPDVEPQSWREAFKQHYLASKTWSKNTQDLESSNCFYLFRRKKDRRVLCVGP-GYEFESLRVALAAANPYDRIVLLPGVYEEQSEIVLKVPVEIVGQGKLGDVALLVSIDQHCQTTRLCNVVFMPAWFTPVVYKTTSGHVQFDNCNFENGQLQIHAPGTCQVKFCTFNQCSINFHSVALCVLENCEFIGSE--NASVTVEGSPTSDRNWACKHL-TMLAKSRSVLLQAPDSSSCSRSKHEDWGDSPVGNIRTCEIVVGGDHSNLPPALRTPPALE--QTCEKEAELNGNLYTAKEGEAMTLDTDSSDSELSTGSENEGDDQSMYKLSYQAHSLSHML-----------------TKVIYSRPQTNGLNALQNDFELKSLEQELQRD--------KEAQSLANSLQGCLIRRCLFRDGKGGIFVCSQGQAKMEGSIFRDLTYAVRCIQSSKVIMLKNDIHHCKASGIFLRLSAGGLIADNNIHSNCEAGVDIRKGASPLILCNKIHSGLRSGIVVLGNGKGIIRSNQIYGNKEAGIYILYNGNPIVSGNHIFQGLAAGIAVNENGRGQIIENVIRENQWGGADIRRGGDPVLRNNLICCGYSDGVVVGERGKGLIEGNTIYGNKGCGVWIMASSLPHITNNQIGHNSIYGVAVFCRKDDANDYLANQGGNE-------SFNDEGEAAIWE-----------NDLD------SEDERFASRRLISVALVESNSINHNGAAGLYIKSSEALNIIANAIHANQDSGVTV 798          
BLAST of F-box only protein 10 vs. TrEMBL
Match: A0A5G3IK80 (Integrin alpha FG-GAP repeat containing 2 OS=Xenopus tropicalis OX=8364 GN=itfg2 PE=4 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 2.142e-69
Identity = 212/832 (25.48%), Postives = 374/832 (44.95%), Query Frame = 1
Query:  112 ICHLSADLLLLIMEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDE-KTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPNGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGI--NSQMTIYFDCDTSAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNLNNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFLLNQIKKSLPFHIDSHNVIKCNANTNEYLFPILRKTKSCDNLHFLRXXXXXXXXXXTIQRGRLNSLQSDFSKIQKIHTQVNLALLKDHRILHLLPISLDEXXXXXXXXXXXXXXXFDDLQFDFHKASVNDSSAKSIERKSYS------------KFIKKCCCKD-EVKQIMNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFV-SNSGRVEFNDICFNR-VGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDLNRISGDEKWICRKHGLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISL 2553
            I  L  +L  LI+ YL  +DL RC  V  SWY +I  LDNT W++L L    G +  R                       N   + D E ++W+E ++ H++    W   ++++ + +C  + R   D+  ++VG  G  Y ++R A++S + Y  +I+ PG Y+EQ +I++ +P +++G G   +  + +  D      R+CNL   P WF+ +M +   G  Q ++C+  NG++ + +PG   +++C  N + I F     S +E+CEF ++   N  + VEG+P  ++   C  L +   KS     ++     C   + +Y    L        +H      + +   S +     + L  D +  ++     N+   K+   + L     D +            S +   +  +H   ++   AKSI  +  +            K ++    +D E++ ++N I G L+  C F   K  V    +    +      D    +R  + SK  +  N +++   + + L+  +  +I  N I+   E  ++IRK  +P VL NKIHS  + GI  + S  G +  N I  N+  GI IL++ NPI+  N I    + GI +NE     + +N+I +N+   + IR+   PV+  NLI   ++DG+++ +  KG I  N I  N   G+ +++  LP+I  NQI  N  +G+ +     D  D ++++  NE                  +  D    AN  NDLD +  R S       R   +  IE NSI  N   G+   ++  + I+ NAIHAN + G+++
Sbjct:    3 IGGLPLELWRLILAYLPLRDLGRCGLVCRSWYDLILSLDNTRWRQLCL----GCVECRHP---------------------NWPIQPDVEPRSWREAFKQHYVASRTWTKNAQDLESSNCLYLFRRKKDRRVLYVG-YGCEYENLRTALASANIYDRIILLPGVYEEQNEITLKIPVEIMGQGKLGDVALLVCIDQQCPTSRLCNLVFMPAWFTPVMYKTSIGHVQFDNCNFENGQLQIHAPGTCQVKFCTFNQSSIHFHNVALSVLENCEFVSSE--NASVTVEGSPTSDKNWACKHL-SACAKSRNILFNASEASHCGPGSTDYFGNGL------SGVHLRTCEIMVNSDQSYLLSHAKSQLLGDKASDKENEINGNIYRCKEEEAMTLDTDYSDSDVSTISENEDDEQSVY---KLSYHSHGLSHMLAKSIHCRPQTNRLLTLQGDMSLKSLQHELQRDKELQTLVNTIQGCLIRKCLFRDGKGGVFICSQGQARLEGSIFRDLTYAVRCIQNSKVIMLKNDIYHCKASGVFLRLAAGGLIADNNIHSNTEAGVDIRKGANPVVLCNKIHSGLRSGIVVLGSGKGNIRSNQIFGNKEAGIYILYNGNPIVSGNHIFQGLAAGIAVNENGRGQITENVIRENQWGGVDIRRGGDPVLRSNLICCGYSDGVVVGERGKGLIEGNTIYGNKGCGVWIMSSSLPHITSNQIGHNGIYGVAVFCRKDDASDYLANQAGNE------------------NFNDDGEAANWENDLDSEDERFSSR-----RPMNVALIESNSINHNGAAGLYIKSSEALNIMANAIHANQDCGVAV 773          
BLAST of F-box only protein 10 vs. TrEMBL
Match: A0A3Q0GCN0 (F-box only protein 10 isoform X3 OS=Alligator sinensis OX=38654 GN=FBXO10 PE=4 SV=1)

HSP 1 Score: 263.462 bits (672), Expect = 2.727e-69
Identity = 215/860 (25.00%), Postives = 380/860 (44.19%), Query Frame = 1
Query:   82 LWLLMLEKCSICHLSADLLLLIMEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDE-KTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPNGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGI--NSQMTIYFDCDTSAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNLNNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFL---------LNQIKKSLPFHIDSH---------NVIKCN---ANTNEYLFPILRKTKSCDNLHFLRXXXXXXXXXXTIQRGRLNSLQSDFSKIQKIHTQVNLA--------LLKDHRILHLLPISLDEXXXXXXXXXXXXXXXFDDLQFDFHKASVNDSSAKSIERKSYSKFIKKCCCKDEVKQIMNNINGPLLMNCNFSRS-KFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNR-VGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDLNRISGDEKWICRKH-GLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISL 2553
            +WL+ ++   I  L  +L  LI+ YL   DL RCS V  +WY +I  LDNT W++L L    G +  R                       N   + D E ++W+E ++ H++    W   ++++ + +C  + R   D+  + VGP G+ + S+R A+++ +PY  +++ PG Y+EQ +I + +P +++G G   +  + +  D      R+CN+   P WF+ ++ +   G  Q ++C+  NG++ + +PG   +++C  N   I+F       +E+CEF  +   N  + VEG+P  +R   C  L         L Q   S P     H         N+  C       +  L P LR   + +      K +  +    T + G   +L +D S  +      N            + H + H+L   +    + +      ++     LQ +  +    D  A+S+        I++C  +D    I     G   M  +  R   + V C+  S V+                 +    +  N +H+   + I L+  +  +I  N I+   E  ++IRK  +P +L NKIHS  + GI  + N  G +  N I  N+  GI IL++ NPI+  N I      GI +NE     + +N+I +N+     IR+   PV+  NLI   ++DG+++ +  KG I  N I  N   G+ ++   LP+I  NQI  N  +G+ +     D  D ++++  NE       S+ D   ++ ++           NDLD      S DE++  R+   +  +E NSI  N   G+   ++  + I+ NAIHAN ++G+++
Sbjct:   49 VWLVTMD---ISGLPVELWRLILSYLHLPDLGRCSMVCRAWYELILSLDNTRWRQLCL----GCIECRHP---------------------NWPNQPDVEPQSWREAFKQHYLASKTWSKNTQDLESSNCFYLFRRKKDRRVLCVGP-GYEFESLRVALAAANPYDRIVLLPGVYEEQSEIVLKVPVEIVGQGKLGDVALLVSIDQHCQTTRLCNVVFMPAWFTPVVYKTTSGHVQFDNCNFENGQLQIHAPGTCQVKFCTFNQCSINFHSVALCVLENCEFIGSE--NASVTVEGSPTSDRNWACKHLTMLAKSRSVLLQAPDSSPCSRSKHEDWGDSPVGNIRTCEIVVGGDHSNLPPALRTPPALE--QTCEKEAELNGNLYTAKEGEAMTLDTDSSDSELSTGSENEGDDQSMYKLSYQAHSLSHMLTKVIYSRPQTNGLNALQNDFELKSLQQELQR----DKEAQSLANSLQGCLIRRCLFRDGKGGIFVCSQGQAKMEGSIFRDLTYAVRCIQSSKVL-----------------YRLVIMLKNDIHHCKASGIFLRLSAGGLIADNNIHSNCEAGVDIRKGANPLILCNKIHSGLRSGIVVLGNGKGIIRSNQIYGNKEAGIYILYNGNPIVSGNHIFQGLEAGIAVNENGRGQIIENVIRENQWGGADIRRGGDPVLRNNLICCGYSDGVVVGERGKGLIEGNTIYGNKGCGVWIMASSLPHITNNQIGHNSIYGVAVFCRKDDANDYLANQGGNE-------SFNDEGEAAIWE-----------NDLD------SEDERFASRRLISVALVESNSINHNGAAGLYIKSSEALNIIANAIHANQDSGVTV 830          
BLAST of F-box only protein 10 vs. TrEMBL
Match: A0A3Q0GC15 (F-box only protein 10 isoform X2 OS=Alligator sinensis OX=38654 GN=FBXO10 PE=4 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 4.097e-68
Identity = 218/876 (24.89%), Postives = 383/876 (43.72%), Query Frame = 1
Query:   82 LWLLMLEKCSICHLSADLLLLIMEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDE-KTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPNGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGI--NSQMTIYFDCDTSAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNLNNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFL---------LNQIKKSLPFHIDSH---------NVIKCN---ANTNEYLFPILRKTKSCDNLHFLRXXXXXXXXXXTIQRGRLNSLQSDFSKIQKIHTQVNLA--------LLKDHRILHLLPISLDEXXXXXXXXXXXXXXXFDDLQFDFHKASVNDSSAKSIERKSYSKFIKKCCCKDEVKQIMNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNR-VGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKN-----------------GILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDLNRISGDEKWICRKH-GLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISL 2553
            +WL+ ++   I  L  +L  LI+ YL   DL RCS V  +WY +I  LDNT W++L L    G +  R                       N   + D E ++W+E ++ H++    W   ++++ + +C  + R   D+  + VGP G+ + S+R A+++ +PY  +++ PG Y+EQ +I + +P +++G G   +  + +  D      R+CN+   P WF+ ++ +   G  Q ++C+  NG++ + +PG   +++C  N   I+F       +E+CEF  +   N  + VEG+P  +R   C  L         L Q   S P     H         N+  C       +  L P LR   + +      K +  +    T + G   +L +D S  +      N            + H + H+L               +   +  + LQ DF             E KS  + +++     E + + N++ G L+  C F   K  +    +    +      D    +R  + SK  +  N +H+   + I L+  +  +I  N I+   E  ++IRK  +P +L NKIHS  + GI  + N  G +  N I  N+  GI IL++ NPI+  N I      GI +NE     + +N+I +N+     IR+   PV+  NLI   ++DG+++ +  KG I  N I D  K                  G+ ++   LP+I  NQI  N  +G+ +     D  D ++++  NE       S+ D   ++ ++           NDLD      S DE++  R+   +  +E NSI  N   G+   ++  + I+ NAIHAN ++G+++
Sbjct:   49 VWLVTMD---ISGLPVELWRLILSYLHLPDLGRCSMVCRAWYELILSLDNTRWRQLCL----GCIECRHP---------------------NWPNQPDVEPQSWREAFKQHYLASKTWSKNTQDLESSNCFYLFRRKKDRRVLCVGP-GYEFESLRVALAAANPYDRIVLLPGVYEEQSEIVLKVPVEIVGQGKLGDVALLVSIDQHCQTTRLCNVVFMPAWFTPVVYKTTSGHVQFDNCNFENGQLQIHAPGTCQVKFCTFNQCSINFHSVALCVLENCEFIGSE--NASVTVEGSPTSDRNWACKHLTMLAKSRSVLLQAPDSSPCSRSKHEDWGDSPVGNIRTCEIVVGGDHSNLPPALRTPPALE--QTCEKEAELNGNLYTAKEGEAMTLDTDSSDSELSTGSENEGDDQSMYKLSYQAHSLSHML---------TKVIYSRPQTNGLNALQNDF-------------ELKSLQQELQR---DKEAQSLANSLQGCLIRRCLFRDGKGGIFVCSQGQAKMEGSIFRDLTYAVRCIQSSKVIMLKNDIHHCKASGIFLRLSAGGLIADNNIHSNCEAGVDIRKGANPLILCNKIHSGLRSGIVVLGNGKGIIRSNQIYGNKEAGIYILYNGNPIVSGNHIFQGLEAGIAVNENGRGQIIENVIRENQWGGADIRRGGDPVLRNNLICCGYSDGVVVGERGKGLIEGNTIYDAAKKCQTALVVRSARGGNKGCGVWIMASSLPHITNNQIGHNSIYGVAVFCRKDDANDYLANQGGNE-------SFNDEGEAAIWE-----------NDLD------SEDERFASRRLISVALVESNSINHNGAAGLYIKSSEALNIIANAIHANQDSGVTV 842          
BLAST of F-box only protein 10 vs. Ensembl Cavefish
Match: fbxo10 (F-box protein 10 [Source:ZFIN;Acc:ZDB-GENE-090313-270])

