Synaptotagmin

Overview
NameSynaptotagmin
Smed IDSMED30019471
Length (bp)1910
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Synaptotagmin (SMED30019471) t-SNE clustered cells

Violin plots show distribution of expression levels for Synaptotagmin (SMED30019471) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Synaptotagmin (SMED30019471) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Synaptotagmin (SMED30019471) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019471

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30019471SMESG000055143.1 SmedASXL_012671SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30019471SMESG000055143.1 Contig48026newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019471SMESG000055143.1 Contig48026uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30019471SMESG000055143.1 dd_Smed_v4_6730_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019471SMESG000055143.1 dd_Smed_v4_6730_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30019471SMESG000055143.1 dd_Smed_v4_6730_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30019471SMESG000055143.1 dd_Smed_v4_6730_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30019471SMESG000055143.1 dd_Smed_v4_6730_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30019471SMESG000055143.1 dd_Smed_v4_6730_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30019471SMESG000055143.1 dd_Smed_v6_6730_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30019471SMESG000055143.1 dd_Smed_v6_6730_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30019471SMESG000055143.1 dd_Smed_v6_6730_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Synaptotagmin vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 415.616 bits (1067), Expect = 6.524e-140
Identity = 231/367 (62.94%), Postives = 278/367 (75.75%), Query Frame = 1
Query:  427 EKTLKTFH---MSTGTLIGIGVTVSIVVLLLLYCX-XXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            EK +   H   +    LI I +   ++VL   +CI  K   KK+ KKK   K G   ++MK V+ LG   K++   D +      +  E  + KE   LGKLQYSLDYDF   +L VG+IQA +LPA+DM GTSDPYVKVFLLPDKKKKFETKVHRK LNPVFNE F FK+PYSE+G KTLV  V+DFDRFSKHD IG+ ++P+ +VD   V EEW++L    ++ E++ +LGDICFSLRYVPT+GKL +VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG+V +G N+TGAELRHWSDMLANPRRPIAQWHTLQ
Sbjct:   45 EKFMNELHKIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 409          
BLAST of Synaptotagmin vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 415.616 bits (1067), Expect = 6.524e-140
Identity = 231/367 (62.94%), Postives = 278/367 (75.75%), Query Frame = 1
Query:  427 EKTLKTFH---MSTGTLIGIGVTVSIVVLLLLYCX-XXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            EK +   H   +    LI I +   ++VL   +CI  K   KK+ KKK   K G   ++MK V+ LG   K++   D +      +  E  + KE   LGKLQYSLDYDF   +L VG+IQA +LPA+DM GTSDPYVKVFLLPDKKKKFETKVHRK LNPVFNE F FK+PYSE+G KTLV  V+DFDRFSKHD IG+ ++P+ +VD   V EEW++L    ++ E++ +LGDICFSLRYVPT+GKL +VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG+V +G N+TGAELRHWSDMLANPRRPIAQWHTLQ
Sbjct:   45 EKFMNELHKIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 409          
BLAST of Synaptotagmin vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 415.616 bits (1067), Expect = 6.524e-140
Identity = 231/367 (62.94%), Postives = 278/367 (75.75%), Query Frame = 1
Query:  427 EKTLKTFH---MSTGTLIGIGVTVSIVVLLLLYCX-XXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            EK +   H   +    LI I +   ++VL   +CI  K   KK+ KKK   K G   ++MK V+ LG   K++   D +      +  E  + KE   LGKLQYSLDYDF   +L VG+IQA +LPA+DM GTSDPYVKVFLLPDKKKKFETKVHRK LNPVFNE F FK+PYSE+G KTLV  V+DFDRFSKHD IG+ ++P+ +VD   V EEW++L    ++ E++ +LGDICFSLRYVPT+GKL +VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG+V +G N+TGAELRHWSDMLANPRRPIAQWHTLQ
Sbjct:   45 EKFMNELHKIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 409          
BLAST of Synaptotagmin vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 412.535 bits (1059), Expect = 1.235e-138
Identity = 231/370 (62.43%), Postives = 279/370 (75.41%), Query Frame = 1
Query:  427 EKTLKTFH---MSTGTLIGIGVTVSIVVLLLLYCX-XXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVN---LGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            EK +   H   +    LI I +   ++VL   +CI  K   KK+ KKK   K G   ++MK V+ LG   K+      ++ DA     +G + +E      LGKLQYSLDYDF   +L VG+IQA +LPA+DM GTSDPYVKVFLLPDKKKKFETKVHRK LNPVFNE F FK+PYSE+G KTLV  V+DFDRFSKHD IG+ ++P+ +VD   V EEW++L    ++ E++ +LGDICFSLRYVPT+GKL +VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG+V +G N+TGAELRHWSDMLANPRRPIAQWHTLQ
Sbjct:   45 EKFMNELHKIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKD------QDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 406          
BLAST of Synaptotagmin vs. Ensembl Human
Match: SYT2 (synaptotagmin 2 [Source:HGNC Symbol;Acc:HGNC:11510])

HSP 1 Score: 402.519 bits (1033), Expect = 9.607e-135
Identity = 200/302 (66.23%), Postives = 243/302 (80.46%), Query Frame = 1
Query:  664 NMEDNEGAQDKE------------------AVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            NM+D +G QD +                    NLGKLQ+SLDYDF   +LTVGV+QA +LPA+DM GTSDPYVKVFLLPDKKKK+ETKVHRK LNP FNETF FK+PY E+G KTLV  ++DFDRFSKHD IG++++P+ +VDL + IEEW++L     + E+  +LGDIC SLRYVPT+GKL + ILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTT+KK TLNPY+NESFSFE+PFEQIQKV ++VTV+DYD++G +E IG++ +G NATG ELRHWSDMLANPRRPIAQWH+L+
Sbjct:  107 NMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQ--GGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLK 406          

HSP 2 Score: 85.5001 bits (210), Expect = 4.061e-17
Identity = 53/145 (36.55%), Postives = 85/145 (58.62%), Query Frame = 1
Query:  643 DLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKK--KFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKEL 1071
            DL +      D +G + +E   LG +  SL Y  T G+LTV +++A +L  MD+ G SDPYVK+ L+ + K+  K +T V +K LNP FNE+F F+IP+ ++    +V  V D+D+  K++ IG+I +  GS      +  W ++
Sbjct:  249 DLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFV--GSNATGTELRHWSDM 391          
BLAST of Synaptotagmin vs. Ensembl Celegans
Match: snt-1 (Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:P34693])

HSP 1 Score: 411.764 bits (1057), Expect = 1.518e-138
Identity = 236/408 (57.84%), Postives = 299/408 (73.28%), Query Frame = 1
Query:  322 MQQNVEKSVSQHVTAQTKESTSNKLHTTTAGIS--VLEKTLKTFHMSTGTLIGIGVTVSIVVLLLLYCXXXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVN--LGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEKS 1533
            M++   ++V Q  T  TKE+  + +      +   V EK ++   M     + +G    ++VL   +C+ ++   K++  +   K G KG   K   ++     + +  DLEEL   ME NE  Q +E     LG++QY LDYDF +G+LTV VIQA DLP MDMSGTSDPYVK++LLP+KKKK ETKVHRK LNPVFNETF+FK+ ++E+ +KTLVF ++DFDRFSKHDQIGQ+ IPLG +DL  VIEEWK++ PP  D E E  LGDICFSLRYVPT+GKL +VILEAKNLKKMDVGGLSDPYVK+ LM  GKR+KKKKT+IKK TLNPYYNESFSFEVPFEQIQKV+L++TV+DYD++G+++ IGR +LGCN TGAELRHW DMLA+PRRPIAQWHTL  + E+ 
Sbjct:   28 MEETTSEAVKQIATT-TKETLKDVVVNKVIDVKDVVKEKVMQQTGMPEWAFVFLGFVFILLVLACAFCLIRKLFGKKRHGEKNKKGGLKGFFGKGQDVVDGKNIQGMAQDLEELGDAMEQNEKEQAEEKEEVKLGRIQYKLDYDFQQGQLTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPPDDKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIVLMQGGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKVSLMITVMDYDKLGSNDAIGRCLLGCNGTGAELRHWMDMLASPRRPIAQWHTLGPVEEEG 434          

HSP 2 Score: 82.4185 bits (202), Expect = 2.046e-16
Identity = 51/153 (33.33%), Postives = 89/153 (58.17%), Query Frame = 1
Query:  691 DKEA-VNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKK--KFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGS--------VDLC----KVIEEWKELGPPDSDNEKEN 1104
            DKEA  +LG + +SL Y  T G+LTV +++A +L  MD+ G SDPYVK+ L+   K+  K +T + +  LNP +NE+F F++P+ ++   +L+  V D+D+   +D IG+  +            +D+     + I +W  LGP + + +K++
Sbjct:  286 DKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIVLMQGGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKVSLMITVMDYDKLGSNDAIGRCLLGCNGTGAELRHWMDMLASPRRPIAQWHTLGPVEEEGDKKD 438          
BLAST of Synaptotagmin vs. Ensembl Celegans
Match: snt-1 (Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:P34693])

HSP 1 Score: 383.259 bits (983), Expect = 2.075e-127
Identity = 223/410 (54.39%), Postives = 294/410 (71.71%), Query Frame = 1
Query:  322 MQQNVEKSVSQHVTAQTKESTSNKLHTTTAGIS--VLEKTLKTFHMSTGTLIGIGVTVSIVVLLLLYCXXXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVN--LGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLM-LNGXXXXXXXXXXXXXXLNPYYNESFSFE-VPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEKS 1533
            M++   ++V Q +   TKE+  + +      +   V EK ++   M     + +G    ++VL   +C+ ++   K++  +   K G KG   K   ++     + +  DLEEL   ME NE  Q +E     LG++QY LDYDF +G+LTV VIQA DLP MDMSGTSDPYVK++LLP+KKKK ETKVHRK LNPVFNETF+FK+ ++E+ +KTLVF ++DFDRFSKHDQIGQ+ IPLG +DL  VIEEWK++ PP  D E E  LGDICFSLRYVPT+GKL +VILEAKNLKKMDVGGLSDPYVKL +   + KR+KKKKT IK+ TLNPY+NESF F+ +P  +++KV+L++TV+DYD++G+++ IGR +LGCN TGAELRHW DMLA+PRRPIAQWHTL  + E+ 
Sbjct:   28 MEETTSEAVKQ-IATTTKETLKDVVVNKVIDVKDVVKEKVMQQTGMPEWAFVFLGFVFILLVLACAFCLIRKLFGKKRHGEKNKKGGLKGFFGKGQDVVDGKNIQGMAQDLEELGDAMEQNEKEQAEEKEEVKLGRIQYKLDYDFQQGQLTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPPDDKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKLEMFGEDRKRLKKKKTNIKRKTLNPYFNESFVFDKLPLHKMKKVSLMITVMDYDKLGSNDAIGRCLLGCNGTGAELRHWMDMLASPRRPIAQWHTLGPVEEEG 436          

HSP 2 Score: 79.337 bits (194), Expect = 2.103e-15
Identity = 52/155 (33.55%), Postives = 87/155 (56.13%), Query Frame = 1
Query:  691 DKEA-VNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRK---ILNPVFNETFVF-KIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGS--------VDLC----KVIEEWKELGPPDSDNEKEN 1104
            DKEA  +LG + +SL Y  T G+LTV +++A +L  MD+ G SDPYVK+ +  + +K+ + K        LNP FNE+FVF K+P  ++   +L+  V D+D+   +D IG+  +            +D+     + I +W  LGP + + +K++
Sbjct:  286 DKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKLEMFGEDRKRLKKKKTNIKRKTLNPYFNESFVFDKLPLHKMKKVSLMITVMDYDKLGSNDAIGRCLLGCNGTGAELRHWMDMLASPRRPIAQWHTLGPVEEEGDKKD 440          
BLAST of Synaptotagmin vs. Ensembl Celegans
Match: snt-3 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5])

HSP 1 Score: 350.132 bits (897), Expect = 8.559e-117
Identity = 176/268 (65.67%), Postives = 214/268 (79.85%), Query Frame = 1
Query:  709 LGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTL 1512
            LG+LQY LDYDF K  LTV +IQA +LPAMD+ GTSDPYVK+FLLPDKKKK +TKV RK LNPVFNE+F FKIP++E+G +TLV NVFDFDRF KHDQIGQI IPLG VDL   +E    +  P      ENRLG++C +LRYVP   KL++V++E KNLKKMDV GLSDPYVK+ LM+  KR++KKKTTIK  TLNPYYNESFSF+V  E++Q+V+L VTV DYDR+G++E IG+V++G  ATG  L+ W+DMLA PRR +AQWHTL
Sbjct:   16 LGRLQYKLDYDFDKNSLTVVIIQAEELPAMDLGGTSDPYVKLFLLPDKKKKLQTKVQRKSLNPVFNESFTFKIPFNEIGGQTLVLNVFDFDRFGKHDQIGQISIPLGKVDLAATLERTDLIESP-----PENRLGEVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSFDVTSEKMQRVHLHVTVSDYDRVGSNERIGQVIIGTCATGVALKQWNDMLATPRRSVAQWHTL 278          

HSP 2 Score: 66.6254 bits (161), Expect = 9.015e-12
Identity = 44/142 (30.99%), Postives = 79/142 (55.63%), Query Frame = 1
Query:  652 ELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKK--KFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKEL 1071
            +L A +E  +  +      LG++  +L Y   K +L+V V++  +L  MD+ G SDPYVK++L+   K+  K +T +  K LNP +NE+F F +   ++    L   V D+DR   +++IGQ+ I  G+      +++W ++
Sbjct:  125 DLAATLERTDLIESPPENRLGEVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSFDVTSEKMQRVHLHVTVSDYDRVGSNERIGQVII--GTCATGVALKQWNDM 264          
BLAST of Synaptotagmin vs. Ensembl Celegans
Match: snt-3 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5])