HSP 1 Score: 125.176 bits (313), Expect = 2.560e-29
Identity = 81/305 (26.56%), Postives = 138/305 (45.25%), Query Frame = 1
Query:  121 LSADLLLLIMEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDEKTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPN-GFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGINSQ--MTIYFDCDTSAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNLNNAKIS-FFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFLLNQIKKSL 1023
            L  +L  LI+ YL   DL RC  V  +W  ++  LD+T W++L LR                       +  + N+       Q    +W+E+ R H +    W L   E+ + +C  + R   D+    V    G    ++R A+++  PY  + ++PG Y+EQ ++++ +P +++G G   +  + I FD      R+CN+   P WFS +  +   G  Q+++C+    ++H+  PG    R+C+ +    + F     S V+ CEF      +  I VEG P  ER   C   L  + KSL
Sbjct:    6 LPVELWRLILAYLPLADLGRCCLVCRAWRELVLSLDSTRWRQLCLR---------------------CPECRHPNWPRRP---QLAPPSWREVLRQHALASRTWTLNGSELHSSACLHLFRRRKDRRVWRVETEAGCGAVTLRGALAAAGPYDRIHLYPGVYEEQAEVTLKVPVEIVGKGKLGEVVLMISFDQQCPTARLCNVVFMPAWFSPVAYKTSSGHVQLDNCNFEGCQLHIRGPGTCQTRFCSFSQGSSAHFLGVAISLVDSCEFSGGDSAS--ITVEGPPVSERNWACKH-LAALAKSL 283          

HSP 2 Score: 53.5286 bits (127), Expect = 1.104e-6
Identity = 37/149 (24.83%), Postives = 68/149 (45.64%), Query Frame = 1
Query: 1453 EVKQIMNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNR-VGINILHSANPI 1893
            E +++  ++ G LL  C     K  V+    +   +           +R  + +K  +  N +     + + L+  ++ +I  N I+   E  ++IRK  +P +L N+IHS  + GI  + N  G +  N I  NR  G+ IL + NP+
Sbjct:  409 EARELAGSVQGCLLHRCLLRDGKGGVHLYNHAQARLEANMFRGLNYAVRCIQNAKLVMLRNEVSGCRASGVFLRLSAQGLIAQNNIHSNGEAGLDIRKGANPIILCNRIHSGLRSGIVVLGNGKGSIRSNQIYSNREAGVYILFNGNPV 557          

HSP 3 Score: 51.9878 bits (123), Expect = 3.009e-6
Identity = 34/151 (22.52%), Postives = 71/151 (47.02%), Query Frame = 1
Query: 1729 AIEIRKNTSPNVLANKIHS---------NGKCGISFVSNS-GRVEFNDICFNRVGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLL 2151
            + E++++     LA  +           +GK G+   +++  R+E N        +  + +A  ++  N +    + G+ +   +  ++  N I+ N E+ + IRK + P+I CN I+     GI++    KG+I +N I  N + G+ +L
Sbjct:  401 SAELQRDAEARELAGSVQGCLLHRCLLRDGKGGVHLYNHAQARLEANMFRGLNYAVRCIQNAKLVMLRNEVSGCRASGVFLRLSAQGLIAQNNIHSNGEAGLDIRKGANPIILCNRIHSGLRSGIVVLGNGKGSIRSNQIYSNREAGVYIL 551          
BLAST of F-box only protein 10 vs. Ensembl Cavefish
Match: fbxo10 (F-box protein 10 [Source:ZFIN;Acc:ZDB-GENE-090313-270])

HSP 1 Score: 126.716 bits (317), Expect = 3.780e-29
Identity = 83/306 (27.12%), Postives = 137/306 (44.77%), Query Frame = 1
Query:  121 LSADLLLLIMEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTR-QDDEKTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPN-GFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGINSQ--MTIYFDCDTSAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNLNNAKIS-FFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFLLNQIKKSL 1023
            L  +L  LI+ YL   DL RC  V  +W  ++  LD+T W++L LR                           E    N   R Q    +W+E+ R H +    W L   E+ + +C  + R   D+    V    G    ++R A+++  PY  + ++PG Y+EQ ++++ +P +++G G   +  + I FD      R+CN+   P WFS +  +   G  Q+++C+    ++H+  PG    R+C+ +    + F     S V+ CEF      +  I VEG P  ER   C  L   + KSL
Sbjct:    6 LPVELWRLILAYLPLADLGRCCLVCRAWRELVLSLDSTRWRQLCLR-------------------------CPECRHPNWPRRPQLAPPSWREVLRQHALASRTWTLNGSELHSSACLHLFRRRKDRRVWRVETEAGCGAVTLRGALAAAGPYDRIHLYPGVYEEQAEVTLKVPVEIVGKGKLGEVVLMISFDQQCPTARLCNVVFMPAWFSPVAYKTSSGHVQLDNCNFEGCQLHIRGPGTCQTRFCSFSQGSSAHFLGVAISLVDSCEFSGGDSAS--ITVEGPPVSERNWACKHLA-ALAKSL 283          

HSP 2 Score: 115.546 bits (288), Expect = 1.305e-25
Identity = 95/395 (24.05%), Postives = 178/395 (45.06%), Query Frame = 1
Query: 1453 EVKQIMNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNR-VGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDE---QDNEFESNSMVSYCDTTYSSEYDEFDYSR----------------------NANDFNDLDGDL---NRISGDEKWICRKHGLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGI 2547
            E +++  ++ G LL  C     K  V+    +   +           +R  + +K  +  N +     + + L+  ++ +I  N I+   E  ++IRK  +P +L N+IHS  + GI  + N  G +  N I  NR  G+ IL + NP++  N I    + GI +NE    ++ +N+I +N+     IR+   PV+  N I   ++DG+++ +  +G I  N I  N   G+ +++  LP + GN I  N+ +G+ +     D E     E   Q+N  E   M+++ ++   SE + F   R                       +++  ++ G++   NR +G    I +   L  +  N ++ N   G++ D    +E+  N I+ NS +GI
Sbjct:  409 EARELAGSVQGCLLHRCLLRDGKGGVHLYNHAQARLEANMFRGLNYAVRCIQNAKLVMLRNEVSGCRASGVFLRLSAQGLIAQNNIHSNGEAGLDIRKGANPIILCNRIHSGLRSGIVVLGNGKGSIRSNQIYSNREAGVYILFNGNPVVSGNHIFQGLAAGIAVNENGRGLITENVIRQNQWGGADIRRGGDPVLRNNFICHGYSDGVVVGERGRGLIEGNHIYGNRGCGVWVMSSSLPQLIGNYITHNRMYGLAVF-CRKDPESERGGERGGQENFHEEGEMLAW-ESDMDSEDERFSSRRPITVALVENNCMSRNGAVGVYVKSSEALNVVGNMVSNNRAAGMS--IIQSTQLTRLVGNCVHGNGRTGVTVDRECRVELRGNGIYGNSCHGI 799          
BLAST of F-box only protein 10 vs. Ensembl Cavefish
Match: fbxo11a (F-box protein 11 [Source:NCBI gene;Acc:103042797])

HSP 1 Score: 101.293 bits (251), Expect = 2.914e-21
Identity = 66/242 (27.27%), Postives = 118/242 (48.76%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNRV--GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI---ARVIMDNEDIISDEQDNEFESNSMVSYC 2301
            I++   S   + HN++H+     I +    + VI  NE+Y      + +   ++P +  N+IHS  + G+ F  N  G +E NDI +N +  G+ I   +NP IR N I    + GI++    +  ++DN I+ N  + +WI+  S P +  N I+   + GI + +G +G +  N I  N + G+L+     P +  N+I      GI I   A   ++   I ++     F ++++VS C
Sbjct:  490 IQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDI-YNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGFIEDNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPVLRKNRIFDGFAAGIEITNHATATLEGNQIFNNRFGGLFLASALVSAC 730          

HSP 2 Score: 79.7221 bits (195), Expect = 1.245e-14
Identity = 51/193 (26.42%), Postives = 89/193 (46.11%), Query Frame = 1
Query: 1639 MHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGIS-FVSNSGRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGI 2211
            +H+     I +        I N+IY      + I  N+ P +  N I +  + G+  F    G +E NDI  N + GI I  ++ PI+R N I      GI ++E+   ++++N +Y N  + +W+   S PV+  N I+     G+   D   G + +N I ++  +G+ +     P I  N+I   +  GI
Sbjct:  413 IHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNAIFNGNQGGVYIFGDGRGLIEGNDIYGNALAGIQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQIRTGSNPKIRRNKIWGGQNGGI 605          

HSP 3 Score: 53.9138 bits (128), Expect = 1.035e-6
Identity = 38/146 (26.03%), Postives = 66/146 (45.21%), Query Frame = 1
Query: 1822 GRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI---ARVIMDNEDI 2247
            G  E N+I  N + GI + +  NPIIR N I      G+   +  +   +   I++NR +   ++ ++ P +    I+     GI + +  +G    N I  N   G+ + +   P I GN I    Q G++I    R +++  DI
Sbjct:  337 GIYEDNEISNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHRNRIAGFEVKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNAIFNGNQGGVYIFGDGRGLIEGNDI 482          
BLAST of F-box only protein 10 vs. Ensembl Cavefish
Match: fbxo11a (F-box protein 11 [Source:NCBI gene;Acc:103042797])

HSP 1 Score: 96.2857 bits (238), Expect = 1.074e-19
Identity = 60/211 (28.44%), Postives = 104/211 (49.29%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNRV--GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI 2217
            I++   S   + HN++H+     I +    + VI  NE+Y      + +   ++P +  N+IHS  + G+ F  N  G +E NDI +N +  G+ I   +NP IR N I    + GI++    +  ++DN I+ N  + +WI+  S P +  N I+   + GI + +G +G +  N I  N + G+L+     P +  N+I      GI I
Sbjct:  525 IQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDI-YNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGFIEDNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPVLRKNRIFDGFAAGIEI 734          

HSP 2 Score: 80.1073 bits (196), Expect = 8.616e-15
Identity = 60/241 (24.90%), Postives = 103/241 (42.74%), Query Frame = 1
Query: 1498 NCNFSRSKFV-VNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGIS-FVSNSGRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGI 2211
            +CN  R++         +N  +V CE+H                     H  +G  I +        I N+IY      + I  N+ P +  N I +  + G+  F    G +E NDI  N + GI I  ++ PI+R N I      GI ++E+   ++++N +Y N  + +W+   S PV+  N I+     G+   D   G + +N I ++  +G+ +     P I  N+I   +  GI
Sbjct:  422 SCNIHRNRIAGFEVKAYANPTVVRCEIH---------------------HGQTG-GIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNAIFNGNQGGVYIFGDGRGLIEGNDIYGNALAGIQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQIRTGSNPKIRRNKIWGGQNGGI 640          

HSP 3 Score: 53.9138 bits (128), Expect = 1.030e-6
Identity = 38/146 (26.03%), Postives = 66/146 (45.21%), Query Frame = 1
Query: 1822 GRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI---ARVIMDNEDI 2247
            G  E N+I  N + GI + +  NPIIR N I      G+   +  +   +   I++NR +   ++ ++ P +    I+     GI + +  +G    N I  N   G+ + +   P I GN I    Q G++I    R +++  DI
Sbjct:  372 GIYEDNEISNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHRNRIAGFEVKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNAIFNGNQGGVYIFGDGRGLIEGNDI 517          
BLAST of F-box only protein 10 vs. Ensembl Cavefish
Match: FBXO11 (F-box only protein 11-like [Source:NCBI gene;Acc:103027057])

HSP 1 Score: 96.2857 bits (238), Expect = 1.113e-19
Identity = 60/211 (28.44%), Postives = 104/211 (49.29%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNRV--GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI 2217
            I++   S   + HN++H+     I +    + VI  NE+Y      + +   ++P +  N+IHS  + G+ F  N  G +E NDI +N +  G+ I   +NP IR N I    + GI++    +  ++DN I+ N  + +WI+  S P +  N I+   + GI + +G +G +  N I  N + G+L+     P +  N+I      GI I
Sbjct:  526 IQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDI-YNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGFIEDNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPVLRKNRIFDGFAAGIEI 735          

HSP 2 Score: 80.1073 bits (196), Expect = 9.551e-15
Identity = 60/241 (24.90%), Postives = 103/241 (42.74%), Query Frame = 1
Query: 1498 NCNFSRSKFV-VNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGIS-FVSNSGRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGI 2211
            +CN  R++         +N  +V CE+H                     H  +G  I +        I N+IY      + I  N+ P +  N I +  + G+  F    G +E NDI  N + GI I  ++ PI+R N I      GI ++E+   ++++N +Y N  + +W+   S PV+  N I+     G+   D   G + +N I ++  +G+ +     P I  N+I   +  GI
Sbjct:  423 SCNIHRNRIAGFEVKAYANPTVVRCEIH---------------------HGQTG-GIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNAIFNGNQGGVYIFGDGRGLIEGNDIYGNALAGIQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQIRTGSNPKIRRNKIWGGQNGGI 641          

HSP 3 Score: 53.9138 bits (128), Expect = 1.122e-6
Identity = 38/146 (26.03%), Postives = 66/146 (45.21%), Query Frame = 1
Query: 1822 GRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI---ARVIMDNEDI 2247
            G  E N+I  N + GI + +  NPIIR N I      G+   +  +   +   I++NR +   ++ ++ P +    I+     GI + +  +G    N I  N   G+ + +   P I GN I    Q G++I    R +++  DI
Sbjct:  373 GIYEDNEISNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHRNRIAGFEVKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNAIFNGNQGGVYIFGDGRGLIEGNDI 518          
BLAST of F-box only protein 10 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003788.1 (pep scaffold:Pmarinus_7.0:GL481779:16077:20598:-1 gene:ENSPMAG00000003467.1 transcript:ENSPMAT00000003788.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.88 bits (333), Expect = 9.982e-33
Identity = 82/292 (28.08%), Postives = 140/292 (47.95%), Query Frame = 1
Query:  112 ICHLSADLLLLIMEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDEKTWKELYRNHFIWKNLWKLR-SEEVLAKSCGCVIRPLVDKS----EIHVGPNGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGINSQMT--IYFDCDTSAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNLNNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAP 966
            +  L  +L  LI+ YL+  +L RCS VS +W  ++  LD T W++L L           +    R+           N+ +     + +  +W+E  R   +   +W+   S        GC+  P   K        VGP G  Y S+R A++S+ PY  V + PG Y+EQ ++ +  P +++G G   Q+   + F+     VR+CNL +   WF+ I+ +   G  QM++C+L NG+V V++P    +R+C+ + A +       + VE+CEF  +   +  + VEG P
Sbjct:    3 VGRLPLELWRLILSYLQLPELGRCSSVSRTWRELVVSLDKTRWRQLYL----------GSPHACRR---------PPNWPLRP---ELEPPSWRESLRRALLANRVWRRHDSRWSTVDVTGCLYGPFFRKRPECRSAWVGPGG-DYESLRVALASVPPYSRVFLLPGVYEEQSEVVLRAPVEIVGQGSLGQVALLVSFEQQCPTVRLCNLVLMQAWFTPIIYKTSVGHVQMDTCNLENGQVQVSAPATCHLRFCSFSQAGLHLHAVALAAVENCEFSGSEGAS--LTVEGFP 269          
BLAST of F-box only protein 10 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006884.1 (pep scaffold:Pmarinus_7.0:GL479707:44391:56944:-1 gene:ENSPMAG00000006180.1 transcript:ENSPMAT00000006884.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.2117 bits (243), Expect = 5.219e-21
Identity = 69/252 (27.38%), Postives = 119/252 (47.22%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNRV--GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKG-----------------------TIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDN--EDIISDEQD 2265
            I++   S   + HN++H+     I +    + VI  NE+Y      + +   ++P +  N+IHS  + G+ F  N  G +E NDI +N +  G+ I   +NP IR N I    + GI++    + +++DN I+ N  + +WI+  S P +  N I+   + GI + +G +G                       T+  N I D F  GI + N     + GNQI  NK  G+ +A  ++ N  ++ I++ QD
Sbjct:  493 IQIRTNSGPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDI-YNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGVIEDNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGICIFNGGRGILEENDIFRNAQAGVLVSTNSHPTLRKNRIFDGFAAGIEITNHATATLEGNQIFNNKFGGLFLASGVIVNMKDNKIANNQD 743          

HSP 2 Score: 82.8037 bits (203), Expect = 2.524e-16
Identity = 64/255 (25.10%), Postives = 109/255 (42.75%), Query Frame = 1
Query: 1498 NCNFSRSKFV-VNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGIS-FVSNSGRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIAR----VIMDNE 2241
            +CN  R++         +N  +V CE+H                     H  +G  I +        I N+IY      + +  N+ P +  N I +  + G+  F    G +E NDI  N + GI I  ++ PI+R N I      GI ++E+   ++++N +Y N  + +W+   S PV+  N I+     G+   D   G + +N I ++  +G+ +     P I  N+I   +  GI +      VI DNE
Sbjct:  390 SCNIHRNRIAGFEVKAYANPTVVRCEIH---------------------HGQTG-GIYVHEKGRGQFIDNKIYSNNFAGVWVTSNSDPTIRGNAIFNGNQGGVYIFGEGRGLIEANDIYGNALAGIQIRTNSGPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGVIEDNE 622          