HSP 1 Score: 350.132 bits (897), Expect = 8.559e-117
Identity = 176/268 (65.67%), Postives = 214/268 (79.85%), Query Frame = 1
Query:  709 LGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTL 1512
            LG+LQY LDYDF K  LTV +IQA +LPAMD+ GTSDPYVK+FLLPDKKKK +TKV RK LNPVFNE+F FKIP++E+G +TLV NVFDFDRF KHDQIGQI IPLG VDL   +E    +  P      ENRLG++C +LRYVP   KL++V++E KNLKKMDV GLSDPYVK+ LM+  KR++KKKTTIK  TLNPYYNESFSF+V  E++Q+V+L VTV DYDR+G++E IG+V++G  ATG  L+ W+DMLA PRR +AQWHTL
Sbjct:   16 LGRLQYKLDYDFDKNSLTVVIIQAEELPAMDLGGTSDPYVKLFLLPDKKKKLQTKVQRKSLNPVFNESFTFKIPFNEIGGQTLVLNVFDFDRFGKHDQIGQISIPLGKVDLAATLERTDLIESP-----PENRLGEVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSFDVTSEKMQRVHLHVTVSDYDRVGSNERIGQVIIGTCATGVALKQWNDMLATPRRSVAQWHTL 278          

HSP 2 Score: 66.6254 bits (161), Expect = 9.015e-12
Identity = 44/142 (30.99%), Postives = 79/142 (55.63%), Query Frame = 1
Query:  652 ELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKK--KFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKEL 1071
            +L A +E  +  +      LG++  +L Y   K +L+V V++  +L  MD+ G SDPYVK++L+   K+  K +T +  K LNP +NE+F F +   ++    L   V D+DR   +++IGQ+ I  G+      +++W ++
Sbjct:  125 DLAATLERTDLIESPPENRLGEVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSFDVTSEKMQRVHLHVTVSDYDRVGSNERIGQVII--GTCATGVALKQWNDM 264          
BLAST of Synaptotagmin vs. Ensembl Celegans
Match: snt-2 (Synaptotagmin 2 [Source:UniProtKB/Swiss-Prot;Acc:K8FE10])

HSP 1 Score: 280.411 bits (716), Expect = 1.299e-88
Identity = 141/279 (50.54%), Postives = 198/279 (70.97%), Query Frame = 1
Query:  712 GKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGC------NATGAELRHWSDMLANPRRPIAQWHTLQDMPEK 1530
            G + + ++YDF + +L+V ++ A+DLPAMD +G SDPYVKV++LP++K+KFET++ R  LNP +NETF F IP++E+ SKTL+  V+D+DR SK D++GQ+ +PL S+D     +  + L  P+ D+EKE RLGDICFS RY P +G + + I+EA+NLKKMDVGG SDPYVK+ L    K + KKKT+ K  TLNPYYNESF F++    I+KV+LIV+V DYD++  ++ IG V LG         T A    W++M+ + RRP+ QWHTLQ+  EK
Sbjct:   85 GNIHFRVEYDFEQSKLSVTIVSASDLPAMDRNGMSDPYVKVYVLPERKQKFETRIIRNTLNPTYNETFQFSIPFNELHSKTLMLVVYDYDRLSKDDKMGQLSVPLESIDFGITTDIERPLQKPEKDDEKECRLGDICFSTRYRPATGTVTLTIMEARNLKKMDVGGSSDPYVKIYLHHGRKLLSKKKTSRKYKTLNPYYNESFQFKIEPHMIEKVHLIVSVWDYDKMSKNDFIGEVTLGSKHLNLPQITHACSEQWAEMMTS-RRPVVQWHTLQERMEK 362          

HSP 2 Score: 83.5741 bits (205), Expect = 5.269e-17
Identity = 45/133 (33.83%), Postives = 79/133 (59.40%), Query Frame = 1
Query:  691 DKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKK--KKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVI----EEWKEL 1071
            D++   LG + +S  Y    G +T+ +++A +L  MD+ G+SDPYVK++L   +K   K +T    K LNP +NE+F FKI    +    L+ +V+D+D+ SK+D IG++ +    ++L ++     E+W E+
Sbjct:  211 DEKECRLGDICFSTRYRPATGTVTLTIMEARNLKKMDVGGSSDPYVKIYLHHGRKLLSKKKTSRKYKTLNPYYNESFQFKIEPHMIEKVHLIVSVWDYDKMSKNDFIGEVTLGSKHLNLPQITHACSEQWAEM 343          

HSP 3 Score: 70.8626 bits (172), Expect = 6.924e-13
Identity = 40/105 (38.10%), Postives = 66/105 (62.86%), Query Frame = 1
Query: 1105 RLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRV 1419
            + G+I F + Y     KL++ I+ A +L  MD  G+SDPYVK+ ++   +R +K +T I + TLNP YNE+F F +PF ++    L++ V DYDR+   + +G++
Sbjct:   83 QYGNIHFRVEYDFEQSKLSVTIVSASDLPAMDRNGMSDPYVKVYVL--PERKQKFETRIIRNTLNPTYNETFQFSIPFNELHSKTLMLVVYDYDRLSKDDKMGQL 185          
BLAST of Synaptotagmin vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0077726)

HSP 1 Score: 458.373 bits (1178), Expect = 3.585e-156
Identity = 246/418 (58.85%), Postives = 314/418 (75.12%), Query Frame = 1
Query:  319 KMQQNVEKSVSQHVTAQTKESTSNKLHTTTAGISVLEKT-----------LKTFHMSTGTLIGIGVTVSIVVL-LLLYCXXXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFK-IPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEKS 1533
            K  +   + ++Q V + T+ +T+    +TT  + V++K             +   + T  ++ I + V +VV  ++ +C+ +   K+R K   G K     VDMKSVQLLG+AYKEKVQPD+EEL  N E+ +    +    LG+L + L+YDF    L V VIQA +LPA+DM GTSDPYVKV+LLPDKKKKFETKVHRK L+PVFNETF FK +PY++  +KTLVF +FDFDRFSKHDQIG++++PL ++DL + IEEW++L   + +  +E +LGDICFSLRYVPT+GKL +VILEAKNLKKMDVGGLSDPYVK+++M NGKR+KKKKT+IKK TLNPYYNESFSFEVPFEQIQK+ L+VTVVDYDRIGTSEPIGR +LGC  TG ELRHWSDMLA+PRRPIAQWHTL+D PE++
Sbjct:   56 KAAEAASQRIAQ-VESTTRSATTEAQESTTTAVPVIKKIEHVGEVVTEVIAERTGLPTWGVVAIIILVFLVVFGIIFFCVRRFLKKRRTKDGKGKKG----VDMKSVQLLGSAYKEKVQPDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQE-KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKD-PEET 466          
BLAST of Synaptotagmin vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0343993)

HSP 1 Score: 457.603 bits (1176), Expect = 9.198e-156
Identity = 246/418 (58.85%), Postives = 312/418 (74.64%), Query Frame = 1
Query:  319 KMQQNVEKSVSQHVTAQTKESTSNKLHTTTAGISVLEKT-----------LKTFHMSTGTLIGIGVTVSIVVL-LLLYCXXXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFK-IPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEKS 1533
            K  +   + ++Q V + T+ +T+    +TT  + V++K             +   + T  ++ I + V +VV  ++ +C+ +   K+R K   G K     VDMKSVQLLG+AYKEKVQPD+EEL  N E+ +    +    LG+L + L+YDF    L V VIQA +LPA+DM GTSDPYVKV+LLPDKKKKFETKVHRK L+PVFNETF FK +PY++  +KTLVF +FDFDRFSKHDQIG++++PL ++DL + IEEW++L     + E   +LGDICFSLRYVPT+GKL +VILEAKNLKKMDVGGLSDPYVK+++M NGKR+KKKKT+IKK TLNPYYNESFSFEVPFEQIQK+ L+VTVVDYDRIGTSEPIGR +LGC  TG ELRHWSDMLA+PRRPIAQWHTL+D PE++
Sbjct:   56 KAAEAASQRIAQ-VESTTRSATTEAQESTTTAVPVIKKIEHVGEVVTEVIAERTGLPTWGVVAIIILVFLVVFGIIFFCVRRFLKKRRTKDGKGKKG----VDMKSVQLLGSAYKEKVQPDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDL--VSVEGEGGQKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKD-PEET 465          
BLAST of Synaptotagmin vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0332218)

HSP 1 Score: 456.062 bits (1172), Expect = 2.932e-155
Identity = 245/418 (58.61%), Postives = 312/418 (74.64%), Query Frame = 1
Query:  319 KMQQNVEKSVSQHVTAQTKESTSNKLHTTTAGISVLEKT-----------LKTFHMSTGTLIGIGVTVSIVVL-LLLYCXXXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFK-IPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEKS 1533
            K  +   + ++Q V + T+ +T+    +TT  + V++K             +   + T  ++ I + V +VV  ++ +C+ +   K+R K   G K     VDMKSVQLLG+AYKEKVQPD+EEL  N E+ +    +    LG+L + L+YDF    L V VIQA +LPA+DM GTSDPYVKV+LLPDKKKKFETKVHRK L+PVFNETF FK +PY++  +KTLVF +FDFDRFSKHDQIG++++PL ++DL + IEEW++L   + +     +LGDICFSLRYVPT+GKL +VILEAKNLKKMDVGGLSDPYVK+++M NGKR+KKKKT+IKK TLNPYYNESFSFEVPFEQIQK+ L+VTVVDYDRIGTSEPIGR +LGC  TG ELRHWSDMLA+PRRPIAQWHTL+D PE++
Sbjct:   56 KAAEAASQRIAQ-VESTTRSATTEAQESTTTAVPVIKKIEHVGEVVTEVIAERTGLPTWGVVAIIILVFLVVFGIIFFCVRRFLKKRRTKDGKGKKG----VDMKSVQLLGSAYKEKVQPDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEG---GQLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKD-PEET 464          
BLAST of Synaptotagmin vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0077728)

HSP 1 Score: 450.284 bits (1157), Expect = 5.512e-153
Identity = 244/418 (58.37%), Postives = 312/418 (74.64%), Query Frame = 1
Query:  319 KMQQNVEKSVSQHVTAQTKESTSNKLHTTTAGISVLEKT-----------LKTFHMSTGTLIGIGVTVSIVVL-LLLYCXXXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFK-IPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEKS 1533
            K  +   + ++Q V + T+ +T+    +TT  + V++K             +   + T  ++ I + V +VV  ++ +C+ +   K+R K   G K     VDMKSVQLLG+AYKEK  PD+EEL  N E+ +    +    LG+L + L+YDF    L V VIQA +LPA+DM GTSDPYVKV+LLPDKKKKFETKVHRK L+PVFNETF FK +PY++  +KTLVF +FDFDRFSKHDQIG++++PL ++DL + IEEW++L   + +  +E +LGDICFSLRYVPT+GKL +VILEAKNLKKMDVGGLSDPYVK+++M NGKR+KKKKT+IKK TLNPYYNESFSFEVPFEQIQK+ L+VTVVDYDRIGTSEPIGR +LGC  TG ELRHWSDMLA+PRRPIAQWHTL+D PE++
Sbjct:   56 KAAEAASQRIAQ-VESTTRSATTEAQESTTTAVPVIKKIEHVGEVVTEVIAERTGLPTWGVVAIIILVFLVVFGIIFFCVRRFLKKRRTKDGKGKKG----VDMKSVQLLGSAYKEK--PDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQE-KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKD-PEET 464          
BLAST of Synaptotagmin vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0345331)

HSP 1 Score: 450.284 bits (1157), Expect = 5.512e-153
Identity = 244/418 (58.37%), Postives = 312/418 (74.64%), Query Frame = 1
Query:  319 KMQQNVEKSVSQHVTAQTKESTSNKLHTTTAGISVLEKT-----------LKTFHMSTGTLIGIGVTVSIVVL-LLLYCXXXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFK-IPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEKS 1533
            K  +   + ++Q V + T+ +T+    +TT  + V++K             +   + T  ++ I + V +VV  ++ +C+ +   K+R K   G K     VDMKSVQLLG+AYKEK  PD+EEL  N E+ +    +    LG+L + L+YDF    L V VIQA +LPA+DM GTSDPYVKV+LLPDKKKKFETKVHRK L+PVFNETF FK +PY++  +KTLVF +FDFDRFSKHDQIG++++PL ++DL + IEEW++L   + +  +E +LGDICFSLRYVPT+GKL +VILEAKNLKKMDVGGLSDPYVK+++M NGKR+KKKKT+IKK TLNPYYNESFSFEVPFEQIQK+ L+VTVVDYDRIGTSEPIGR +LGC  TG ELRHWSDMLA+PRRPIAQWHTL+D PE++
Sbjct:   56 KAAEAASQRIAQ-VESTTRSATTEAQESTTTAVPVIKKIEHVGEVVTEVIAERTGLPTWGVVAIIILVFLVVFGIIFFCVRRFLKKRRTKDGKGKKG----VDMKSVQLLGSAYKEK--PDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQE-KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKD-PEET 464          
BLAST of Synaptotagmin vs. Ensembl Zebrafish
Match: syt1a (synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-165])

HSP 1 Score: 404.831 bits (1039), Expect = 7.415e-136
Identity = 196/269 (72.86%), Postives = 233/269 (86.62%), Query Frame = 1
Query:  709 LGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            LGKLQYS+DY+FT+  L VG+IQA +LPAMDM GTSDPYVKV+LLPDKKKKFETKVHRK LNPVFNE F FK+PY+E+G KTLV  V+DFDRFSKHD IG +++P+  VD   V EEW++L    ++ E++ +LGDICFSLRYVPT+GKL +V+LEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV +++TV+DYD+IG ++ IG+V +G N+TG ELRHWSDMLANPRRPIAQWH L+
Sbjct:  139 LGKLQYSMDYNFTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVITVLDYDKIGKNDAIGKVFVGLNSTGTELRHWSDMLANPRRPIAQWHVLK 405          
BLAST of Synaptotagmin vs. Ensembl Zebrafish
Match: syt1a (synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-165])