HSP 3 Score: 58.151 bits (139), Expect = 1.157e-8
Identity = 40/146 (27.40%), Postives = 68/146 (46.58%), Query Frame = 1
Query: 1822 GRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI---ARVIMDNEDI 2247
            G  E N+I  N + GI + + ANPIIR N I      G+   +  +   D   I++NR +   ++ ++ P +    I+     GI + +  +G   +N I  N   G+ + +   P I GN I    Q G++I    R +++  DI
Sbjct:  340 GTYEDNEISNNALAGIWVKNHANPIIRRNHIHHGRDVGVFTFDHGMGYFDSCNIHRNRIAGFEVKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFIDNKIYSNNFAGVWVTSNSDPTIRGNAIFNGNQGGVYIFGEGRGLIEANDI 485          
BLAST of F-box only protein 10 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009948.1 (pep scaffold:Pmarinus_7.0:GL476672:304688:326741:-1 gene:ENSPMAG00000008986.1 transcript:ENSPMAT00000009948.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.5817 bits (218), Expect = 5.254e-18
Identity = 81/306 (26.47%), Postives = 136/306 (44.44%), Query Frame = 1
Query: 1537 LLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNRV--GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDG----------------------------SKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIA---RVIMDNEDIISDEQD--NEFESNSMVSYCDTTYSSEYDEFDYSR 2346
            L+ESN +  N         I++   S   + HN++H+     I +    + VI  NE+Y      + +   ++P +  N+IHS  + G+ F  N  G +E NDI +N +  G+ I   +NP IR N I    + GI++    + +++DN I+ N  + +WI+  S P +  N I+   + GI + +G                            S  T+  N I D F  GI + N     +  NQI  NK  G+ +A   +VIM  ++ + + QD   +  S     Y  ++Y+S Y   D+ R
Sbjct:  501 LIESNDIYGNALAG-----IQIRSNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDI-YNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGVIEDNEIFDNAMAGVWIKTDSNPTLRRNKIHGGRDGGICIFNGGRVSVREGVLEENDIFRNAQAGVLISTNSHPTLRKNRIFDGFAAGIEITNHATATLEDNQIFNNKFGGLFVATGVQVIM-KDNKVGNNQDAIEKAVSRGHCLYKISSYTS-YPMHDFYR 798          

HSP 2 Score: 78.9518 bits (193), Expect = 4.327e-15
Identity = 63/255 (24.71%), Postives = 108/255 (42.35%), Query Frame = 1
Query: 1498 NCNFSRSKFV-VNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGIS-FVSNSGRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIAR----VIMDNE 2241
            +CN  R++         +N  +V CE+H                     H  +G  I +        I N+IY      + +   + P +  N I +  + G+  F    G +E NDI  N + GI I  ++ PI+R N I      GI ++E+   ++++N +Y N  + +W+   S PV+  N I+     G+   D   G + +N I ++  +G+ +     P I  N+I   +  GI +      VI DNE
Sbjct:  412 SCNIHRNRIAGFEVKAYANPTVVRCEIH---------------------HGQTG-GIYVHEKGRGQFIDNKIYSNNFAGVWVTSQSDPTIRGNTIFNGNQGGVYIFGDGRGLIESNDIYGNALAGIQIRSNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGVIEDNE 644          

HSP 3 Score: 56.9954 bits (136), Expect = 2.449e-8
Identity = 39/146 (26.71%), Postives = 69/146 (47.26%), Query Frame = 1
Query: 1822 GRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI---ARVIMDNEDI 2247
            G  E N+I  N + GI + + ANPIIR N I      G+   +  +   +   I++NR +   ++ ++ P +    I+     GI + +  +G   +N I  N   G+ + +   P I GN I    Q G++I    R ++++ DI
Sbjct:  362 GTYEDNEISNNALAGIWVKNHANPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHRNRIAGFEVKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFIDNKIYSNNFAGVWVTSQSDPTIRGNTIFNGNQGGVYIFGDGRGLIESNDI 507          
BLAST of F-box only protein 10 vs. Ensembl Nematostella
Match: EDO29952 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T259])

HSP 1 Score: 118.627 bits (296), Expect = 3.070e-28
Identity = 104/361 (28.81%), Postives = 161/361 (44.60%), Query Frame = 1
Query: 1477 INGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFN-RVGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDLNRISGDEKWICRKHGLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISL 2553
            I+G ++ N  F+  K  V      +  I   E+H     IR    +K  + +NR+HN   +A+  +  S  ++ GN I+   E  I+IR  + P +  N IHS  + G+  +    G V  NDI  N   G+ IL+  NP++R N I S  + GI I E     +  N I       + IR    PV++ N I + H DGI++ +G KG + +N I  N   G+ +L    P IYGN+I ++   GI      + N D+     DN+  ++ +V           D+   S   N   D  G      G+E  + R         NSI+ N  CGI       I I +N++  N  +GI +
Sbjct:    2 IHGCIVRNNLFNSGKGAVLVRRRGHAWIEGNEIHGLVHGIRCLTGAKIVVLNNRIHNCETSALFFRERSVGLVAGNHIFSNKEAGIDIRSCSDPIIQHNHIHSGKRSGVVVLDRGRGLVRDNDIYDNNEAGVYILYRGNPVVRHNRIWSGRAAGIAITEDGRGHISHNDICGMEWGGVDIRNGGNPVVSNNWIREGHADGIVIGEGGKGIVMDNDIRGNSGCGVWVLTIAKPVIYGNRIGESGDSGI----AFVSNSDL---HHDNQQLTSPVVQLDQDQVRPRPDKNTASAVNNIVFDNAGHGIHFCGNESLLIRA--------NSIHSNKACGICISKPADITIQDNSVCRNDSHGICI 347          

HSP 2 Score: 66.6254 bits (161), Expect = 2.315e-11
Identity = 65/256 (25.39%), Postives = 107/256 (41.80%), Query Frame = 1
Query: 1621 FIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNSG----------------------------RVEFNDICFNRVGINILHSANP--IIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSY 2298
             + +N +     + I +  G + +++ N+I G     + +     P +  N+I  +G  GI+FVSNS                                 N+I F+  G  I    N   +IR+N+I SN +CGI I++ +   + DN + +N    I I   S   I  N +Y     G+ +    KGTI  N +M N  + I +  P  PY+  N++    + G H    IM+N      E +  FES S  ++
Sbjct:  188 VVSNNWIREGHADGIVIGEGGKGIVMDNDIRGNSGCGVWVLTIAKPVIYGNRIGESGDSGIAFVSNSDLHHDNQQLTSPVVQLDQDQVRPRPDKNTASAVNNIVFDNAGHGIHFCGNESLLIRANSIHSNKACGICISKPADITIQDNSVCRNDSHGICIELGSRASIHGNGVYGNKKCGMCVS--GKGTIRENDVMSNGLHAIQIFGPGDPYVTHNRL----ESGHHNGVCIMENARGFV-EMNEIFESRSRATF 436          
BLAST of F-box only protein 10 vs. Ensembl Nematostella
Match: EDO44002 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXB9])

HSP 1 Score: 92.8189 bits (229), Expect = 2.445e-21
Identity = 64/209 (30.62%), Postives = 100/209 (47.85%), Query Frame = 1
Query:  118 HLSADLLLLIMEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDEKTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPNGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSG----INSQMTIYFDCDTSAVRMCNLFIKP 732
            +L  +L  +++ YL   DLCRCSQV   W  +++ LD+T W+ L    F G   +R                 + N+  +T   + D  +WKE Y+ H +    W  RS EV         R   ++   HVG  G  Y +IR AI+   PY  ++VH G YDEQ    +  P ++IG+G    +  QM I  +  +S+ R+ N+ ++P
Sbjct:    6 NLPLELWRVVLSYLSVVDLCRCSQVCLEWRELVRSLDSTRWREL----FLGTKKWR-----------------HPNWPTST---KKDPSSWKETYKIHHLTSKQWINRSIEVRCSPFFGTFRRRQERRVFHVG-KGKEYVTIRSAIAVASPYDRILVHSGVYDEQHFFVLKFPIEIIGAGELGDVMIQMAI--EQQSSSGRIANVVVQP 187          
BLAST of F-box only protein 10 vs. Ensembl Nematostella
Match: EDO37279 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG64])

HSP 1 Score: 93.2041 bits (230), Expect = 2.595e-19
Identity = 60/231 (25.97%), Postives = 111/231 (48.05%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNR--VGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI---ARVIMDNEDIISDEQDN 2268
            I++   S   +  N++H+     I +  G + +I  NE+Y      + +   ++P +  N+IHS  + G+ F     G +E N+I FN    GI I  ++NP IR N I    + G+++      +L++N I+ N  + +WI+  S PV+  N I+     G+ + +G +G +  N I  N   G+L+     P +  N+I      GI +   A   ++N ++ ++  D 
Sbjct:  422 IQIRTKSNPIVRCNKIHSGLHGGIYIHEGGQGLIEENEVYCNTLAGVWVTTGSTPTLRYNRIHSGKQVGVYFYDGGCGTLEDNEI-FNHKYSGIQIRSNSNPTIRRNKIWGGQNGGVLVYNEGQGVLEENEIFDNAMAGVWIKTESNPVLKRNKIHDGREGGVCIFNGGRGILEENEIFRNKLTGVLISTSSYPVLRNNRIFDGGAAGIEVTNNAGGTLENNEVFNNRFDG 651          

HSP 2 Score: 77.411 bits (189), Expect = 2.261e-14
Identity = 57/205 (27.80%), Postives = 101/205 (49.27%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNSGR--VEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNK 2199
            + ++  S   + +NR+H+     +    G    +  NEI+      I+IR N++P +  NKI   G+ G   V N G+  +E N+I  N + G+ I   +NP+++ N I      G+ I      IL++N I++N+ + + I   S PV+  N I+     GI + + + GT+ NN + +N  +GI L     P +  N +  N+
Sbjct:  468 VWVTTGSTPTLRYNRIHSGKQVGVYFYDGGCGTLEDNEIFNHKYSGIQIRSNSNPTIRRNKIWG-GQNGGVLVYNEGQGVLEENEIFDNAMAGVWIKTESNPVLKRNKIHDGREGGVCIFNGGRGILEENEIFRNKLTGVLISTSSYPVLRNNRIFDGGAAGIEVTNNAGGTLENNEVFNNRFDGICLATGVKPKLKNNSVYGNR 671          

HSP 3 Score: 76.2554 bits (186), Expect = 4.331e-14
Identity = 64/251 (25.50%), Postives = 110/251 (43.82%), Query Frame = 1
Query: 1618 AFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS------------------------GRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVS 2295
             F   N +HN+      ++  +   ++G +I+  + G I    +     L NKI+SN   GI   S S                        G +E N+I  N + GI I   +NPI+R N I S    GI I+E    ++++N +Y N  + +W+   S P +  N I+     G+   DG  GT+ +N I ++  +GI + +   P I  N+I   +  G+    V  + + ++   ++NE   N+M  
Sbjct:  315 GFYEKNNVHNNRIAGFEVRSWANPTVVGCDIHHGMTGGIYCHDDARGEFLENKIYSNTYAGIWITSQSNPTIKNNEIFDGQQGGVYVFGDGRGLIEGNNIHDNALAGIQIRTKSNPIVRCNKIHSGLHGGIYIHEGGQGLIEENEVYCNTLAGVWVTTGSTPTLRYNRIHSGKQVGVYFYDGGCGTLEDNEIFNHKYSGIQIRSNSNPTIRRNKIWGGQNGGV---LVYNEGQGVL---EENEIFDNAMAG 559          