HSP 1 Score: 404.831 bits (1039), Expect = 7.415e-136
Identity = 196/269 (72.86%), Postives = 233/269 (86.62%), Query Frame = 1
Query:  709 LGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            LGKLQYS+DY+FT+  L VG+IQA +LPAMDM GTSDPYVKV+LLPDKKKKFETKVHRK LNPVFNE F FK+PY+E+G KTLV  V+DFDRFSKHD IG +++P+  VD   V EEW++L    ++ E++ +LGDICFSLRYVPT+GKL +V+LEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV +++TV+DYD+IG ++ IG+V +G N+TG ELRHWSDMLANPRRPIAQWH L+
Sbjct:  139 LGKLQYSMDYNFTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVITVLDYDKIGKNDAIGKVFVGLNSTGTELRHWSDMLANPRRPIAQWHVLK 405          
BLAST of Synaptotagmin vs. Ensembl Zebrafish
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 378.252 bits (970), Expect = 2.172e-125
Identity = 183/269 (68.03%), Postives = 231/269 (85.87%), Query Frame = 1
Query:  709 LGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            LGKLQ+SLDYDF+  +LTVG++QA DL +MD  GTSDPYVKVF+LPDKKKK++TKVH+K LNPVFNETF FKIP++E+G KTLV +V+DFDRFSKHD IG+++IP+ ++DL + IE+W++L    ++ E+  +LGDIC SLRYVPT+GKL I ILEAKNLKKMDVGGLSDPYVK+ L+ NGKR+KKKKTT+KK TLNPYYNESFSFE+P +Q+QK+  ++TV+DYD+IG ++ IG++ +G  A G ELRHWSDMLANPRRPIAQWH L+
Sbjct:  148 LGKLQFSLDYDFSASQLTVGILQAADLLSMDSGGTSDPYVKVFILPDKKKKYDTKVHKKTLNPVFNETFHFKIPFTEMGGKTLVMSVYDFDRFSKHDVIGEVKIPMNTLDLAQPIEQWRDLD--SAEKEEPEKLGDICISLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKIHLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPQDQMQKIQAVITVLDYDKIGKNDAIGKIWVGSKAQGTELRHWSDMLANPRRPIAQWHPLK 414          
BLAST of Synaptotagmin vs. Ensembl Zebrafish
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 378.252 bits (970), Expect = 2.172e-125
Identity = 183/269 (68.03%), Postives = 231/269 (85.87%), Query Frame = 1
Query:  709 LGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            LGKLQ+SLDYDF+  +LTVG++QA DL +MD  GTSDPYVKVF+LPDKKKK++TKVH+K LNPVFNETF FKIP++E+G KTLV +V+DFDRFSKHD IG+++IP+ ++DL + IE+W++L    ++ E+  +LGDIC SLRYVPT+GKL I ILEAKNLKKMDVGGLSDPYVK+ L+ NGKR+KKKKTT+KK TLNPYYNESFSFE+P +Q+QK+  ++TV+DYD+IG ++ IG++ +G  A G ELRHWSDMLANPRRPIAQWH L+
Sbjct:  148 LGKLQFSLDYDFSASQLTVGILQAADLLSMDSGGTSDPYVKVFILPDKKKKYDTKVHKKTLNPVFNETFHFKIPFTEMGGKTLVMSVYDFDRFSKHDVIGEVKIPMNTLDLAQPIEQWRDLD--SAEKEEPEKLGDICISLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKIHLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPQDQMQKIQAVITVLDYDKIGKNDAIGKIWVGSKAQGTELRHWSDMLANPRRPIAQWHPLK 414          
BLAST of Synaptotagmin vs. Ensembl Zebrafish
Match: syt5b (synaptotagmin Vb [Source:ZFIN;Acc:ZDB-GENE-050522-134])

HSP 1 Score: 373.244 bits (957), Expect = 1.049e-123
Identity = 191/270 (70.74%), Postives = 230/270 (85.19%), Query Frame = 1
Query:  706 NLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            NLGKL++SLDY+FT  +L VG++QA DL AMD+ GTSDPYVKV+LLPDKKKKFETKV RK L PVFNETF+FKIPY+E+G KTLV  VFDFDRF KHD IGQI+IP+  VDL + + EW+EL   ++  ++E +LGD+C SLRYVPT+GKL + I+EAKNLKKMDVGGLSDPYVK+ L  NGKR+KKKKTT+KK TLNPY+NESFSFEVPFEQIQKV L++TV DYD++G+++PIG+  +G  ATG  LRHWSDMLANPRRP+AQWHTLQ
Sbjct:  133 NLGKLEFSLDYNFTDAQLIVGILQAQDLAAMDIGGTSDPYVKVYLLPDKKKKFETKVQRKNLCPVFNETFIFKIPYAELGGKTLVLQVFDFDRFGKHDVIGQIKIPMNCVDLAQPLHEWREL---ENGEKEEEKLGDVCISLRYVPTAGKLTVNIMEAKNLKKMDVGGLSDPYVKIVLQHNGKRLKKKKTTVKKNTLNPYFNESFSFEVPFEQIQKVQLLITVYDYDKLGSNDPIGKTFIGYGATGVGLRHWSDMLANPRRPVAQWHTLQ 399          
BLAST of Synaptotagmin vs. Ensembl Xenopus
Match: SYT5 (synaptotagmin 5 [Source:NCBI gene;Acc:100493612])

HSP 1 Score: 439.884 bits (1130), Expect = 1.842e-149
Identity = 216/313 (69.01%), Postives = 268/313 (85.62%), Query Frame = 1
Query:  586 VDMKSVQLLGNAYKEKVQPDLEELDANMEDN---EGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            ++MK V+ LG +Y +KVQPD+E+LD ++ D+   E  Q+K    LGKLQYSLDYDF  G+L VG+IQA DLPA+D+ GTSDPYVKV+LLPDKKKK+ETKVHRK LNP FNE+F FK+PY+E+G KTLV +V+DFDRFSKHD IG++++ + +VDL  VIEEW++L    ++ E++ +LGDICFSLRYVPT+GKL +++LEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV +++TV+DYD++G +E IG++ +GCNATG ELRHWSDMLANPRRPIAQWHTLQ
Sbjct:  101 INMKEVKELGKSYIDKVQPDVEDLDPSLLDDVKDEKPQEK----LGKLQYSLDYDFQTGQLVVGIIQAADLPALDIGGTSDPYVKVYLLPDKKKKYETKVHRKTLNPTFNESFTFKVPYAELGGKTLVMSVYDFDRFSKHDAIGEVRVHMNTVDLAHVIEEWQDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVLTVLDYDKLGKNEAIGKIFVGCNATGTELRHWSDMLANPRRPIAQWHTLQ 407          
BLAST of Synaptotagmin vs. Ensembl Xenopus
Match: SYT5 (synaptotagmin 5 [Source:NCBI gene;Acc:100493612])

HSP 1 Score: 439.884 bits (1130), Expect = 1.929e-149
Identity = 216/313 (69.01%), Postives = 268/313 (85.62%), Query Frame = 1
Query:  586 VDMKSVQLLGNAYKEKVQPDLEELDANMEDN---EGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            ++MK V+ LG +Y +KVQPD+E+LD ++ D+   E  Q+K    LGKLQYSLDYDF  G+L VG+IQA DLPA+D+ GTSDPYVKV+LLPDKKKK+ETKVHRK LNP FNE+F FK+PY+E+G KTLV +V+DFDRFSKHD IG++++ + +VDL  VIEEW++L    ++ E++ +LGDICFSLRYVPT+GKL +++LEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV +++TV+DYD++G +E IG++ +GCNATG ELRHWSDMLANPRRPIAQWHTLQ
Sbjct:   96 INMKEVKELGKSYIDKVQPDVEDLDPSLLDDVKDEKPQEK----LGKLQYSLDYDFQTGQLVVGIIQAADLPALDIGGTSDPYVKVYLLPDKKKKYETKVHRKTLNPTFNESFTFKVPYAELGGKTLVMSVYDFDRFSKHDAIGEVRVHMNTVDLAHVIEEWQDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVLTVLDYDKLGKNEAIGKIFVGCNATGTELRHWSDMLANPRRPIAQWHTLQ 402          
BLAST of Synaptotagmin vs. Ensembl Xenopus
Match: e2f4 (E2F transcription factor 4 [Source:Xenbase;Acc:XB-GENE-482721])

HSP 1 Score: 414.846 bits (1065), Expect = 1.555e-139
Identity = 224/353 (63.46%), Postives = 277/353 (78.47%), Query Frame = 1
Query:  463 TLIGIGVTVSIVVLLLLYCX-XXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEK-VQPDLEELDANMEDNEGA-QDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTL 1512
             LI I +   +++L   +C+  K   KK+ KKK   K G   ++MK V+ LG   K++ ++ D ++ +  + D E   Q KE   LGKLQYSLDYDF   +L VG+IQA +LPA+DM GTSDPYVK+FL+PDKKKKFETKVHRK LNPVFNE F FK+PY+E+G KTLV  V+DFDRFSKHD IG +++P+ +VD   V EEW++L    ++ E++ +LGDICFSLRYVPT+GKL +VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG+V +G N+TGAELRHWSDMLANPRRPIAQWHTL
Sbjct:   61 ALIAIAIVAVLLILTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDDDAETGLTDGEDKEQPKEVEKLGKLQYSLDYDFQNNQLMVGIIQAAELPALDMGGTSDPYVKLFLMPDKKKKFETKVHRKTLNPVFNEQFTFKVPYAELGGKTLVLTVYDFDRFSKHDVIGDVKVPMNTVDFGHVTEEWRDL--VSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTL 411          
BLAST of Synaptotagmin vs. Ensembl Xenopus
Match: luzp2 (leucine zipper protein 2 [Source:Xenbase;Acc:XB-GENE-940667])

HSP 1 Score: 392.119 bits (1006), Expect = 1.292e-130
Identity = 186/265 (70.19%), Postives = 229/265 (86.42%), Query Frame = 1
Query:  721 QYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            Q+SLDYDF   ++ VG+IQAT+LPA+DM GTSDPYVKVF LPDKKKK ETKVHRK LNP+FNETF FKIPY E+G KTL  +++DFDRFSKHD IG++++P+ +VDL + IEEW++L    ++ E+  +LGDIC SLRYVPT+GKL + ILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTT+KK TLNPY+NESFSFE+PFEQIQKV +++TV+DYD++G +E IG++ +GCNA+G ELRHWSDMLANPRRPIAQWH L+
Sbjct:  150 QFSLDYDFQNNQMQVGIIQATELPALDMGGTSDPYVKVFFLPDKKKKHETKVHRKTLNPIFNETFTFKIPYQELGGKTLCMSIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQ--SAEKEEPEKLGDICISLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVITVLDYDKLGKNEAIGKIFVGCNASGTELRHWSDMLANPRRPIAQWHPLK 412          
BLAST of Synaptotagmin vs. Ensembl Xenopus
Match: syt8 (synaptotagmin 8 [Source:NCBI gene;Acc:100037878])

HSP 1 Score: 335.495 bits (859), Expect = 4.032e-109
Identity = 173/305 (56.72%), Postives = 222/305 (72.79%), Query Frame = 1
Query:  613 GNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPE 1527
            GN     VQP       N++  E  + +     G++QYSL+Y+F   ELTVGV QA  L AMD+ GTSDPY  V++  D +KKFETKV+RK LNPVFNE+FVFK+   EV   T V  +FDF+RF KHD IG++ IPLG V+L  VIE+WK+LGP  +   +   LGDICFSLRYVP+SGKL I+ILEAKNLK+MD  G SDPYVK+ L LN K+ K+KKT +KK TL PY+NESF+F+V  EQ++ ++LI++V D+D++G +E IG++ LGC A+G  LRHWSDMLA+PRRPIAQWH LQ+  E
Sbjct:   83 GNLTTHLVQPGA----GNLQKGEKVEYR-----GRVQYSLEYNFQTEELTVGVKQAAALKAMDLGGTSDPYAIVYVTNDTRKKFETKVNRKTLNPVFNESFVFKVTQEEVPRTTAVVQIFDFNRFLKHDVIGEMVIPLGEVNLQHVIEDWKDLGP--AGKTEHEHLGDICFSLRYVPSSGKLTIIILEAKNLKRMDSDGFSDPYVKVHLALNRKKWKRKKTAVKKSTLKPYFNESFTFDVSLEQMKNLDLIISVWDHDKVGKNEQIGKLFLGCRASGNALRHWSDMLAHPRRPIAQWHKLQEADE 376          
BLAST of Synaptotagmin vs. Ensembl Mouse
Match: Syt1 (synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667])

HSP 1 Score: 414.461 bits (1064), Expect = 1.211e-139
Identity = 213/310 (68.71%), Postives = 253/310 (81.61%), Query Frame = 1
Query:  586 VDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            ++MK V+ LG   K++   D +      +  E  + KE   LGKLQYSLDYDF   +L VG+IQA +LPA+DM GTSDPYVKVFLLPDKKKKFETKVHRK LNPVFNE F FK+PYSE+G KTLV  V+DFDRFSKHD IG+ ++P+ +VD   V EEW++L    ++ E++ +LGDICFSLRYVPT+GKL +VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG+V +G N+TGAELRHWSDMLANPRRPIAQWHTLQ
Sbjct:  101 INMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 408          
BLAST of Synaptotagmin vs. Ensembl Mouse
Match: Syt1 (synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667])

HSP 1 Score: 414.461 bits (1064), Expect = 1.211e-139
Identity = 213/310 (68.71%), Postives = 253/310 (81.61%), Query Frame = 1
Query:  586 VDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            ++MK V+ LG   K++   D +      +  E  + KE   LGKLQYSLDYDF   +L VG+IQA +LPA+DM GTSDPYVKVFLLPDKKKKFETKVHRK LNPVFNE F FK+PYSE+G KTLV  V+DFDRFSKHD IG+ ++P+ +VD   V EEW++L    ++ E++ +LGDICFSLRYVPT+GKL +VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG+V +G N+TGAELRHWSDMLANPRRPIAQWHTLQ
Sbjct:  101 INMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 408          
BLAST of Synaptotagmin vs. Ensembl Mouse
Match: Syt2 (synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666])

HSP 1 Score: 403.29 bits (1035), Expect = 3.979e-135
Identity = 200/302 (66.23%), Postives = 243/302 (80.46%), Query Frame = 1
Query:  664 NMEDNEGAQDKE------------------AVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            NM+D +G QD +                    NLGKLQ+SLDYDF   +LTVGV+QA +LPA+DM GTSDPYVKVFLLPDKKKK+ETKVHRK LNP FNETF FK+PY E+G KTLV  ++DFDRFSKHD IG++++P+ +VDL + IEEW++L     + E+  +LGDIC SLRYVPT+GKL + ILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTT+KK TLNPY+NESFSFE+PFEQIQKV ++VTV+DYD++G +E IG++ +G NATG ELRHWSDMLANPRRPIAQWH+L+
Sbjct:  110 NMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQ--GGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLK 409          

HSP 2 Score: 85.8853 bits (211), Expect = 2.773e-17
Identity = 53/145 (36.55%), Postives = 85/145 (58.62%), Query Frame = 1
Query:  643 DLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKK--KFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKEL 1071
            DL +      D +G + +E   LG +  SL Y  T G+LTV +++A +L  MD+ G SDPYVK+ L+ + K+  K +T V +K LNP FNE+F F+IP+ ++    +V  V D+D+  K++ IG+I +  GS      +  W ++
Sbjct:  252 DLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFV--GSNATGTELRHWSDM 394          
BLAST of Synaptotagmin vs. Ensembl Mouse
Match: Syt2 (synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666])

HSP 1 Score: 403.29 bits (1035), Expect = 3.979e-135
Identity = 200/302 (66.23%), Postives = 243/302 (80.46%), Query Frame = 1
Query:  664 NMEDNEGAQDKE------------------AVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            NM+D +G QD +                    NLGKLQ+SLDYDF   +LTVGV+QA +LPA+DM GTSDPYVKVFLLPDKKKK+ETKVHRK LNP FNETF FK+PY E+G KTLV  ++DFDRFSKHD IG++++P+ +VDL + IEEW++L     + E+  +LGDIC SLRYVPT+GKL + ILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTT+KK TLNPY+NESFSFE+PFEQIQKV ++VTV+DYD++G +E IG++ +G NATG ELRHWSDMLANPRRPIAQWH+L+
Sbjct:  110 NMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQ--GGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLK 409          

HSP 2 Score: 85.8853 bits (211), Expect = 2.773e-17
Identity = 53/145 (36.55%), Postives = 85/145 (58.62%), Query Frame = 1
Query:  643 DLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKK--KFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKEL 1071
            DL +      D +G + +E   LG +  SL Y  T G+LTV +++A +L  MD+ G SDPYVK+ L+ + K+  K +T V +K LNP FNE+F F+IP+ ++    +V  V D+D+  K++ IG+I +  GS      +  W ++
Sbjct:  252 DLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFV--GSNATGTELRHWSDM 394          
BLAST of Synaptotagmin vs. Ensembl Mouse
Match: Syt5 (synaptotagmin V [Source:MGI Symbol;Acc:MGI:1926368])

HSP 1 Score: 368.622 bits (945), Expect = 3.784e-122
Identity = 185/310 (59.68%), Postives = 247/310 (79.68%), Query Frame = 1
Query:  586 VDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            V ++ V+ LG +Y +KVQP++EELD +     G Q  +   LG+LQYSLDYDF  G+L VG++QA  L A+D+ G+SDPYV V+LLPDK+++ ETKVHR+ LNP F ETF FK+PY E+G + LV  V+DFDRFS++D IG++++P+ SV+L + ++ W+EL    +  E++ +LGDICFSLRYVPT+GKL +++LEAKNLKKMDVGGLSDPYVK+ L+  GK+V+KKKTTIKK TLNPYYNE+FSFEVP +Q+QKV + +TV+DYD++G +E IGRV +G    GA LRHW+DMLANPRRPIAQWH+L+
Sbjct:   69 VHLQEVKELGRSYIDKVQPEIEELDRS-PSMPGQQVSDKHQLGRLQYSLDYDFQTGQLLVGILQAQGLAALDLGGSSDPYVSVYLLPDKRRRHETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDRFSRNDAIGEVRVPMSSVNLGRPVQAWRELQ--VAPKEEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKNTLNPYYNEAFSFEVPCDQVQKVQVELTVLDYDKLGKNEAIGRVAVGAAVGGAGLRHWADMLANPRRPIAQWHSLR 375          
BLAST of Synaptotagmin vs. UniProt/SwissProt
Match: sp|P41823|SY65_APLCA (Synaptotagmin-1 OS=Aplysia californica OX=6500 GN=SYT1 PE=1 SV=2)

HSP 1 Score: 511.146 bits (1315), Expect = 1.948e-176
Identity = 251/317 (79.18%), Postives = 287/317 (90.54%), Query Frame = 1
Query:  586 VDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQD-KEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEKS 1533
            VD+KSVQLLGN+YKEKVQPDL+EL  NMEDNE A+  K  V LGKLQ+SLDYDF KGEL+V VIQA DLP MDMSGTSDPYVKV+LLPDKKKK+ETKVHRK LNPVFNE+F FK+PY+EVGSK L F V+DFDRFSKHDQIGQ+Q+PL S+DL +V+E+WK+L  PD+++EKEN+LGDICFSLRYVPT+GKL +VILEAKNLKKMDVGGLSDPYVK++L+   KR+KKKKTTIKK TLNPY+NESF FEVPFEQIQKV LI+TVVDYDRIGTSEPIGR VLGCN++G ELRHWSDMLANPRRPIAQWHTLQ++PEK+
Sbjct:  112 VDLKSVQLLGNSYKEKVQPDLDELPVNMEDNEDAESTKSEVKLGKLQFSLDYDFQKGELSVNVIQAADLPGMDMSGTSDPYVKVYLLPDKKKKYETKVHRKTLNPVFNESFTFKVPYAEVGSKILTFAVYDFDRFSKHDQIGQVQVPLNSIDLGRVVEDWKDLQSPDTESEKENKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIALLQGTKRLKKKKTTIKKNTLNPYFNESFGFEVPFEQIQKVTLIITVVDYDRIGTSEPIGRCVLGCNSSGTELRHWSDMLANPRRPIAQWHTLQEVPEKN 428          
BLAST of Synaptotagmin vs. UniProt/SwissProt
Match: sp|P21521|SY65_DROME (Synaptotagmin 1 OS=Drosophila melanogaster OX=7227 GN=Syt1 PE=1 SV=3)

HSP 1 Score: 458.373 bits (1178), Expect = 3.594e-155
Identity = 246/418 (58.85%), Postives = 314/418 (75.12%), Query Frame = 1
Query:  319 KMQQNVEKSVSQHVTAQTKESTSNKLHTTTAGISVLEKT-----------LKTFHMSTGTLIGIGVTVSIVVL-LLLYCXXXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFK-IPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEKS 1533
            K  +   + ++Q V + T+ +T+    +TT  + V++K             +   + T  ++ I + V +VV  ++ +C+ +   K+R K   G K     VDMKSVQLLG+AYKEKVQPD+EEL  N E+ +    +    LG+L + L+YDF    L V VIQA +LPA+DM GTSDPYVKV+LLPDKKKKFETKVHRK L+PVFNETF FK +PY++  +KTLVF +FDFDRFSKHDQIG++++PL ++DL + IEEW++L   + +  +E +LGDICFSLRYVPT+GKL +VILEAKNLKKMDVGGLSDPYVK+++M NGKR+KKKKT+IKK TLNPYYNESFSFEVPFEQIQK+ L+VTVVDYDRIGTSEPIGR +LGC  TG ELRHWSDMLA+PRRPIAQWHTL+D PE++
Sbjct:   56 KAAEAASQRIAQ-VESTTRSATTEAQESTTTAVPVIKKIEHVGEVVTEVIAERTGLPTWGVVAIIILVFLVVFGIIFFCVRRFLKKRRTKDGKGKKG----VDMKSVQLLGSAYKEKVQPDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQE-KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKD-PEET 466          
BLAST of Synaptotagmin vs. UniProt/SwissProt
Match: sp|P48018|SYT1_BOVIN (Synaptotagmin-1 OS=Bos taurus OX=9913 GN=SYT1 PE=1 SV=1)

HSP 1 Score: 416.001 bits (1068), Expect = 3.033e-139
Identity = 231/367 (62.94%), Postives = 278/367 (75.75%), Query Frame = 1
Query:  427 EKTLKTFH---MSTGTLIGIGVTVSIVVLLLLYCX-XXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            EK +   H   +    LI I +   ++VL   +CI  K   KK+ KKK   K G   ++MK V+ LG   K++   D +      +  E  + KE   LGKLQYSLDYDF   +L VG+IQA +LPA+DM GTSDPYVKVFLLPDKKKKFETKVHRK LNPVFNE F FK+PYSE+G KTLV  V+DFDRFSKHD IG+ ++P+ +VD   V EEW++L    ++ E++ +LGDICFSLRYVPT+GKL +VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG+V +G N+TGAELRHWSDMLANPRRPIAQWHTLQ
Sbjct:   45 EKFMNELHKIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 409          
BLAST of Synaptotagmin vs. UniProt/SwissProt
Match: sp|P21579|SYT1_HUMAN (Synaptotagmin-1 OS=Homo sapiens OX=9606 GN=SYT1 PE=1 SV=1)

HSP 1 Score: 415.616 bits (1067), Expect = 3.133e-139
Identity = 231/367 (62.94%), Postives = 278/367 (75.75%), Query Frame = 1
Query:  427 EKTLKTFH---MSTGTLIGIGVTVSIVVLLLLYCX-XXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            EK +   H   +    LI I +   ++VL   +CI  K   KK+ KKK   K G   ++MK V+ LG   K++   D +      +  E  + KE   LGKLQYSLDYDF   +L VG+IQA +LPA+DM GTSDPYVKVFLLPDKKKKFETKVHRK LNPVFNE F FK+PYSE+G KTLV  V+DFDRFSKHD IG+ ++P+ +VD   V EEW++L    ++ E++ +LGDICFSLRYVPT+GKL +VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG+V +G N+TGAELRHWSDMLANPRRPIAQWHTLQ
Sbjct:   45 EKFMNELHKIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 409          
BLAST of Synaptotagmin vs. UniProt/SwissProt
Match: sp|P46096|SYT1_MOUSE (Synaptotagmin-1 OS=Mus musculus OX=10090 GN=Syt1 PE=1 SV=1)

HSP 1 Score: 414.461 bits (1064), Expect = 8.472e-139
Identity = 213/310 (68.71%), Postives = 253/310 (81.61%), Query Frame = 1
Query:  586 VDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            ++MK V+ LG   K++   D +      +  E  + KE   LGKLQYSLDYDF   +L VG+IQA +LPA+DM GTSDPYVKVFLLPDKKKKFETKVHRK LNPVFNE F FK+PYSE+G KTLV  V+DFDRFSKHD IG+ ++P+ +VD   V EEW++L    ++ E++ +LGDICFSLRYVPT+GKL +VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG+V +G N+TGAELRHWSDMLANPRRPIAQWHTLQ
Sbjct:  101 INMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 408          
BLAST of Synaptotagmin vs. TrEMBL
Match: Q9U8R6 (Djsyt protein OS=Dugesia japonica OX=6161 GN=Djsyt PE=2 SV=1)

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 286/316 (90.51%), Postives = 305/316 (96.52%), Query Frame = 1
Query:  586 VDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEKS 1533
            VDMKS QLLGN+YKEK+QPDLEELDANMEDNEG ++KE V+LGKLQYSLDYDF KGELTVGVIQATDLPAMDMSGTSDPYVK+FLLPDKKKKFETKVHRKILNPVFNETFVFK+P++EV SKTLVFNV+DFDRFSKHDQIGQI++PLG++DL +VIEEWKEL  PD+D EKENRLGDICFSLRYVPTSGKL IVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGR+VLGCNATGAELRHWSDMLANPRRPIAQWHTLQ+MPE +
Sbjct:   80 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLFLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLVFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPDNDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 395          
BLAST of Synaptotagmin vs. TrEMBL
Match: A0A267E333 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031935g3 PE=4 SV=1)

HSP 1 Score: 562.377 bits (1448), Expect = 0.000e+0
Identity = 298/404 (73.76%), Postives = 342/404 (84.65%), Query Frame = 1
Query:  322 MQQNVEKSVSQHVTAQTKESTSNKLHTTTAGISVLEKTLKTFHMSTGTLIGIGVTVSIVVLLLLYCXXXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEKS 1533
            +    ++SV+   T  + E   NK+      +S  EK     HM    ++ I + V +V LL++YCICKRCI +RKK    GKKG   VDMKSVQLLGN YKEKVQPD+EEL   MEDNEGAQ+KE   LGKLQYSLDYDF KGEL+VGVIQA+DLPAMDM GTSDPYVKV+++P+KKKKFETKVHRK LNPVFNETF+FK+PY++V SKTLVF V+DFDRFSKHDQIG I++PLG++DL ++IEEWK++ PP+S+++K NRLGDICFSLRYVPT+GKL IVILEAKNLKKMDVGGLSDPYVKLSLMLNGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV+LIVTVVDYDRIGTSEPIGR+VLGC ATGAELRHWSDMLANPRRPIAQWHTLQ+MPEKS
Sbjct:   34 LSNTTDRSVAMGTTKSSGEKAINKIDNALNVLS--EKA----HMGKPAIVTIIIGVLLVFLLIMYCICKRCICRRKKGGKDGKKGKGAVDMKSVQLLGNEYKEKVQPDMEELVETMEDNEGAQEKEVEKLGKLQYSLDYDFQKGELSVGVIQASDLPAMDMGGTSDPYVKVYIMPEKKKKFETKVHRKTLNPVFNETFIFKVPYADVPSKTLVFAVYDFDRFSKHDQIGLIKLPLGAIDLARLIEEWKDIDPPESEDDKSNRLGDICFSLRYVPTAGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRIKKKKTTIKKCTLNPYYNESFSFEVPFEQIQKVSLIVTVVDYDRIGTSEPIGRIVLGCTATGAELRHWSDMLANPRRPIAQWHTLQEMPEKS 431          
BLAST of Synaptotagmin vs. TrEMBL
Match: A0A267GS86 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031935g1 PE=4 SV=1)