HSP 4 Score: 60.077 bits (144), Expect = 4.545e-9
Identity = 44/192 (22.92%), Postives = 79/192 (41.15%), Query Frame = 1
Query: 1726 GAIEIRKNTSPNVLANK------------IHSNGK------CGIS-------FVSNSGRVEFNDICFNR---VGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI 2217
            G +E++   SP V   K            +H  G       C IS       FV+++ +  + D         G+ +   ANP++R NT+      G  I ++ +   + N ++ NR +   +R ++ P +    I+     GI   D ++G    N I  N   GI + +   P I  N+I   +Q G+++
Sbjct:  210 GCVEVQGECSPTVFNCKLTSLSHAGATVYVHGRGARPVVSHCAISDSENVGVFVTDAAQGLYEDCEITNTKLAGVWVRSQANPVMRRNTVHHGRDVGFFIFDQGMGFYEKNNVHNNRIAGFEVRSWANPTVVGCDIHHGMTGGIYCHDDARGEFLENKIYSNTYAGIWITSQSNPTIKNNEIFDGQQGGVYV 401          
BLAST of F-box only protein 10 vs. Ensembl Medaka
Match: fbxo10 (F-box protein 10 [Source:NCBI gene;Acc:101168677])

HSP 1 Score: 218.009 bits (554), Expect = 8.219e-58
Identity = 193/837 (23.06%), Postives = 350/837 (41.82%), Query Frame = 1
Query:  121 LSADLLLLIMEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDEKTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPNGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGINSQMTIYF----DCDTSAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNLN-NAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFLLNQIKKSLPFHIDSHNVIKCNANTNEYLFPILRKTKSCDNLHFLRXXXXXXXXXXTIQRGRLNSLQSDFSKIQKIHTQVNLA----------LLKDHRILHLL-PISLDEXXXXXXXXXXXXXXXFDDLQFDFHKASVNDSSAKSIERKSYSKFIKKCCCKDEVKQI-MNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDC---GDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNR-VGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDL---DGDLNRISGDEKWICRKHGLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISLV 2556
            L  +L  +I+ YL   DL RC QV  +W  +I  LD+T W++L L                   SE  +     N+         +  +W+E  + H +    W     E+ + +C    R   D+   HVGP G  + S+R A+    PY  V++HPG Y+EQ ++++ +P +L+G G   ++ +       C T+  R+CNL   PPWFS ++ R   G  QM++C+    ++ +  PG    R+C+ +  + +  F    S ++ C+F  +   +  + VEG P  ER   C  L    +      I S    + ++          +K          R    +    + I+ G  +   S+    +K     N A              H + HLL P+        S             LQ +  +    D  A+ +        +++C  +D    + ++N     L    F    + V C+  + +V++  E+ +C   G  +RLS  ++  I  N +H++                        E  ++IRK  +P +L NKIHS  + GI  + N  G +  N I  N+  G+ IL S NP++  N I    + GI INE    ++ +N+I +N+   + IR+   P++  N I    +DG+++ +  +G I  N +  N   G+ +++  LP + GN I  N  +G+ +     D+E++ S E +         +        E +  +   N N+  +L   + DL+   G      R   +  +E N + +N   G+   ++  + +  N +++N   GI+++
Sbjct:    6 LPMELWRVILAYLPLPDLGRCCQVCRAWRELILSLDSTRWRQLCL-----------------GCSECRHP----NWPSQPHL---EPASWREALKQHALASRTWTRNVPELQSSACLHFFRRRKDRKVWHVGP-GCEFESLRGALGVTGPYDRVVLHPGVYEEQAEVALKVPVELVGLGRLGEVALLVCIEQQCPTA--RLCNLVFMPPWFSTVVYRTSWGHVQMDNCNFEGAQLQIRGPGTCQARFCSFSQGSSLHLFSVSLSLLDSCDFSGSDTAS--VTVEGPPVSERNWACKHLAALARTFPSGFISSPKAPRASSTGGNPAGGNAKKEPVSTEEWKTRMGGDAGCHGTVIEDGWSDGDCSEGDDEKKDGRGANTAKKMFTLDYKIPYDHHGLAHLLKPLEDGTLPAASSPSPPPVTPEPLTLQEELER----DQEAQIMAASILGCIVRRCLFRDGKGGVHLSNYGQGRLEENVFRGLNYAVRCIQNATIVMLRNEVCECCASGVFLRLS--AQGLIAENNIHSNG-----------------------EAGLDIRKGANPIILCNKIHSGLRSGIVVLGNGRGSIRSNLIYNNKEAGVYILFSGNPVVSGNHIFQGQAAGIAINENGRGMITENVIKENQWGGVDIRRGGDPILRNNYICYGFSDGVVVGERGRGLIEGNHVYCNKGCGVWVMSSSLPQLLGNYIIHNCMYGLAVF-CRKDSENMESREGNWPGREGIGEAGNGERRGVEAEGREAHENFNEEGELFAWESDLDSEDGGHS-ARRSISVALVESNCLSYNGAVGLYVKSSEAMNVFANLVNSNRGPGIAVL 782          
BLAST of F-box only protein 10 vs. Ensembl Medaka
Match: ENSORLT00000038994.1 (F-box only protein 11 [Source:NCBI gene;Acc:101160686])

HSP 1 Score: 95.9005 bits (237), Expect = 1.304e-19
Identity = 60/212 (28.30%), Postives = 104/212 (49.06%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNRV--GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIA 2220
            I++   S   + HN++H+     I +    + VI  NE+Y      + +   ++P +  N+IHS  + G+ F  N  G +E NDI +N +  G+ I   +NP IR N I    + GI++    +  ++DN I+ N  + +WI+  S P +  N I+   + GI + +G +G +  N I  N + G+L+     P +  N+I      GI I 
Sbjct:  512 IQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDI-YNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGFIEDNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPVLRKNRIFDGFAAGIEIT 722          

HSP 2 Score: 79.7221 bits (195), Expect = 1.193e-14
Identity = 51/193 (26.42%), Postives = 89/193 (46.11%), Query Frame = 1
Query: 1639 MHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGIS-FVSNSGRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGI 2211
            +H+     I +        I N+IY      + I  N+ P +  N I +  + G+  F    G +E NDI  N + GI I  ++ PI+R N I      GI ++E+   ++++N +Y N  + +W+   S PV+  N I+     G+   D   G + +N I ++  +G+ +     P I  N+I   +  GI
Sbjct:  435 IHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNAIFNGNQGGVYIFGDGRGLIEGNDIYGNALAGIQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQIRTGSNPKIRRNKIWGGQNGGI 627          

HSP 3 Score: 53.9138 bits (128), Expect = 1.100e-6
Identity = 38/146 (26.03%), Postives = 66/146 (45.21%), Query Frame = 1
Query: 1822 GRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI---ARVIMDNEDI 2247
            G  E N+I  N + GI + +  NPIIR N I      G+   +  +   +   I++NR +   ++ ++ P +    I+     GI + +  +G    N I  N   G+ + +   P I GN I    Q G++I    R +++  DI
Sbjct:  359 GIYEDNEISNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHRNRIAGFEVKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNAIFNGNQGGVYIFGDGRGLIEGNDI 504          
BLAST of F-box only protein 10 vs. Ensembl Medaka
Match: ENSORLT00000013865.2 (F-box only protein 11 [Source:NCBI gene;Acc:101160686])

HSP 1 Score: 95.5153 bits (236), Expect = 1.459e-19
Identity = 60/212 (28.30%), Postives = 104/212 (49.06%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNRV--GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIA 2220
            I++   S   + HN++H+     I +    + VI  NE+Y      + +   ++P +  N+IHS  + G+ F  N  G +E NDI +N +  G+ I   +NP IR N I    + GI++    +  ++DN I+ N  + +WI+  S P +  N I+   + GI + +G +G +  N I  N + G+L+     P +  N+I      GI I 
Sbjct:  489 IQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDI-YNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGFIEDNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPVLRKNRIFDGFAAGIEIT 699          

HSP 2 Score: 74.7146 bits (182), Expect = 4.787e-13
Identity = 47/183 (25.68%), Postives = 86/183 (46.99%), Query Frame = 1
Query: 1669 LKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNSGRVEFNDICFN--RVGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGI 2211
            +K  +   ++  EI+    G I + +      + NKI++N   G+   SNS      +  FN  + GI I  ++ PI+R N I      GI ++E+   ++++N +Y N  + +W+   S PV+  N I+     G+   D   G + +N I ++  +G+ +     P I  N+I   +  GI
Sbjct:  422 VKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNAIFNGNQGGIQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQIRTGSNPKIRRNKIWGGQNGGI 604          

HSP 3 Score: 51.9878 bits (123), Expect = 3.493e-6
Identity = 36/133 (27.07%), Postives = 59/133 (44.36%), Query Frame = 1
Query: 1822 GRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHI 2217
            G  E N+I  N + GI + +  NPIIR N I      G+   +  +   +   I++NR +   ++ ++ P +    I+     GI + +  +G    N I  N   G+ + +   P I GN I    Q GI I
Sbjct:  359 GIYEDNEISNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHRNRIAGFEVKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNAIFNGNQGGIQI 491          
BLAST of F-box only protein 10 vs. Ensembl Medaka
Match: ENSORLT00000012820.2 (F-box only protein 11 [Source:NCBI gene;Acc:101167743])

HSP 1 Score: 95.5153 bits (236), Expect = 1.616e-19
Identity = 60/212 (28.30%), Postives = 104/212 (49.06%), Query Frame = 1
Query: 1594 IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNS-GRVEFNDICFNRV--GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIA 2220
            I++   S   + HN++H+     I +    + VI  NE+Y      + +   ++P +  N+IHS  + G+ F  N  G +E NDI +N +  G+ I   +NP IR N I    + GI++    +  ++DN I+ N  + +WI+  S P +  N I+   + GI + +G +G +  N I  N + G+L+     P +  N+I      GI I 
Sbjct:  538 IQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRKNRIHSGKQVGVYFYDNGHGVLEDNDI-YNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGFIEDNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPILRKNRIFDGFAAGIEIT 748          

HSP 2 Score: 67.0106 bits (162), Expect = 1.052e-10
Identity = 55/215 (25.58%), Postives = 95/215 (44.19%), Query Frame = 1
Query: 1681 SEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGI-SFVSNSGRVEFNDICFNRV-GINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSS 2319
            ++ +   NEI       I ++ + +P +  N IH     G+ +F    G  E  +I  NR+ G  +   ANP +    I    + GI ++E+      +N IY N  + +WI   S P I  N I+  +  G+ +    +G I +N I  N   GI +     P +  N+I   +  GI++       + +I   ++NE  SN++     TT S+
Sbjct:  383 AQGIYEDNEISNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFENCNIHRNRIAGFEVKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRANAIFNGNQGGVYIFGDGRGLIESNDIYGNALAGIQIRTNSCPIVRHNKIHDGQHGGIYVHE---KGQGVI---EENEVYSNTLAGVWVTTGST 591          
BLAST of F-box only protein 10 vs. Planmine SMEST
Match: SMESG000000593.1 (SMESG000000593.1)