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 298/404 (73.76%), Postives = 342/404 (84.65%), Query Frame = 1
Query:  322 MQQNVEKSVSQHVTAQTKESTSNKLHTTTAGISVLEKTLKTFHMSTGTLIGIGVTVSIVVLLLLYCXXXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEKS 1533
            +    ++SV+   T  + E   NK+      +S  EK     HM    ++ I + V +V LL++YCICKRCI +RKK    GKKG   VDMKSVQLLGN YKEKVQPD+EEL   MEDNEGAQ+KE   LGKLQYSLDYDF KGEL+VGVIQA+DLPAMDM GTSDPYVKV+++P+KKKKFETKVHRK LNPVFNETF+FK+PY++V SKTLVF V+DFDRFSKHDQIG I++PLG++DL ++IEEWK++ PP+S+++K NRLGDICFSLRYVPT+GKL IVILEAKNLKKMDVGGLSDPYVKLSLMLNGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV+LIVTVVDYDRIGTSEPIGR+VLGC ATGAELRHWSDMLANPRRPIAQWHTLQ+MPEKS
Sbjct:   34 LSNTTDRSVAMGTTKSSGEKAINKIDNALNVLS--EKA----HMGKPAIVTIIIGVLLVFLLIMYCICKRCICRRKKGGKDGKKGKGAVDMKSVQLLGNEYKEKVQPDMEELVETMEDNEGAQEKEVEKLGKLQYSLDYDFQKGELSVGVIQASDLPAMDMGGTSDPYVKVYIMPEKKKKFETKVHRKTLNPVFNETFIFKVPYADVPSKTLVFAVYDFDRFSKHDQIGLIKLPLGAIDLARLIEEWKDIDPPESEDDKSNRLGDICFSLRYVPTAGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRIKKKKTTIKKCTLNPYYNESFSFEVPFEQIQKVSLIVTVVDYDRIGTSEPIGRIVLGCTATGAELRHWSDMLANPRRPIAQWHTLQEMPEKS 431          
BLAST of Synaptotagmin vs. TrEMBL
Match: A0A267E6V1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031935g2 PE=4 SV=1)

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 298/404 (73.76%), Postives = 341/404 (84.41%), Query Frame = 1
Query:  322 MQQNVEKSVSQHVTAQTKESTSNKLHTTTAGISVLEKTLKTFHMSTGTLIGIGVTVSIVVLLLLYCXXXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEKS 1533
            +    ++SV+   T  + E   NK+      +S  EK     HM    ++ I + V +V LL++YCICKRCI +RKK    GKKG   VDMKSVQLLGN YKEKVQPD+EEL   MEDNEG Q+KE   LGKLQYSLDYDF KGEL+VGVIQA+DLPAMDM GTSDPYVKV++LP+KKKKFETKVHRK LNPVFNETF+FK+PY++V SKTLVF V+DFDRFSKHDQIG I++PLG++DL ++IEEWK++ PP+S+++K NRLGDICFSLRYVPT+GKL IVILEAKNLKKMDVGGLSDPYVKLSLMLNGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV+LIVTVVDYDRIGTSEPIGR+VLGC ATGAELRHWSDMLANPRRPIAQWHTLQ+MPEKS
Sbjct:   34 LSNTTDRSVAMGTTKSSGEKAINKIDNALNVLS--EKA----HMGKPAIVTIIIGVLLVFLLIMYCICKRCICRRKKGGKDGKKGKGAVDMKSVQLLGNEYKEKVQPDMEELVETMEDNEGNQEKEVEKLGKLQYSLDYDFQKGELSVGVIQASDLPAMDMGGTSDPYVKVYILPEKKKKFETKVHRKTLNPVFNETFIFKVPYADVPSKTLVFAVYDFDRFSKHDQIGLIKLPLGAIDLARLIEEWKDIDPPESEDDKSNRLGDICFSLRYVPTAGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRIKKKKTTIKKCTLNPYYNESFSFEVPFEQIQKVSLIVTVVDYDRIGTSEPIGRIVLGCTATGAELRHWSDMLANPRRPIAQWHTLQEMPEKS 431          
BLAST of Synaptotagmin vs. TrEMBL
Match: A0A183QG72 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 540.036 bits (1390), Expect = 0.000e+0
Identity = 291/363 (80.17%), Postives = 320/363 (88.15%), Query Frame = 1
Query:  445 FHMSTGTLIGIGVTVSIVVLLLLYCXXXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEKS 1533
             H+ TG +I + + V + VLL+L+CICKRC+ KR+KK  G KK     D+KSVQLLG     K + DL+EL+ANMEDNEG QDKE VNLGKLQYS+DYDFT+GELTVGVIQATDLP MD+SGTSDPYVKVFLLP+KKKK+ETKVHRK LNPVFNETFVFK+PY+EVG KTLVFNV+DFDRFSKHDQIGQIQ+PLGSVDL +VIEEW++L PPD D+EKENRLGDICFSLRYVPT+GKL I ILEAKNLKKMDVGGLSDPYVKLSLML GKR+KKKKTTIKK TLNPYYNESF+FEVPFEQIQKV LIV VVDYDRIGTSE IGRVVLGCN TGA LRHWSDMLANPRRPIAQWHTLQ MPEK 
Sbjct:   46 MHVPTGAVIAMVIGVILFVLLILFCICKRCVFKRRKKDRGAKKSK--ADIKSVQLLGKGLA-KDKGDLDELEANMEDNEGVQDKEEVNLGKLQYSIDYDFTQGELTVGVIQATDLPGMDLSGTSDPYVKVFLLPEKKKKYETKVHRKTLNPVFNETFVFKVPYAEVGGKTLVFNVYDFDRFSKHDQIGQIQVPLGSVDLARVIEEWRDLSPPD-DDEKENRLGDICFSLRYVPTAGKLTINILEAKNLKKMDVGGLSDPYVKLSLMLGGKRIKKKKTTIKKCTLNPYYNESFAFEVPFEQIQKVTLIVIVVDYDRIGTSEAIGRVVLGCNETGAGLRHWSDMLANPRRPIAQWHTLQPMPEKG 404          
BLAST of Synaptotagmin vs. Ensembl Cavefish
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:103044539])

HSP 1 Score: 412.149 bits (1058), Expect = 7.739e-139
Identity = 221/361 (61.22%), Postives = 277/361 (76.73%), Query Frame = 1
Query:  436 LKTFHMSTGTLIGIGVTVSIVVLLLLYCXXXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEG-AQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            L    + +  ++ I     ++V+   +CICK+ I K+K KK G  KG   ++MK V    +  K +   D +E++  + +NE  A+ KE   LGKLQYSLDY+FT+  L VG+IQA +LPAMDM GTSDPYVKV+LLPDKKKKFETKVHRK LNP FNE F FK+PY+E+G KTLV  V+DFDRFSKHD IG +++P+  VD   V EEW++L    ++ E++ +LGDICFSLRYVPT+GKL +VILEAKNLKKMDVGGLSDPY K+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV +++TV+DYD+IG ++ IG+V +G N++G ELRHWSDMLANPRRPIAQWH L+
Sbjct:   50 LNKIPLPSWAIVAIAFVAVVLVVSCCFCICKKWIFKKKNKKKGKDKGKNAINMKDVI---DGTKTEALKDEDEVETGLTENEKEAEPKEQEKLGKLQYSLDYNFTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPTFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYAKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVITVLDYDKIGKNDAIGKVFVGLNSSGTELRHWSDMLANPRRPIAQWHVLK 405          
BLAST of Synaptotagmin vs. Ensembl Cavefish
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:103044539])

HSP 1 Score: 409.838 bits (1052), Expect = 6.718e-138
Identity = 202/292 (69.18%), Postives = 244/292 (83.56%), Query Frame = 1
Query:  643 DLEELDANMEDNEG-AQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            D +E++  + +NE  A+ KE   LGKLQYSLDY+FT+  L VG+IQA +LPAMDM GTSDPYVKV+LLPDKKKKFETKVHRK LNP FNE F FK+PY+E+G KTLV  V+DFDRFSKHD IG +++P+  VD   V EEW++L    ++ E++ +LGDICFSLRYVPT+GKL +VILEAKNLKKMDVGGLSDPY K+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV +++TV+DYD+IG ++ IG+V +G N++G ELRHWSDMLANPRRPIAQWH L+
Sbjct:  113 DEDEVETGLTENEKEAEPKEQEKLGKLQYSLDYNFTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPTFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYAKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVITVLDYDKIGKNDAIGKVFVGLNSSGTELRHWSDMLANPRRPIAQWHVLK 402          
BLAST of Synaptotagmin vs. Ensembl Cavefish
Match: syt1b (synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-166])

HSP 1 Score: 391.734 bits (1005), Expect = 7.229e-131
Identity = 196/286 (68.53%), Postives = 235/286 (82.17%), Query Frame = 1
Query:  658 DANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            D+  E+ E    KE   LGKLQ+SLDY FT G L VG+IQA DL AMDMSGTSDPYVK++LLPDKKKKFETKVHRK LNP FNE F FK+PYSE+G KTLV  V+DFDRFSKHD IG +++ +  VD  +V EEW+ L    ++ E++ +LGDIC SLRYVPT+GKL +V+LEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK+TLNPYYNESFSFEVP EQIQKV ++VTV+DYD+IG ++ IG+V +G +++G E RHW+DMLANPRRPIAQWH L+
Sbjct:  122 DSKAENKEEGP-KEEQKLGKLQFSLDYHFTDGSLIVGIIQAEDLAAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKTLNPTFNEHFTFKVPYSELGGKTLVMTVYDFDRFSKHDAIGDVRVQMNKVDFSQVTEEWRVLQ--KAEKEEQEKLGDICLSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKHTLNPYYNESFSFEVPSEQIQKVQVVVTVLDYDKIGKNDAIGKVFMGLHSSGTEQRHWADMLANPRRPIAQWHALK 404          
BLAST of Synaptotagmin vs. Ensembl Cavefish
Match: syt1b (synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-166])

HSP 1 Score: 391.349 bits (1004), Expect = 1.002e-130
Identity = 196/288 (68.06%), Postives = 236/288 (81.94%), Query Frame = 1
Query:  652 ELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            + D+  E+ E    KE   LGKLQ+SLDY FT G L VG+IQA DL AMDMSGTSDPYVK++LLPDKKKKFETKVHRK LNP FNE F FK+PYSE+G KTLV  V+DFDRFSKHD IG +++ +  VD  +V EEW+ L    ++ E++ +LGDIC SLRYVPT+GKL +V+LEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK+TLNPYYNESFSFEVP EQIQKV ++VTV+DYD+IG ++ IG+V +G +++G E RHW+DMLANPRRPIAQWH L+
Sbjct:  123 DTDSKAENKEEGP-KEEQKLGKLQFSLDYHFTDGSLIVGIIQAEDLAAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKTLNPTFNEHFTFKVPYSELGGKTLVMTVYDFDRFSKHDAIGDVRVQMNKVDFSQVTEEWRVLQ--KAEKEEQEKLGDICLSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKHTLNPYYNESFSFEVPSEQIQKVQVVVTVLDYDKIGKNDAIGKVFMGLHSSGTEQRHWADMLANPRRPIAQWHALK 407          
BLAST of Synaptotagmin vs. Ensembl Cavefish
Match: syt5b (synaptotagmin-1-like [Source:NCBI gene;Acc:103029888])

HSP 1 Score: 379.022 bits (972), Expect = 1.570e-125
Identity = 186/275 (67.64%), Postives = 234/275 (85.09%), Query Frame = 1
Query:  706 NLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEK 1530
            +LGKL++SLDY+FT+ +L VG++QA DL AMD+ GTSDPYVKVFLLPDKKKKFETKV RK L PVFNETF+FKIPY+E+G K LV  V+DFDRF KHD IGQI+IP+  VDL + + +W++L    ++ E++ +LGD+C SLRYVPT+GKL + I+EAKNLKKMDVGGLSDP+VK+ L  NGKR+KKKKTT+KK TLNPY+NESFSFE+PFEQIQKV L++TV DYD++G+++PIG++ +G  ATG  LRHWSDMLANPRRP+AQWHTL  +PE+
Sbjct:  162 HLGKLEFSLDYNFTEAQLIVGILQAQDLAAMDIGGTSDPYVKVFLLPDKKKKFETKVQRKNLCPVFNETFIFKIPYAELGGKILVLLVYDFDRFGKHDVIGQIKIPMNCVDLGQPLHQWRDL--ESAEKEEQEKLGDVCISLRYVPTAGKLTVNIMEAKNLKKMDVGGLSDPFVKIVLQHNGKRLKKKKTTVKKNTLNPYFNESFSFEIPFEQIQKVQLLITVYDYDKLGSNDPIGKIFIGYGATGVGLRHWSDMLANPRRPVAQWHTL--LPEE 432          
BLAST of Synaptotagmin vs. Ensembl Sea Lamprey
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 202.216 bits (513), Expect = 3.523e-61
Identity = 98/163 (60.12%), Postives = 131/163 (80.37%), Query Frame = 1
Query:  586 VDMKSVQLLGNAYKEKVQPDLEELDANM-EDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKEL 1071
            ++MK V+ + N  K +   + E+L+  + E +E  ++KE   LGKLQ+S+DYDF   +LTVGVIQA +LPA+DM GTSDPYVK+FL+PDKKKK+ETKVHRK LNPVFNE+FVFK+PYSE+G KTLV  V+DFDRFSKHD IG++++P+ ++DL  VIEEW++L
Sbjct:   56 INMKDVKDMDNDKKNQAHSE-EDLETGLTEGDEKEEEKEEEKLGKLQFSIDYDFQNNQLTVGVIQAAELPALDMGGTSDPYVKLFLMPDKKKKYETKVHRKTLNPVFNESFVFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEVKVPMNTIDLGHVIEEWRDL 217          

HSP 2 Score: 78.1814 bits (191), Expect = 1.235e-16
Identity = 47/137 (34.31%), Postives = 80/137 (58.39%), Query Frame = 1
Query: 1108 LGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNAT--GAELRHWSDMLANPRRPIAQWHTL 1512
            LG + FS+ Y   + +L + +++A  L  +D+GG SDPYVKL LM +  + KK +T + + TLNP +NESF F+VP+ ++    L++ V D+DR    + IG V +  N    G  +  W D+++  +  +++   L
Sbjct:   97 LGKLQFSIDYDFQNNQLTVGVIQAAELPALDMGGTSDPYVKLFLMPD--KKKKYETKVHRKTLNPVFNESFVFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEVKVPMNTIDLGHVIEEWRDLVSAEKEEVSRARRL 231          
BLAST of Synaptotagmin vs. Ensembl Sea Lamprey
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 198.749 bits (504), Expect = 3.147e-60
Identity = 87/121 (71.90%), Postives = 108/121 (89.26%), Query Frame = 1
Query:  709 LGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKEL 1071
            LGKLQ+S+DYDF   +LTVGVIQA +LPA+DM GTSDPYVK+FL+PDKKKK+ETKVHRK LNPVFNE+FVFK+PYSE+G KTLV  V+DFDRFSKHD IG++++P+ ++DL  VIEEW++L
Sbjct:   80 LGKLQFSIDYDFQNNQLTVGVIQAAELPALDMGGTSDPYVKLFLMPDKKKKYETKVHRKTLNPVFNESFVFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEVKVPMNTIDLGHVIEEWRDL 200          

HSP 2 Score: 76.6406 bits (187), Expect = 3.292e-16
Identity = 46/125 (36.80%), Postives = 75/125 (60.00%), Query Frame = 1
Query: 1108 LGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNAT--GAELRHWSDMLA 1476
            LG + FS+ Y   + +L + +++A  L  +D+GG SDPYVKL LM +  + KK +T + + TLNP +NESF F+VP+ ++    L++ V D+DR    + IG V +  N    G  +  W D+++
Sbjct:   80 LGKLQFSIDYDFQNNQLTVGVIQAAELPALDMGGTSDPYVKLFLMPD--KKKKYETKVHRKTLNPVFNESFVFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEVKVPMNTIDLGHVIEEWRDLVS 202          
BLAST of Synaptotagmin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006908.1 (pep scaffold:Pmarinus_7.0:GL476344:649897:653668:1 gene:ENSPMAG00000006246.1 transcript:ENSPMAT00000006908.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 187.963 bits (476), Expect = 6.228e-57
Identity = 91/139 (65.47%), Postives = 115/139 (82.73%), Query Frame = 1
Query: 1096 KENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTL 1512
            +++RLGDICFSLRY+P++GKL IVILEA NLK MDV G SDPYVK+ +M  G R+KKKKTT+KK  LNPY+NE+FSF++PFE I+K+ L+ +V+DYD +  ++ IG+V +GC A GA  RHWSDMLANPRRPI QWHTL
Sbjct:    6 QQDRLGDICFSLRYIPSTGKLTIVILEATNLKVMDVSGASDPYVKIQVMEGGIRLKKKKTTVKKKALNPYFNEAFSFDIPFENIEKIQLVFSVMDYDSLSRNDAIGKVYVGCGAAGAGHRHWSDMLANPRRPITQWHTL 144          

HSP 2 Score: 83.9593 bits (206), Expect = 1.813e-19
Identity = 47/111 (42.34%), Postives = 73/111 (65.77%), Query Frame = 1
Query:  709 LGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPD--KKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSV 1035
            LG + +SL Y  + G+LT+ +++AT+L  MD+SG SDPYVK+ ++    + KK +T V +K LNP FNE F F IP+  +    LVF+V D+D  S++D IG++ +  G+ 
Sbjct:   10 LGDICFSLRYIPSTGKLTIVILEATNLKVMDVSGASDPYVKIQVMEGGIRLKKKKTTVKKKALNPYFNEAFSFDIPFENIEKIQLVFSVMDYDSLSRNDAIGKVYVGCGAA 120          
BLAST of Synaptotagmin vs. Ensembl Sea Lamprey
Match: SYT5 (synaptotagmin 5 [Source:HGNC Symbol;Acc:HGNC:11513])

HSP 1 Score: 182.185 bits (461), Expect = 5.404e-54
Identity = 83/157 (52.87%), Postives = 114/157 (72.61%), Query Frame = 1
Query:  622 YKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDN 1092
            +K KVQPDLE++D    ++   ++     LG+LQ+SLDY+    + TVG++QATDL AMD+ G SDPYV+V+LLP KKKKFET VHRK LNP+F E F F +P+ E+  + LV  V+DFDRFS+HD IG+++IPL SVDL   +EEW++L   + D+
Sbjct:   54 FKNKVQPDLEDIDPGFIEDIYKEN----TLGRLQFSLDYNLKTSQFTVGILQATDLAAMDIGGMSDPYVRVYLLPHKKKKFETSVHRKTLNPIFEEKFTFTVPFEELVERVLVMVVYDFDRFSRHDIIGELRIPLSSVDLSHSVEEWRDLQKTEKDD 206          

HSP 2 Score: 82.4185 bits (202), Expect = 3.107e-18
Identity = 49/130 (37.69%), Postives = 77/130 (59.23%), Query Frame = 1
Query: 1087 DNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIG--RVVLGCNATGAELRHWSDM 1470
            D  KEN LG + FSL Y   + +  + IL+A +L  MD+GG+SDPYV++ L+ +    KK +T++ + TLNP + E F+F VPFE++ +  L++ V D+DR    + IG  R+ L        +  W D+
Sbjct:   72 DIYKENTLGRLQFSLDYNLKTSQFTVGILQATDLAAMDIGGMSDPYVRVYLLPHK--KKKFETSVHRKTLNPIFEEKFTFTVPFEELVERVLVMVVYDFDRFSRHDIIGELRIPLSSVDLSHSVEEWRDL 199          
BLAST of Synaptotagmin vs. Ensembl Sea Lamprey
Match: SYT6 (synaptotagmin 6 [Source:HGNC Symbol;Acc:HGNC:18638])

HSP 1 Score: 147.132 bits (370), Expect = 1.570e-40
Identity = 70/155 (45.16%), Postives = 104/155 (67.10%), Query Frame = 1
Query:  631 KVQPDL-EELDANMEDNEGAQDKEAVN-----LGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIP--LGSVDLCKVIEEWKEL 1071
            +++P+L ++     +D +G     A N      GKL ++L YD+   +L V V +A +LPA D SGTSDPYVK++LLPD+K+K++TKVHRK LNPVF ETF F +PY+E+ ++ L F+V+DFDRFS+HD IGQ+ +       DL +    W+++
Sbjct:   81 RIKPELYKQRSVEGDDADGGCGTTAANDGRTLAGKLNFALHYDYEMEQLLVRVCRAAELPAKDFSGTSDPYVKIYLLPDRKRKYQTKVHRKTLNPVFEETFQFFVPYAELPARRLHFSVYDFDRFSRHDTIGQVVVDNLFEESDLSRETSLWRDI 235          

HSP 2 Score: 58.5362 bits (140), Expect = 6.439e-10
Identity = 38/112 (33.93%), Postives = 61/112 (54.46%), Query Frame = 1
Query: 1090 NEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVL 1425
            N+     G + F+L Y     +L + +  A  L   D  G SDPYVK+ L+ +  R +K +T + + TLNP + E+F F VP+ ++    L  +V D+DR    + IG+VV+
Sbjct:  107 NDGRTLAGKLNFALHYDYEMEQLLVRVCRAAELPAKDFSGTSDPYVKIYLLPD--RKRKYQTKVHRKTLNPVFEETFQFFVPYAELPARRLHFSVYDFDRFSRHDTIGQVVV 216          
BLAST of Synaptotagmin vs. Ensembl Yeast
Match: TCB3 (Cortical ER protein involved in ER-plasma membrane tethering; one of 6 proteins (Ist2p, Scs2p, Scs22p, Tcb1p, Tcb2p, Tcb3p) that connect ER to the plasma membrane (PM) and regulate PM phosphatidylinositol-4-phosphate (PI4P) levels by controlling access of Sac1p phosphatase to its substrate PI4P in the PM; localized to the bud via specific mRNA transport; non-tagged protein detected in a phosphorylated state in mitochondria; C-termini of Tcb1p, Tcb2p and Tcb3p interact [Source:SGD;Acc:S000004537])

HSP 1 Score: 64.6994 bits (156), Expect = 3.697e-11
Identity = 34/100 (34.00%), Postives = 58/100 (58.00%), Query Frame = 1
Query:  751 GELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKV 1050
            G L + +I    L + D +G SDP+V +F+  + KK F++ + +K L+PV+NE    KIP        ++FNV D+DR   +D +GQ  + + S+++ K 
Sbjct: 1134 GYLNIKLISGHGLKSADRNGYSDPFVHIFV--NDKKVFKSNIKKKTLDPVWNEDA--KIPILSRSKNQVIFNVLDWDRAGDNDDLGQASLDVSSLEVGKT 1229          
BLAST of Synaptotagmin vs. Ensembl Yeast
Match: TCB1 (Lipid-binding ER protein involved in ER-plasma membrane tethering; one of 6 proteins (Ist2p, Scs2p, Scs22p, Tcb1p, Tcb2p, Tcb3p) that connect ER to plasma membrane and regulate PI4P levels by controlling access of Sac1p phosphatase to its substrate PI4P in PM; contains 3 calcium and lipid binding domains; non-tagged protein also localizes to mitochondria; C-termini of Tcb1p, Tcb2p and Tcb3p interact; TCB1 has a paralog, TCB2, that arose from the whole genome duplication [Source:SGD;Acc:S000005612])

HSP 1 Score: 57.3806 bits (137), Expect = 5.600e-9
Identity = 34/95 (35.79%), Postives = 54/95 (56.84%), Query Frame = 1
Query:  751 GELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSV 1035
            G+LT+    A +L A D++G SDPY+K ++  ++   ++TKV +K LNP +N+    +I  +   +  L   V D+D  S  D IG  +IPL  V
Sbjct:  992 GDLTIMSRSAENLIASDLNGYSDPYLKYYINNEEDCAYKTKVVKKTLNPKWNDEGTIQI--NNRLNDVLRIKVMDWDSTSADDTIGTAEIPLNKV 1084          
BLAST of Synaptotagmin vs. Ensembl Yeast
Match: TCB2 (ER protein involved in ER-plasma membrane tethering; one of 6 proteins (Ist2p, Scs2p, Scs22p, Tcb1p, Tcb2p, Tcb3p) that connect ER to plasma membrane (PM) and regulate PM phosphatidylinositol-4-phosphate (PI4P) levels by controlling access of Sac1p phosphatase to its substrate PI4P in the PM; contains 3 calcium and lipid binding domains; mRNA is targeted to bud; TCB2 has a paralog, TCB1, that arose from the whole genome duplication [Source:SGD;Acc:S000005031])

HSP 1 Score: 51.9878 bits (123), Expect = 2.358e-7
Identity = 31/97 (31.96%), Postives = 53/97 (54.64%), Query Frame = 1
Query:  751 GELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKK-FETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVD 1038
            G+L +    A +L  ++ +G SDPYV+ FL        F+T V +K LNP +NE+   ++  S   +  L  NV D++  + +  IG+  +PL ++D
Sbjct:  983 GDLKITAKSAENLIGVNKNGYSDPYVEFFLNEKSTSPFFKTAVQKKTLNPTWNESKTIEV--SNRVNDYLTINVKDYESTNSNRSIGKAVVPLSTID 1077          
BLAST of Synaptotagmin vs. Ensembl Nematostella
Match: EDO31746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX17])

HSP 1 Score: 370.548 bits (950), Expect = 7.451e-124
Identity = 185/315 (58.73%), Postives = 246/315 (78.10%), Query Frame = 1
Query:  586 VDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFK-IPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDN---EKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQD 1518
            VD ++VQ+ G +Y+EKVQP ++ELD N ED   +     V +G++ ++LDY FT   LTVG+I+A D+PA D SG+SDPYVK+ LLPDKKKK+ETKVHRK LNPVFNE FVFK IPYSE+ ++ L+  +FDFDRFS+HD IG+ ++PL  VDL   I EW+ L PP         ++ LGDICFSLRYVP+SGKL I I+EAK+LK MD+ G SDPYVK++L+  G+++KKKKTT+KK TLNPYYNE+F+F V FE+I++ +LI++V+DYDR+G SE IG+ V+G  ++GA+LRHW+DMLA+PRR +AQWHTL +
Sbjct:   45 VDFRAVQI-GASYQEKVQPSMDELDYNSEDYH-SDLSSGVKIGRINFTLDYSFTDNTLTVGIIRAEDIPAKDFSGSSDPYVKIMLLPDKKKKYETKVHRKTLNPVFNEQFVFKNIPYSEITNRILLMELFDFDRFSRHDLIGEARLPLIDVDLASNINEWRVLTPPSGSGGAGHSKSDLGDICFSLRYVPSSGKLQITIVEAKSLKSMDLTGYSDPYVKIALVQEGRKIKKKKTTVKKRTLNPYYNETFTFTVAFEKIEQTSLIISVLDYDRVGKSEMIGKCVVGELSSGADLRHWADMLASPRRSVAQWHTLHN 357          
BLAST of Synaptotagmin vs. Ensembl Nematostella
Match: EDO43704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXY7])