HSP 1 Score: 1932.92 bits (5006), Expect = 0.000e+0
Identity = 984/987 (99.70%), Postives = 984/987 (99.70%), Query Frame = 1
Query:  148 MEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDEKTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPNGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGINSQMTIYFDCDTSAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNLNNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFLLNQIKKSLPFHIDSHNVIKCNANTNEYLFPILRKTKSCDNLHFLRXXXXXXXXXXTIQRGRLNSLQSDFSKIQKIHTQVNLALLKDHRILHLLPISLDEXXXXXXXXXXXXXXXFDDLQFDFHKASVNDSSAKSIERKSYSKFIKKCCCKDEVKQIMNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNSGRVEFNDICFNRVGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDLNRISGDEKWICRKHGLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISLVVPGVFGLTYGSPKLSFVDCQNETIKKFNLQNLSNIVNTFILEDSVDEPKIKVVNTKVTPYFGDNHSQWKMRHRTLGQIIKNSXXXXXXXXXXXXXXHFSAARFVIAGNGIYDNQGNGLSIQTECEIVNNDILGNNKAALQAKSRAWIYLTMNRLFSAKTTTIDVYQPSTTLICKNNIIYTASLQ 3108
            MEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDEKTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPNGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGINSQMTIYFDCDTSAVRMCNLFIKPPWFSEIMLRVRGGF QMESCDLANGEVHVTSPGVLAMRYCNLNNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFLLNQIKKSLPFHIDSHNVIK NANTNEYLFPILRKTKSCDNLHFLRKSSISSLKSSTIQRGRLNSLQSDFSKIQKIHTQVNLALLKDHRILHLLPISLDENKRNSCSGRKSSNSSFDDLQFDFHKASVNDSSAKSIERKSYSKFIKKCCCKDEVKQIMNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNSGRVEFNDICFNRVGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLN DLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDLNRISGDEKWICRKHGLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISLVVPGVFGLTYGSPKLSFVDCQNETIKKFNLQNLSNIVNTFILEDSVDEPKIKVVNTKVTPYFGDNHSQWKMRHRTLGQIIKNSITDNGGNGIIINTTHFSAARFVIAGNGIYDNQGNGLSIQTECEIVNNDILGNNKAALQAKSRAWIYLTMNRLFSAKTTTIDVYQPSTTLICKNNIIYTASLQ
Sbjct:    1 MEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDEKTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPNGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGINSQMTIYFDCDTSAVRMCNLFIKPPWFSEIMLRVRGGFVQMESCDLANGEVHVTSPGVLAMRYCNLNNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFLLNQIKKSLPFHIDSHNVIKSNANTNEYLFPILRKTKSCDNLHFLRKSSISSLKSSTIQRGRLNSLQSDFSKIQKIHTQVNLALLKDHRILHLLPISLDENKRNSCSGRKSSNSSFDDLQFDFHKASVNDSSAKSIERKSYSKFIKKCCCKDEVKQIMNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNSGRVEFNDICFNRVGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNSDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDLNRISGDEKWICRKHGLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISLVVPGVFGLTYGSPKLSFVDCQNETIKKFNLQNLSNIVNTFILEDSVDEPKIKVVNTKVTPYFGDNHSQWKMRHRTLGQIIKNSITDNGGNGIIINTTHFSAARFVIAGNGIYDNQGNGLSIQTECEIVNNDILGNNKAALQAKSRAWIYLTMNRLFSAKTTTIDVYQPSTTLICKNNIIYTASLQ 987          

HSP 2 Score: 197.978 bits (502), Expect = 2.555e-51
Identity = 99/104 (95.19%), Postives = 99/104 (95.19%), Query Frame = 3
Query: 3102 LASDVINVILENGINKTNKDKFLIKCFGAFKSANAIEYFQDSEPDASYVLHLRSSFSNENRQINSLAGLRNYPLRPIIVKDTHYVRVSIALSDAMNSFNRSPRS 3413
            L SDVINVILENGINKTNKDKFLIKCFGAFKSANAIEYFQDSEPDASYVLHL    SNENRQINSLAGLRNYPLRPIIVKDTHYVRVSIALSDAMNSFNRSPRS
Sbjct:  986 LQSDVINVILENGINKTNKDKFLIKCFGAFKSANAIEYFQDSEPDASYVLHL----SNENRQINSLAGLRNYPLRPIIVKDTHYVRVSIALSDAMNSFNRSPRS 1085          
BLAST of F-box only protein 10 vs. Planmine SMEST
Match: SMESG000000593.1 (SMESG000000593.1)

HSP 1 Score: 1932.92 bits (5006), Expect = 0.000e+0
Identity = 984/987 (99.70%), Postives = 984/987 (99.70%), Query Frame = 1
Query:  148 MEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDEKTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPNGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGINSQMTIYFDCDTSAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNLNNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFLLNQIKKSLPFHIDSHNVIKCNANTNEYLFPILRKTKSCDNLHFLRXXXXXXXXXXTIQRGRLNSLQSDFSKIQKIHTQVNLALLKDHRILHLLPISLDEXXXXXXXXXXXXXXXFDDLQFDFHKASVNDSSAKSIERKSYSKFIKKCCCKDEVKQIMNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNSGRVEFNDICFNRVGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDLNRISGDEKWICRKHGLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISLVVPGVFGLTYGSPKLSFVDCQNETIKKFNLQNLSNIVNTFILEDSVDEPKIKVVNTKVTPYFGDNHSQWKMRHRTLGQIIKNSXXXXXXXXXXXXXXHFSAARFVIAGNGIYDNQGNGLSIQTECEIVNNDILGNNKAALQAKSRAWIYLTMNRLFSAKTTTIDVYQPSTTLICKNNIIYTASLQ 3108
            MEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDEKTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPNGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGINSQMTIYFDCDTSAVRMCNLFIKPPWFSEIMLRVRGGF QMESCDLANGEVHVTSPGVLAMRYCNLNNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFLLNQIKKSLPFHIDSHNVIK NANTNEYLFPILRKTKSCDNLHFLRKSSISSLKSSTIQRGRLNSLQSDFSKIQKIHTQVNLALLKDHRILHLLPISLDENKRNSCSGRKSSNSSFDDLQFDFHKASVNDSSAKSIERKSYSKFIKKCCCKDEVKQIMNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNSGRVEFNDICFNRVGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLN DLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDLNRISGDEKWICRKHGLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISLVVPGVFGLTYGSPKLSFVDCQNETIKKFNLQNLSNIVNTFILEDSVDEPKIKVVNTKVTPYFGDNHSQWKMRHRTLGQIIKNSITDNGGNGIIINTTHFSAARFVIAGNGIYDNQGNGLSIQTECEIVNNDILGNNKAALQAKSRAWIYLTMNRLFSAKTTTIDVYQPSTTLICKNNIIYTASLQ
Sbjct:    1 MEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDEKTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPNGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGINSQMTIYFDCDTSAVRMCNLFIKPPWFSEIMLRVRGGFVQMESCDLANGEVHVTSPGVLAMRYCNLNNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFLLNQIKKSLPFHIDSHNVIKSNANTNEYLFPILRKTKSCDNLHFLRKSSISSLKSSTIQRGRLNSLQSDFSKIQKIHTQVNLALLKDHRILHLLPISLDENKRNSCSGRKSSNSSFDDLQFDFHKASVNDSSAKSIERKSYSKFIKKCCCKDEVKQIMNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNSGRVEFNDICFNRVGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNSDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDLNRISGDEKWICRKHGLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISLVVPGVFGLTYGSPKLSFVDCQNETIKKFNLQNLSNIVNTFILEDSVDEPKIKVVNTKVTPYFGDNHSQWKMRHRTLGQIIKNSITDNGGNGIIINTTHFSAARFVIAGNGIYDNQGNGLSIQTECEIVNNDILGNNKAALQAKSRAWIYLTMNRLFSAKTTTIDVYQPSTTLICKNNIIYTASLQ 987          

HSP 2 Score: 211.075 bits (536), Expect = 1.555e-55
Identity = 103/104 (99.04%), Postives = 103/104 (99.04%), Query Frame = 3
Query: 3102 LASDVINVILENGINKTNKDKFLIKCFGAFKSANAIEYFQDSEPDASYVLHLRSSFSNENRQINSLAGLRNYPLRPIIVKDTHYVRVSIALSDAMNSFNRSPRS 3413
            L SDVINVILENGINKTNKDKFLIKCFGAFKSANAIEYFQDSEPDASYVLHLRSSFSNENRQINSLAGLRNYPLRPIIVKDTHYVRVSIALSDAMNSFNRSPRS
Sbjct:  986 LQSDVINVILENGINKTNKDKFLIKCFGAFKSANAIEYFQDSEPDASYVLHLRSSFSNENRQINSLAGLRNYPLRPIIVKDTHYVRVSIALSDAMNSFNRSPRS 1089          
BLAST of F-box only protein 10 vs. Planmine SMEST
Match: SMESG000000593.1 (SMESG000000593.1)

HSP 1 Score: 1808.88 bits (4684), Expect = 0.000e+0
Identity = 910/987 (92.20%), Postives = 920/987 (93.21%), Query Frame = 1
Query:  148 MEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDEKTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPNGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGINSQMTIYFDCDTSAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAMRYCNLNNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFLLNQIKKSLPFHIDSHNVIKCNANTNEYLFPILRKTKSCDNLHFLRXXXXXXXXXXTIQRGRLNSLQSDFSKIQKIHTQVNLALLKDHRILHLLPISLDEXXXXXXXXXXXXXXXFDDLQFDFHKASVNDSSAKSIERKSYSKFIKKCCCKDEVKQIMNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNSGRVEFNDICFNRVGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDLNRISGDEKWICRKHGLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISLVVPGVFGLTYGSPKLSFVDCQNETIKKFNLQNLSNIVNTFILEDSVDEPKIKVVNTKVTPYFGDNHSQWKMRHRTLGQIIKNSXXXXXXXXXXXXXXHFSAARFVIAGNGIYDNQGNGLSIQTECEIVNNDILGNNKAALQAKSRAWIYLTMNRLFSAKTTTIDVYQPSTTLICKNNIIYTASLQ 3108
            MEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDEKTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPNGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGINSQMTIYFDCDTSAVRMCNLFIKPPWFSEIMLRVRGGF QMESCDLANGEVHVTSPGVLAMRYCNLNNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFLLNQIKKSLPFHIDSHNVIK NANTNEYLFPILRKTKSCDNLHFLR             +  ++SL+S  S IQ+ +++                                          + +  SVNDSSAKSIERKSYSKFIKKCCCKDEVKQIMNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNSGRVEFNDICFNRVGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLN DLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDLNRISGDEKWICRKHGLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISLVVPGVFGLTYGSPKLSFVDCQNETIKKFNLQNLSNIVNTFILEDSVDEPKIKVVNTKVTPYFGDNHSQWKMRHRTLGQIIKNSITDNGGNGIIINTTHFSAARFVIAGNGIYDNQGNGLSIQTECEIVNNDILGNNKAALQAKSRAWIYLTMNRLFSAKTTTIDVYQPSTTLICKNNIIYTASLQ
Sbjct:    1 MEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWKRLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDEKTWKELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPNGFRYTSIRDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGINSQMTIYFDCDTSAVRMCNLFIKPPWFSEIMLRVRGGFVQMESCDLANGEVHVTSPGVLAMRYCNLNNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCTFLLNQIKKSLPFHIDSHNVIKSNANTNEYLFPILRKTKSCDNLHFLR-------------KSSISSLKS--STIQRQNSE------------------------------------------NSYSTSVNDSSAKSIERKSYSKFIKKCCCKDEVKQIMNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDIIRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIRKNTSPNVLANKIHSNGKCGISFVSNSGRVEFNDICFNRVGINILHSANPIIRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCNLIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNSDLPYIYGNQICQNKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYSRNANDFNDLDGDLNRISGDEKWICRKHGLIHIEFNSIYFNSGCGISNDTNIPIEILNNAIHANSENGISLVVPGVFGLTYGSPKLSFVDCQNETIKKFNLQNLSNIVNTFILEDSVDEPKIKVVNTKVTPYFGDNHSQWKMRHRTLGQIIKNSITDNGGNGIIINTTHFSAARFVIAGNGIYDNQGNGLSIQTECEIVNNDILGNNKAALQAKSRAWIYLTMNRLFSAKTTTIDVYQPSTTLICKNNIIYTASLQ 930          