HSP 1 Score: 251.521 bits (641), Expect = 4.664e-79
Identity = 135/272 (49.63%), Postives = 192/272 (70.59%), Query Frame = 1
Query:  709 LGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFK-IPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEW-KELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQD 1518
            LGK+ +SL Y  +   LT+ V++A  LPA D SGTSDP+VK+ LLPDKK K ET+V RK LNPV+NE F F+  P++++  KTL   V D+DRFS++D IG+++IPL ++DL  V   + K+L P   D      LGD+  SL Y PT+ ++ +V+++A  LK MD+ G SDPYVK+ +M   +R+ KKKTTIK+ T +P +NESF F+VP ++I+ +  +  V+DYDRI  +E IG+V+LG   TG+ LRHW++M+ NPR+P+AQWH LQD
Sbjct:    3 LGKIFFSLTYYSSDSVLTLKVLKAQGLPAKDFSGTSDPFVKIMLLPDKKHKLETRVKRKNLNPVWNEVFTFEGFPHNKLMGKTLYMQVLDYDRFSRNDPIGEVEIPLENIDLGPVTLTFTKDLLPCKKDRVP---LGDLLVSLMYQPTNNRIIVVVMKANKLKAMDLTGSSDPYVKMYIMHKDRRLDKKKTTIKRRTRDPVWNESFIFDVPLDKIRDLTFVFNVMDYDRITQNELIGQVILGYRTTGSSLRHWTEMMNNPRKPVAQWHRLQD 271          

HSP 2 Score: 93.2041 bits (230), Expect = 4.583e-21
Identity = 48/128 (37.50%), Postives = 79/128 (61.72%), Query Frame = 1
Query:  694 KEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKK--KFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKEL 1071
            K+ V LG L  SL Y  T   + V V++A  L AMD++G+SDPYVK++++   ++  K +T + R+  +PV+NE+F+F +P  ++   T VFNV D+DR ++++ IGQ+   LG       +  W E+
Sbjct:  130 KDRVPLGDLLVSLMYQPTNNRIIVVVMKANKLKAMDLTGSSDPYVKMYIMHKDRRLDKKKTTIKRRTRDPVWNESFIFDVPLDKIRDLTFVFNVMDYDRITQNELIGQVI--LGYRTTGSSLRHWTEM 255          

HSP 3 Score: 65.855 bits (159), Expect = 7.087e-12
Identity = 42/106 (39.62%), Postives = 62/106 (58.49%), Query Frame = 1
Query: 1105 RLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFE-VPFEQIQKVNLIVTVVDYDRIGTSEPIGRV 1419
            +LG I FSL Y  +   L + +L+A+ L   D  G SDP+VK  +ML   +  K +T +K+  LNP +NE F+FE  P  ++    L + V+DYDR   ++PIG V
Sbjct:    2 QLGKIFFSLTYYSSDSVLTLKVLKAQGLPAKDFSGTSDPFVK--IMLLPDKKHKLETRVKRKNLNPVWNEVFTFEGFPHNKLMGKTLYMQVLDYDRFSRNDPIGEV 105          
BLAST of Synaptotagmin vs. Ensembl Nematostella
Match: EDO50013 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF18])

HSP 1 Score: 178.718 bits (452), Expect = 2.461e-51
Identity = 111/291 (38.14%), Postives = 183/291 (62.89%), Query Frame = 1
Query:  667 MEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEE-----WKELGPPDSDNEKEN--RLGDICFSLRYVPTSGKLNIVILEAK-NLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNA-TGAELRHWSDMLANPRRPIAQWHTL 1512
            M D  G   ++++  GKL++S+ YD T   L V V++A +L   + +     YV+VFLLPDK +K++T V  K  NPVFNETF F + +SE+  +TL F + D+D +S+H  +G++     S D+   ++E     +++    D    +EN  R G++  SL Y+PTSG+L  V+L+A+ +++ +    LSDP+VK+SLM++G+++KK KT++   TL P YNE+F F++P E++  V+L+V ++  D     + I + V+G ++ T   L HW+ M+ +PR+PIAQWH L
Sbjct:    1 MSDCNGNPFEQSLGCGKLEFSIMYDTTCECLRVRVLKANNLSVPEATT----YVEVFLLPDKIEKYQTNVKYKNSNPVFNETFEFDVAFSELPERTLQFCINDYDGYSRHQALGEV---FHSFDVNVNMQEDTVVIYEKDIRRDIFTFRENQVRKGEVLLSLCYLPTSGRLTFVVLKARLSMRLLFRYSLSDPFVKVSLMVSGRQIKKTKTSVMHGTLRPVYNEAFVFDIPVERLSDVSLLVRMLHSDG-KRCQTIAKTVVGPDSQTSIGLHHWNCMMTSPRKPIAQWHPL 283          
BLAST of Synaptotagmin vs. Ensembl Nematostella
Match: EDO41933 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S352])

HSP 1 Score: 168.318 bits (425), Expect = 1.992e-47
Identity = 106/277 (38.27%), Postives = 153/277 (55.23%), Query Frame = 1
Query:  700 AVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLP--DKKKKFETKVHRKILNPVFNETFVF-KIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDM 1521
             + LG L+++L Y      L V +  A  L  MD  GTSDPYVK+ LLP   K  K  +    K LNPVFNET  +  I   E+ SKTL   VFD D   ++D IG+  I L  ++     + +K    P + +   + LG I  +L+Y    G L + ++    L  MD  G SDPYVK  L  + ++  K++T I+K TLNP +NE F +++   ++ K +L VTV DYD   +++ IG V+L  NA G+ L+HW DML  P +   QWHTL+++
Sbjct:   16 CLGLGLLEFTLRYQKLDSRLDVVLHDAKGLKPMDHGGTSDPYVKLHLLPGASKSNKLRSHTKYKTLNPVFNETLTYYGITEEEISSKTLRLQVFDEDTIGRNDFIGETSINLKLLN-SNPTQTFKRSLIPKALDSPHSPLGRIQLALKYNTQRGMLFVTVMRCSGLASMDANGYSDPYVKCYLKPDPQKKSKRRTNIRKKTLNPEFNEEFVYDIAHHELAKKSLEVTVWDYDVGKSNDFIGGVILNINAEGSALKHWYDMLKGPNQLHTQWHTLENV 291          

HSP 2 Score: 90.1225 bits (222), Expect = 6.708e-20
Identity = 47/112 (41.96%), Postives = 68/112 (60.71%), Query Frame = 1
Query:  685 AQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPD--KKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQI 1014
            A D     LG++Q +L Y+  +G L V V++ + L +MD +G SDPYVK +L PD  KK K  T + +K LNP FNE FV+ I + E+  K+L   V+D+D    +D IG +
Sbjct:  146 ALDSPHSPLGRIQLALKYNTQRGMLFVTVMRCSGLASMDANGYSDPYVKCYLKPDPQKKSKRRTNIRKKTLNPEFNEEFVYDIAHHELAKKSLEVTVWDYDVGKSNDFIGGV 257          
BLAST of Synaptotagmin vs. Ensembl Nematostella
Match: EDO33081 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST78])

HSP 1 Score: 159.844 bits (403), Expect = 6.260e-45
Identity = 98/270 (36.30%), Postives = 156/270 (57.78%), Query Frame = 1
Query:  715 KLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLK-KMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSE-PIGRVVLG--CNATGAELRHWSDMLANPRRPIAQWHTL 1512
            +L +SL+Y     +L V +I+AT L     +  + PYVK+ LLPD+K+K ++    +  NP FNE FVF +P  E+  +TL F V DFDRFS+   IG +Q+                        EK    G + FSL+Y+PT+ +L + IL+ K+L+ + +     D YVK+S+++ GK VKK+KT + K T NP +N++F F +P   ++ V+ +++V+   + G ++  +GR V+G    +T   L HW+DML +PR  +AQWH+L
Sbjct:    5 RLCFSLNYSHYNEKLQVKLIRATRLTPKGNNVVATPYVKMCLLPDRKRKLQSTRRHRNSNPAFNEDFVFSVPAEELRMRTLKFTVCDFDRFSRQQVIGHVQL------------------------EK----GQLLFSLQYLPTACRLTVAILKGKDLRVEGEETTEIDTYVKVSMIMGGKAVKKRKTPVVKKTCNPVFNQAFVFSMPPSYLENVSFVISVIATPKRGGNKIHVGRAVVGPYMYSTSPGLSHWTDMLGSPRSAVAQWHSL 246          
BLAST of Synaptotagmin vs. Ensembl Medaka
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:101166921])

HSP 1 Score: 416.387 bits (1069), Expect = 2.012e-140
Identity = 224/361 (62.05%), Postives = 278/361 (77.01%), Query Frame = 1
Query:  436 LKTFHMSTGTLIGIGVTVSIVVLLLLYCXXXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEG-AQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            L    + +  ++ I     I+VL   +CICK+ I K+K KK G  KG   ++MK V+   +  K +   D E+ +  + + E  A+ KE+  LGKLQYSLDY+FT+  L VG+IQA +LPAMDM GTSDPYVKV+LLPDKKKKFETKVHRK LNPVFNE F FK+PY E+G KTLV  V+DFDRFSKHD IG I++P+  VD   V EEW++L    ++ E++ +LGDICFSLRYVPT+GKL +V+LEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV +++TV+DYD+IG ++ IG+V +G N++G ELRHWSDMLANPRRPIAQWH L+
Sbjct:   54 LNKIPLPSWAIVSIAFVAIILVLACCFCICKKWIFKKKNKKKGKDKGKNAINMKDVK---DGAKTEALKDEEDAETGLTETEKEAEPKESEKLGKLQYSLDYNFTENTLMVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYVELGGKTLVMTVYDFDRFSKHDAIGDIKVPMNKVDFSHVTEEWRDL--QSAEKEEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVITVLDYDKIGKNDAIGKVFVGLNSSGTELRHWSDMLANPRRPIAQWHVLK 409          
BLAST of Synaptotagmin vs. Ensembl Medaka
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:101166921])

HSP 1 Score: 416.387 bits (1069), Expect = 2.012e-140
Identity = 224/361 (62.05%), Postives = 278/361 (77.01%), Query Frame = 1
Query:  436 LKTFHMSTGTLIGIGVTVSIVVLLLLYCXXXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEG-AQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            L    + +  ++ I     I+VL   +CICK+ I K+K KK G  KG   ++MK V+   +  K +   D E+ +  + + E  A+ KE+  LGKLQYSLDY+FT+  L VG+IQA +LPAMDM GTSDPYVKV+LLPDKKKKFETKVHRK LNPVFNE F FK+PY E+G KTLV  V+DFDRFSKHD IG I++P+  VD   V EEW++L    ++ E++ +LGDICFSLRYVPT+GKL +V+LEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV +++TV+DYD+IG ++ IG+V +G N++G ELRHWSDMLANPRRPIAQWH L+
Sbjct:   54 LNKIPLPSWAIVSIAFVAIILVLACCFCICKKWIFKKKNKKKGKDKGKNAINMKDVK---DGAKTEALKDEEDAETGLTETEKEAEPKESEKLGKLQYSLDYNFTENTLMVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYVELGGKTLVMTVYDFDRFSKHDAIGDIKVPMNKVDFSHVTEEWRDL--QSAEKEEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVITVLDYDKIGKNDAIGKVFVGLNSSGTELRHWSDMLANPRRPIAQWHVLK 409          
BLAST of Synaptotagmin vs. Ensembl Medaka
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:101166921])

HSP 1 Score: 416.387 bits (1069), Expect = 2.012e-140
Identity = 224/361 (62.05%), Postives = 278/361 (77.01%), Query Frame = 1
Query:  436 LKTFHMSTGTLIGIGVTVSIVVLLLLYCXXXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEG-AQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            L    + +  ++ I     I+VL   +CICK+ I K+K KK G  KG   ++MK V+   +  K +   D E+ +  + + E  A+ KE+  LGKLQYSLDY+FT+  L VG+IQA +LPAMDM GTSDPYVKV+LLPDKKKKFETKVHRK LNPVFNE F FK+PY E+G KTLV  V+DFDRFSKHD IG I++P+  VD   V EEW++L    ++ E++ +LGDICFSLRYVPT+GKL +V+LEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV +++TV+DYD+IG ++ IG+V +G N++G ELRHWSDMLANPRRPIAQWH L+
Sbjct:   54 LNKIPLPSWAIVSIAFVAIILVLACCFCICKKWIFKKKNKKKGKDKGKNAINMKDVK---DGAKTEALKDEEDAETGLTETEKEAEPKESEKLGKLQYSLDYNFTENTLMVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYVELGGKTLVMTVYDFDRFSKHDAIGDIKVPMNKVDFSHVTEEWRDL--QSAEKEEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVITVLDYDKIGKNDAIGKVFVGLNSSGTELRHWSDMLANPRRPIAQWHVLK 409          
BLAST of Synaptotagmin vs. Ensembl Medaka
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:101166921])

HSP 1 Score: 416.387 bits (1069), Expect = 7.948e-139
Identity = 224/361 (62.05%), Postives = 278/361 (77.01%), Query Frame = 1
Query:  436 LKTFHMSTGTLIGIGVTVSIVVLLLLYCXXXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEG-AQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            L    + +  ++ I     I+VL   +CICK+ I K+K KK G  KG   ++MK V+   +  K +   D E+ +  + + E  A+ KE+  LGKLQYSLDY+FT+  L VG+IQA +LPAMDM GTSDPYVKV+LLPDKKKKFETKVHRK LNPVFNE F FK+PY E+G KTLV  V+DFDRFSKHD IG I++P+  VD   V EEW++L    ++ E++ +LGDICFSLRYVPT+GKL +V+LEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV +++TV+DYD+IG ++ IG+V +G N++G ELRHWSDMLANPRRPIAQWH L+
Sbjct:  168 LNKIPLPSWAIVSIAFVAIILVLACCFCICKKWIFKKKNKKKGKDKGKNAINMKDVK---DGAKTEALKDEEDAETGLTETEKEAEPKESEKLGKLQYSLDYNFTENTLMVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYVELGGKTLVMTVYDFDRFSKHDAIGDIKVPMNKVDFSHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVITVLDYDKIGKNDAIGKVFVGLNSSGTELRHWSDMLANPRRPIAQWHVLK 523          
BLAST of Synaptotagmin vs. Ensembl Medaka
Match: syt2a (synaptotagmin-2 [Source:NCBI gene;Acc:101161806])