HSP 2 Score: 211.46 bits (537), Expect = 1.123e-55
Identity = 103/104 (99.04%), Postives = 103/104 (99.04%), Query Frame = 3
Query: 3102 LASDVINVILENGINKTNKDKFLIKCFGAFKSANAIEYFQDSEPDASYVLHLRSSFSNENRQINSLAGLRNYPLRPIIVKDTHYVRVSIALSDAMNSFNRSPRS 3413
            L SDVINVILENGINKTNKDKFLIKCFGAFKSANAIEYFQDSEPDASYVLHLRSSFSNENRQINSLAGLRNYPLRPIIVKDTHYVRVSIALSDAMNSFNRSPRS
Sbjct:  929 LQSDVINVILENGINKTNKDKFLIKCFGAFKSANAIEYFQDSEPDASYVLHLRSSFSNENRQINSLAGLRNYPLRPIIVKDTHYVRVSIALSDAMNSFNRSPRS 1032          
The following BLAST results are available for this feature:
BLAST of F-box only protein 10 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FBXO101.068e-3127.78F-box protein 10 [Source:HGNC Symbol;Acc:HGNC:1358... [more]
FBXO101.302e-3127.78F-box protein 10 [Source:HGNC Symbol;Acc:HGNC:1358... [more]
FBXO113.480e-1928.44F-box protein 11 [Source:HGNC Symbol;Acc:HGNC:1359... [more]
FBXO113.972e-1928.44F-box protein 11 [Source:HGNC Symbol;Acc:HGNC:1359... [more]
FBXO111.106e-1629.67F-box protein 11 [Source:HGNC Symbol;Acc:HGNC:1359... [more]
back to top
BLAST of F-box only protein 10 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
BE0003N10.31.135e-2228.31pep chromosome:WBcel235:III:1045809:1053246:-1 gen... [more]
BE0003N10.32.361e-2227.94pep chromosome:WBcel235:III:1045809:1052783:-1 gen... [more]
dre-12.787e-1928.30F-box protein dre-1 [Source:UniProtKB/Swiss-Prot;... [more]
dre-12.902e-1928.30F-box protein dre-1 [Source:UniProtKB/Swiss-Prot;... [more]
back to top
BLAST of F-box only protein 10 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
FBXO114.133e-2228.91gene:FBgn0037760 transcript:FBtr0334684[more]
FBXO114.133e-2228.91gene:FBgn0037760 transcript:FBtr0082155[more]
back to top
BLAST of F-box only protein 10 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxo106.739e-3126.90F-box protein 10 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
fbxo107.612e-3126.90F-box protein 10 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
fbxo108.057e-3126.90F-box protein 10 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
fbxo101.074e-3026.90F-box protein 10 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
fbxo102.648e-3026.62F-box protein 10 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
back to top
BLAST of F-box only protein 10 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itfg21.364e-7225.48integrin alpha FG-GAP repeat containing 2 [Source:... [more]
itfg21.357e-5425.11integrin alpha FG-GAP repeat containing 2 [Source:... [more]
itfg21.002e-5123.32integrin alpha FG-GAP repeat containing 2 [Source:... [more]
smad21.825e-1928.44SMAD family member 2 [Source:Xenbase;Acc:XB-GENE-4... [more]
smad21.977e-1928.44SMAD family member 2 [Source:Xenbase;Acc:XB-GENE-4... [more]
back to top
BLAST of F-box only protein 10 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fbxo104.041e-3227.45F-box protein 10 [Source:MGI Symbol;Acc:MGI:268693... [more]
Fbxo103.107e-2924.75F-box protein 10 [Source:MGI Symbol;Acc:MGI:268693... [more]
Fbxo112.002e-1928.44F-box protein 11 [Source:MGI Symbol;Acc:MGI:214713... [more]
Fbxo112.335e-1928.30F-box protein 11 [Source:MGI Symbol;Acc:MGI:214713... [more]
Fbxo112.335e-1928.30F-box protein 11 [Source:MGI Symbol;Acc:MGI:214713... [more]
back to top
BLAST of F-box only protein 10 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7TQF2|FBX10_MOUSE2.827e-3127.45F-box only protein 10 OS=Mus musculus OX=10090 GN=... [more]
sp|Q9UK96|FBX10_HUMAN5.129e-3127.78F-box only protein 10 OS=Homo sapiens OX=9606 GN=F... [more]
sp|Q7TPD1|FBX11_MOUSE1.401e-1828.44F-box only protein 11 OS=Mus musculus OX=10090 GN=... [more]
sp|Q7TSL3|FBX11_RAT1.402e-1828.44F-box only protein 11 OS=Rattus norvegicus OX=1011... [more]
sp|Q86XK2|FBX11_HUMAN1.671e-1828.44F-box only protein 11 OS=Homo sapiens OX=9606 GN=F... [more]
back to top
BLAST of F-box only protein 10 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1U7RYX51.763e-7025.26F-box only protein 10 isoform X4 OS=Alligator sine... [more]
A0A151NDU83.280e-7025.06F-box only protein 10 OS=Alligator mississippiensi... [more]
A0A5G3IK802.142e-6925.48Integrin alpha FG-GAP repeat containing 2 OS=Xenop... [more]
A0A3Q0GCN02.727e-6925.00F-box only protein 10 isoform X3 OS=Alligator sine... [more]
A0A3Q0GC154.097e-6824.89F-box only protein 10 isoform X2 OS=Alligator sine... [more]
back to top
BLAST of F-box only protein 10 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxo102.560e-2926.56F-box protein 10 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
fbxo103.780e-2927.12F-box protein 10 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
fbxo11a2.914e-2127.27F-box protein 11 [Source:NCBI gene;Acc:103042797][more]
fbxo11a1.074e-1928.44F-box protein 11 [Source:NCBI gene;Acc:103042797][more]
FBXO111.113e-1928.44F-box only protein 11-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of F-box only protein 10 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000003788.19.982e-3328.08pep scaffold:Pmarinus_7.0:GL481779:16077:20598:-1 ... [more]
ENSPMAT00000006884.15.219e-2127.38pep scaffold:Pmarinus_7.0:GL479707:44391:56944:-1 ... [more]
ENSPMAT00000009948.15.254e-1826.47pep scaffold:Pmarinus_7.0:GL476672:304688:326741:-... [more]
back to top
BLAST of F-box only protein 10 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of F-box only protein 10 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO299523.070e-2828.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO440022.445e-2130.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372792.595e-1925.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of F-box only protein 10 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
fbxo108.219e-5823.06F-box protein 10 [Source:NCBI gene;Acc:101168677][more]
ENSORLT00000038994.11.304e-1928.30F-box only protein 11 [Source:NCBI gene;Acc:101160... [more]
ENSORLT00000013865.21.459e-1928.30F-box only protein 11 [Source:NCBI gene;Acc:101160... [more]
ENSORLT00000012820.21.616e-1928.30F-box only protein 11 [Source:NCBI gene;Acc:101167... [more]
back to top
BLAST of F-box only protein 10 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000000593.12.555e-5199.70SMESG000000593.1[more]
SMESG000000593.11.555e-5599.70SMESG000000593.1[more]
SMESG000000593.11.123e-5592.20SMESG000000593.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019474 ID=SMED30019474|Name=F-box only protein 10|organism=Schmidtea mediterranea sexual|type=transcript|length=3413bp
ACAATTTTAAGTTTAATTAACATAATTTCTTATCTATTAAAGCAGTTATT
AACTGATTATTTGATTGAATATTTTTAATATCTTTGGCTTCTAATGCTTG
AAAAATGCAGTATATGCCATCTATCCGCCGACTTACTTCTATTAATAATG
GAGTATTTAGAAGCCAAAGATCTATGTCGATGTTCTCAAGTGTCTTGGTC
ATGGTATTATATTATTAAATATTTGGATAATACTACTTGGAAAAGATTGG
TTTTGCGAGATTTTTCTGGTATTCTGAATTTCAGATCTACAATAATGTAT
TTTCGAAAATTATCCGAAATAAATAATGATTTAATTAATGAGAACTTTTT
AATGAATACGTTTACGCGTCAGGACGACGAGAAAACATGGAAAGAATTAT
ATCGTAATCATTTTATCTGGAAAAACCTTTGGAAACTTCGATCAGAAGAA
GTTCTAGCTAAATCTTGTGGTTGTGTTATTCGACCATTAGTTGACAAATC
TGAAATACATGTTGGTCCCAATGGATTCCGTTATACCTCCATCAGGGATG
CCATATCAAGTATCCACCCATATTGCACAGTTATTGTTCATCCTGGCAAT
TACGATGAGCAAGTTAAAATATCAGTCCTTATGCCTTTTCAGCTTATTGG
ATCTGGAATAAATAGTCAAATGACAATTTATTTTGACTGTGATACTTCGG
CTGTGAGGATGTGCAATTTATTCATCAAACCTCCTTGGTTCAGTGAAATT
ATGTTGAGAGTCCGAGGAGGTTTCGCTCAGATGGAATCGTGTGACTTAGC
GAATGGAGAAGTTCACGTTACGAGCCCCGGTGTATTGGCTATGCGTTACT
GCAACTTGAATAATGCCAAAATTTCTTTCTTTAAAAGTTGTTGTTCAACA
GTTGAACATTGCGAATTCCAAAACAATACAGATTTTAACGAATTTATCCA
CGTTGAAGGTGCTCCACGATACGAAAGAATTACTGTCTGCACATTTTTAT
TGAACCAGATTAAAAAATCTCTTCCTTTTCATATAGACTCGCACAATGTC
ATAAAATGCAATGCCAATACGAACGAATATTTATTTCCTATTTTGAGAAA
AACAAAAAGTTGTGATAATCTACATTTTCTTCGAAAATCTTCAATAAGTT
CTTTAAAATCCTCAACGATCCAAAGAGGTCGTTTAAATTCCTTGCAATCA
GACTTCAGCAAAATTCAGAAAATTCATACTCAAGTTAATCTGGCGTTACT
CAAGGACCACCGAATCTTGCACTTGCTTCCGATTTCCCTGGATGAGAATA
AGCGGAATAGTTGCTCTGGTAGAAAATCCAGTAACAGCTCGTTTGACGAT
CTTCAATTTGATTTCCACAAAGCTTCAGTAAATGATTCCTCCGCAAAGAG
TATTGAAAGAAAGTCTTATTCGAAATTCATTAAGAAATGTTGCTGTAAAG
ATGAAGTTAAACAAATTATGAACAATATCAATGGACCACTGTTGATGAAT
TGCAATTTCTCTCGCAGCAAATTCGTTGTAAATTGCTTGCTTGAGTCTAA
CGTCGTAATAGTCAATTGCGAAATGCATGACTGTGGGGATATCATTCGGC
TGTCCCGATTTAGCAAGGCTTTTATTTATCATAATAGAATGCATAATTCG
TCAGGCAATGCCATATGCTTAAAGCATGGCTCTGAAGCCGTTATCATAGG
CAATGAAATATACGGAATGGTAGAGGGCGCTATCGAAATTCGGAAGAATA
CATCACCTAATGTTTTAGCAAATAAAATTCACTCAAATGGAAAATGTGGA
ATTTCTTTCGTTTCCAATAGTGGACGTGTAGAATTCAATGATATATGCTT
TAATAGGGTCGGTATCAACATTTTGCACTCTGCCAACCCAATTATTCGAT
CAAATACAATTCGTTCAAATAATTCCTGTGGTATTATTATTAACGAAAGA
AGCATCAGTATTTTAGATGACAACTTAATTTATAAAAATCGAGAGTCAAA
TATTTGGATTCGAAAGTTTTCGGCACCTGTTATCACCTGTAACCTTATTT
ATCAAGCTCATAATGATGGGATTATATTAGATGATGGAAGCAAGGGTACA
ATTGCAAACAATATAATTATGGATAATTTCAAAAATGGTATTTTGTTGTT
AAACCCTGATTTGCCATATATTTATGGAAACCAAATTTGCCAGAATAAAC
AACACGGTATTCATATCGCGAGGGTCATAATGGATAATGAAGATATTATT
AGTGATGAACAAGATAACGAATTTGAAAGCAACTCAATGGTATCATACTG
TGACACTACTTATAGCAGTGAATATGATGAATTTGATTATTCGAGGAATG
CCAATGATTTCAATGATCTTGATGGAGATCTTAATAGAATAAGTGGAGAT
GAGAAATGGATCTGTCGAAAACACGGTTTAATTCATATCGAGTTCAATTC
CATTTATTTTAATTCAGGATGTGGAATATCAAATGATACAAATATCCCAA
TAGAAATACTTAATAACGCAATTCATGCCAATTCAGAAAATGGAATATCT
CTTGTTGTTCCAGGGGTTTTCGGACTCACTTACGGATCACCGAAATTATC
GTTCGTAGACTGCCAAAACGAAACTATAAAAAAATTCAATTTACAGAATT
TGTCGAATATTGTAAATACCTTTATTCTTGAGGACAGTGTTGATGAACCT
AAAATTAAAGTTGTTAATACAAAAGTCACTCCATATTTTGGAGACAATCA
TTCTCAATGGAAAATGCGCCATAGAACGCTAGGACAGATTATAAAGAACA
GTATTACTGATAATGGAGGAAATGGGATAATAATCAACACCACCCATTTC
TCGGCAGCGAGATTCGTGATTGCTGGTAACGGTATTTATGACAACCAAGG
AAATGGCCTATCTATCCAAACAGAATGTGAAATAGTCAACAACGACATTT
TAGGTAACAACAAAGCAGCATTGCAAGCAAAATCTCGTGCTTGGATTTAT
CTAACAATGAATCGGTTGTTTTCTGCTAAAACAACTACAATTGATGTTTA
TCAACCTTCTACAACCCTCATATGCAAGAATAACATAATTTACACAGCCT
CCTTGCAAGTGATGTCATAAATGTAATATTAGAAAACGGTATAAATAAGA
CAAACAAGGATAAGTTTTTGATAAAATGTTTTGGTGCATTCAAATCTGCC
AATGCAATTGAATATTTCCAGGACAGTGAGCCTGACGCGTCCTATGTGCT
GCATCTCAGGTCCTCATTCAGTAATGAAAATCGGCAGATAAATTCATTAG
CAGGGTTGCGCAATTATCCATTGCGGCCTATCATAGTAAAAGATACTCAT
TATGTAAGAGTTAGTATTGCGCTATCAGATGCGATGAATTCATTCAATAG
ATCACCGAGATCG
back to top

protein sequence of SMED30019474-orf-1

>SMED30019474-orf-1 ID=SMED30019474-orf-1|Name=SMED30019474-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1009bp
MLEKCSICHLSADLLLLIMEYLEAKDLCRCSQVSWSWYYIIKYLDNTTWK
RLVLRDFSGILNFRSTIMYFRKLSEINNDLINENFLMNTFTRQDDEKTWK
ELYRNHFIWKNLWKLRSEEVLAKSCGCVIRPLVDKSEIHVGPNGFRYTSI
RDAISSIHPYCTVIVHPGNYDEQVKISVLMPFQLIGSGINSQMTIYFDCD
TSAVRMCNLFIKPPWFSEIMLRVRGGFAQMESCDLANGEVHVTSPGVLAM
RYCNLNNAKISFFKSCCSTVEHCEFQNNTDFNEFIHVEGAPRYERITVCT
FLLNQIKKSLPFHIDSHNVIKCNANTNEYLFPILRKTKSCDNLHFLRKSS
ISSLKSSTIQRGRLNSLQSDFSKIQKIHTQVNLALLKDHRILHLLPISLD
ENKRNSCSGRKSSNSSFDDLQFDFHKASVNDSSAKSIERKSYSKFIKKCC
CKDEVKQIMNNINGPLLMNCNFSRSKFVVNCLLESNVVIVNCEMHDCGDI
IRLSRFSKAFIYHNRMHNSSGNAICLKHGSEAVIIGNEIYGMVEGAIEIR
KNTSPNVLANKIHSNGKCGISFVSNSGRVEFNDICFNRVGINILHSANPI
IRSNTIRSNNSCGIIINERSISILDDNLIYKNRESNIWIRKFSAPVITCN
LIYQAHNDGIILDDGSKGTIANNIIMDNFKNGILLLNPDLPYIYGNQICQ
NKQHGIHIARVIMDNEDIISDEQDNEFESNSMVSYCDTTYSSEYDEFDYS
RNANDFNDLDGDLNRISGDEKWICRKHGLIHIEFNSIYFNSGCGISNDTN
IPIEILNNAIHANSENGISLVVPGVFGLTYGSPKLSFVDCQNETIKKFNL
QNLSNIVNTFILEDSVDEPKIKVVNTKVTPYFGDNHSQWKMRHRTLGQII
KNSITDNGGNGIIINTTHFSAARFVIAGNGIYDNQGNGLSIQTECEIVNN
DILGNNKAALQAKSRAWIYLTMNRLFSAKTTTIDVYQPSTTLICKNNIIY
TASLQVMS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000136whole organism
PLANA:0000231vitelline gland
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR039448Beta_helix
IPR022441Para_beta_helix_rpt-2
IPR036047F-box-like_dom_sf
IPR001810F-box_dom
IPR006626PbH1
IPR007742NosD_dom
IPR012334Pectin_lyas_fold
IPR011050Pectin_lyase_fold/virulence
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
Vocabulary: cellular component
TermDefinition
GO:0000151ubiquitin ligase complex
GO:0005737cytoplasm
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:0000209protein polyubiquitination
GO:0006915apoptotic process
GO:0016567protein ubiquitination
GO:0042787protein ubiquitination involved in ubiquitin-dependent protein catabolic process
GO:0042981regulation of apoptotic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001810F-box domainSMARTSM00256fbox_2coord: 10..52
e-value: 6.5E-7
score: 39.0
IPR001810F-box domainPFAMPF00646F-boxcoord: 6..49
e-value: 1.9E-9
score: 37.1
IPR001810F-box domainPROSITEPS50181FBOXcoord: 4..52
score: 10.027
IPR006626Parallel beta-helix repeatSMARTSM00710pbh1coord: 665..687
e-value: 130.0
score: 11.4
coord: 894..916
e-value: 840.0
score: 7.8
coord: 921..943
e-value: 66.0
score: 12.4
coord: 800..822
e-value: 1700.0
score: 5.6
coord: 688..710
e-value: 350.0
score: 10.0
coord: 529..551
e-value: 1600.0
score: 5.9
coord: 506..528
e-value: 2100.0
score: 4.9
coord: 619..641
e-value: 4700.0
score: 2.4
coord: 574..595
e-value: 4700.0
score: 2.4
coord: 484..505
e-value: 9200.0
score: 0.3
coord: 596..618
e-value: 50.0
score: 12.8
IPR012334Pectin lyase foldGENE3DG3DSA:2.160.20.10coord: 894..1007
e-value: 2.5E-8
score: 35.1
coord: 614..758
e-value: 6.9E-15
score: 56.7
IPR012334Pectin lyase foldGENE3DG3DSA:2.160.20.10coord: 397..613
e-value: 3.8E-11
score: 44.6
IPR039448Right handed beta helix domainPFAMPF13229Beta_helixcoord: 590..709
e-value: 9.6E-13
score: 48.3
IPR007742Periplasmic copper-binding protein NosD, beta helix domainPFAMPF05048NosDcoord: 458..580
e-value: 1.9E-5
score: 24.0
IPR022441Parallel beta-helix repeat-2TIGRFAMTIGR03804TIGR03804coord: 659..701
e-value: 6.7E-5
score: 20.5
NoneNo IPR availablePANTHERPTHR22990F-BOX ONLY PROTEINcoord: 15..710
coord: 691..1001
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.602
IPR036047F-box-like domain superfamilySUPERFAMILYSSF81383F-box domaincoord: 2..111
IPR011050Pectin lyase fold/virulence factorSUPERFAMILYSSF51126Pectin lyase-likecoord: 148..579
IPR011050Pectin lyase fold/virulence factorSUPERFAMILYSSF51126Pectin lyase-likecoord: 586..743