HSP 1 Score: 387.882 bits (995), Expect = 3.472e-129
Identity = 189/269 (70.26%), Postives = 232/269 (86.25%), Query Frame = 1
Query:  709 LGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1515
            LGKLQYS+DYDF + +LTVG++QA DL +MD  GTSDPYVKVF+LPDKKKKF+TKVH+K LNPVFNETF FKIP+ E+G KTLV +V+DFDRFSKHD IG+I+IP+ ++DL K IEEW++L    +D E+  +LGDIC SLRYVPT+GKL I ILEAKNLKKMDVGGLSDPYVK++L+ NGKR+KKKKTT+KK TLNPYYNESFSFE+P EQ+QK+  ++TV+DYD+IG ++ IG++ +G  +TGA L+HWSDMLANPRRPIAQWH LQ
Sbjct:  150 LGKLQYSIDYDFQENKLTVGILQAADLLSMDSGGTSDPYVKVFVLPDKKKKFDTKVHKKTLNPVFNETFTFKIPFQEMGGKTLVMSVYDFDRFSKHDVIGEIKIPMNTLDLAKPIEEWRDLD--SADQEEPEKLGDICISLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKINLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPLEQMQKIQAVITVLDYDKIGKNDAIGKIWVGSKSTGAGLKHWSDMLANPRRPIAQWHPLQ 416          
BLAST of Synaptotagmin vs. Planmine SMEST
Match: SMESG000055143.1 (SMESG000055143.1)

HSP 1 Score: 752.281 bits (1941), Expect = 0.000e+0
Identity = 407/408 (99.75%), Postives = 408/408 (100.00%), Query Frame = 1
Query:  310 MTIKMQQNVEKSVSQHVTAQTKESTSNKLHTTTAGISVLEKTLKTFHMSTGTLIGIGVTVSIVVLLLLYCXXXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEKS 1533
            MTIKMQQNVEKSVSQHVTAQTKESTSNKLHTTTAGISVLEKTLKTFHMSTGTLIGIGVTVSIVVLLLLYCICKRCIKKRKKKKDGGKKGGKGVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGV+QATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEKS
Sbjct:    1 MTIKMQQNVEKSVSQHVTAQTKESTSNKLHTTTAGISVLEKTLKTFHMSTGTLIGIGVTVSIVVLLLLYCICKRCIKKRKKKKDGGKKGGKGVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVVQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEKS 408          
BLAST of Synaptotagmin vs. Planmine SMEST
Match: SMESG000055143.1 (SMESG000055143.1)

HSP 1 Score: 752.281 bits (1941), Expect = 0.000e+0
Identity = 407/408 (99.75%), Postives = 408/408 (100.00%), Query Frame = 1
Query:  310 MTIKMQQNVEKSVSQHVTAQTKESTSNKLHTTTAGISVLEKTLKTFHMSTGTLIGIGVTVSIVVLLLLYCXXXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEKS 1533
            MTIKMQQNVEKSVSQHVTAQTKESTSNKLHTTTAGISVLEKTLKTFHMSTGTLIGIGVTVSIVVLLLLYCICKRCIKKRKKKKDGGKKGGKGVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGV+QATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEKS
Sbjct:   13 MTIKMQQNVEKSVSQHVTAQTKESTSNKLHTTTAGISVLEKTLKTFHMSTGTLIGIGVTVSIVVLLLLYCICKRCIKKRKKKKDGGKKGGKGVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVVQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEKS 420          
BLAST of Synaptotagmin vs. Planmine SMEST
Match: SMESG000055143.1 (SMESG000055143.1)

HSP 1 Score: 743.806 bits (1919), Expect = 0.000e+0
Identity = 403/404 (99.75%), Postives = 404/404 (100.00%), Query Frame = 1
Query:  322 MQQNVEKSVSQHVTAQTKESTSNKLHTTTAGISVLEKTLKTFHMSTGTLIGIGVTVSIVVLLLLYCXXXXXXXXXXXXXXXXXXXXXXVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEKS 1533
            MQQNVEKSVSQHVTAQTKESTSNKLHTTTAGISVLEKTLKTFHMSTGTLIGIGVTVSIVVLLLLYCICKRCIKKRKKKKDGGKKGGKGVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGV+QATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEKS
Sbjct:    1 MQQNVEKSVSQHVTAQTKESTSNKLHTTTAGISVLEKTLKTFHMSTGTLIGIGVTVSIVVLLLLYCICKRCIKKRKKKKDGGKKGGKGVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVVQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEKS 404          
BLAST of Synaptotagmin vs. Planmine SMEST
Match: SMESG000025329.1 (SMESG000025329.1)

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 283/314 (90.13%), Postives = 304/314 (96.82%), Query Frame = 1
Query:  586 VDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPE 1527
            VDMKS QLLGN+YKEK+QPDLEELDANMEDNEG ++KE V+LGKLQYSLDYDF KGELTVGVIQATDLPAMDMSGTSDPYVK++LLPDKKKKFETKVHRKILNPVFNETFVFK+P++EV SKTL+FNV+DFDRFSKHDQIGQI++PLG++DL +VIEEWKEL  P++D EKENRLGDICFSLRYVPTSGKL IVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGR+VLGCNATGAELRHWSDMLANPRRPIAQWHTLQ+MPE
Sbjct:   80 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPE 393          
BLAST of Synaptotagmin vs. Planmine SMEST
Match: SMESG000021478.1 (SMESG000021478.1)

HSP 1 Score: 470.315 bits (1209), Expect = 5.530e-162
Identity = 232/312 (74.36%), Postives = 276/312 (88.46%), Query Frame = 1
Query:  595 KSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEK 1530
            K+++++G A   K Q D E+L  + +D+   +++E   LGKL+Y LDYDFTKGELTVG++QA +LPA+DM+GTSDPYVKVFL PDKKKKFETKVHRK LNPVF+E F+FK+P++E+ SKTL  +++DFDRFSKHDQIGQ++IPLGS+DLC+V++EWKEL P     EKEN+LGDICFSLRYVPT+GKL +V+LEAKNLKKMDVGGLSDPYVK+SLM+NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQ++NLIVTVVDYDRIGTSEPIGRVVLGCNA+G  LR WSDMLANPRRPIAQW TLQ+MPEK
Sbjct:   90 KNMKIIGGAVDNKTQSDEEDLVLDKDDDNEKKEEEKEYLGKLEYKLDYDFTKGELTVGILQAQELPALDMNGTSDPYVKVFLKPDKKKKFETKVHRKTLNPVFDEVFLFKVPFAEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGKRIKKKKTTIKKCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK 401          
The following BLAST results are available for this feature:
BLAST of Synaptotagmin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYT16.524e-14062.94synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT16.524e-14062.94synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT16.524e-14062.94synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT11.235e-13862.43synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT29.607e-13566.23synaptotagmin 2 [Source:HGNC Symbol;Acc:HGNC:11510... [more]
back to top
BLAST of Synaptotagmin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snt-11.518e-13857.84Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-12.075e-12754.39Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-38.559e-11765.67SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5... [more]
snt-38.559e-11765.67SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5... [more]
snt-21.299e-8850.54Synaptotagmin 2 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
back to top
BLAST of Synaptotagmin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syt13.585e-15658.85gene:FBgn0004242 transcript:FBtr0077726[more]
Syt19.198e-15658.85gene:FBgn0004242 transcript:FBtr0343993[more]
Syt12.932e-15558.61gene:FBgn0004242 transcript:FBtr0332218[more]
Syt15.512e-15358.37gene:FBgn0004242 transcript:FBtr0077728[more]
Syt15.512e-15358.37gene:FBgn0004242 transcript:FBtr0345331[more]
back to top
BLAST of Synaptotagmin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt1a7.415e-13672.86synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-... [more]
syt1a7.415e-13672.86synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-... [more]
syt2a2.172e-12568.03synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
syt2a2.172e-12568.03synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
syt5b1.049e-12370.74synaptotagmin Vb [Source:ZFIN;Acc:ZDB-GENE-050522-... [more]
back to top
BLAST of Synaptotagmin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYT51.842e-14969.01synaptotagmin 5 [Source:NCBI gene;Acc:100493612][more]
SYT51.929e-14969.01synaptotagmin 5 [Source:NCBI gene;Acc:100493612][more]
e2f41.555e-13963.46E2F transcription factor 4 [Source:Xenbase;Acc:XB-... [more]
luzp21.292e-13070.19leucine zipper protein 2 [Source:Xenbase;Acc:XB-GE... [more]
syt84.032e-10956.72synaptotagmin 8 [Source:NCBI gene;Acc:100037878][more]
back to top
BLAST of Synaptotagmin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syt11.211e-13968.71synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667][more]
Syt11.211e-13968.71synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667][more]
Syt23.979e-13566.23synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666][more]
Syt23.979e-13566.23synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666][more]
Syt53.784e-12259.68synaptotagmin V [Source:MGI Symbol;Acc:MGI:1926368... [more]
back to top
BLAST of Synaptotagmin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P41823|SY65_APLCA1.948e-17679.18Synaptotagmin-1 OS=Aplysia californica OX=6500 GN=... [more]
sp|P21521|SY65_DROME3.594e-15558.85Synaptotagmin 1 OS=Drosophila melanogaster OX=7227... [more]
sp|P48018|SYT1_BOVIN3.033e-13962.94Synaptotagmin-1 OS=Bos taurus OX=9913 GN=SYT1 PE=1... [more]
sp|P21579|SYT1_HUMAN3.133e-13962.94Synaptotagmin-1 OS=Homo sapiens OX=9606 GN=SYT1 PE... [more]
sp|P46096|SYT1_MOUSE8.472e-13968.71Synaptotagmin-1 OS=Mus musculus OX=10090 GN=Syt1 P... [more]
back to top
BLAST of Synaptotagmin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q9U8R60.000e+090.51Djsyt protein OS=Dugesia japonica OX=6161 GN=Djsyt... [more]
A0A267E3330.000e+073.76Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GS860.000e+073.76Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E6V10.000e+073.76Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A183QG720.000e+080.17Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
back to top
BLAST of Synaptotagmin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt1a7.739e-13961.22synaptotagmin 1 [Source:NCBI gene;Acc:103044539][more]
syt1a6.718e-13869.18synaptotagmin 1 [Source:NCBI gene;Acc:103044539][more]
syt1b7.229e-13168.53synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-... [more]
syt1b1.002e-13068.06synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-... [more]
syt5b1.570e-12567.64synaptotagmin-1-like [Source:NCBI gene;Acc:1030298... [more]
back to top
BLAST of Synaptotagmin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt2a3.523e-6160.12synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
syt2a3.147e-6071.90synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
ENSPMAT00000006908.16.228e-5765.47pep scaffold:Pmarinus_7.0:GL476344:649897:653668:1... [more]
SYT55.404e-5452.87synaptotagmin 5 [Source:HGNC Symbol;Acc:HGNC:11513... [more]
SYT61.570e-4045.16synaptotagmin 6 [Source:HGNC Symbol;Acc:HGNC:18638... [more]
back to top
BLAST of Synaptotagmin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
TCB33.697e-1134.00Cortical ER protein involved in ER-plasma membrane... [more]
TCB15.600e-935.79Lipid-binding ER protein involved in ER-plasma mem... [more]
TCB22.358e-731.96ER protein involved in ER-plasma membrane tetherin... [more]
back to top
BLAST of Synaptotagmin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO317467.451e-12458.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437044.664e-7949.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500132.461e-5138.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419331.992e-4738.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330816.260e-4536.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Synaptotagmin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt1a2.012e-14062.05synaptotagmin 1 [Source:NCBI gene;Acc:101166921][more]
syt1a2.012e-14062.05synaptotagmin 1 [Source:NCBI gene;Acc:101166921][more]
syt1a2.012e-14062.05synaptotagmin 1 [Source:NCBI gene;Acc:101166921][more]
syt1a7.948e-13962.05synaptotagmin 1 [Source:NCBI gene;Acc:101166921][more]
syt2a3.472e-12970.26synaptotagmin-2 [Source:NCBI gene;Acc:101161806][more]
back to top
BLAST of Synaptotagmin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055143.10.000e+099.75SMESG000055143.1[more]
SMESG000055143.10.000e+099.75SMESG000055143.1[more]
SMESG000055143.10.000e+099.75SMESG000055143.1[more]
SMESG000025329.10.000e+090.13SMESG000025329.1[more]
SMESG000021478.15.530e-16274.36SMESG000021478.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019471 ID=SMED30019471|Name=Synaptotagmin|organism=Schmidtea mediterranea sexual|type=transcript|length=1910bp
TTTGGGACTTCTCCAATCTATTAAATATATTTAGAACGAACATCGTTGTG
AGAAGCTTTGTCTTGCAAATGCACACCAACACATTCTCTGCCTACTCGAG
ACCAGCCTGAAGGACGCACCCAGTCATCTCTTATAAAAAAAAAACTCTTC
TCTGATTCGGTATTTTCTGATTAATGGAGATCAAACAATGATTGGGCAAC
GTCTAGTTTAGAATATTTACAACTAAATCTGCGTATTTCAATTTTTTTTC
GATTTTGATTGTTGCAAATATTTATGAGTATATCCAATAATATAAGCAGC
GCTAGTAATATGACGATAAAAATGCAACAAAATGTTGAAAAGTCTGTATC
ACAGCATGTAACAGCGCAAACAAAGGAATCAACATCAAATAAACTTCATA
CAACAACAGCCGGTATCTCGGTTTTGGAGAAAACATTAAAAACATTTCAC
ATGAGTACTGGCACTTTGATTGGAATCGGAGTTACAGTGTCTATCGTAGT
TTTATTACTTCTTTATTGTATTTGCAAACGATGCATTAAGAAACGAAAGA
AAAAGAAAGATGGCGGCAAAAAAGGTGGAAAAGGCGTAGACATGAAAAGC
GTACAACTATTAGGAAATGCTTATAAAGAAAAGGTACAGCCGGACCTAGA
AGAACTGGATGCTAACATGGAAGATAATGAAGGGGCGCAAGATAAAGAAG
CAGTCAATCTTGGAAAATTACAGTATTCCCTTGATTACGATTTTACAAAA
GGCGAGCTAACAGTCGGAGTAATTCAAGCCACAGATCTCCCAGCAATGGA
CATGTCAGGAACTTCTGATCCATATGTGAAAGTTTTTCTATTACCGGATA
AAAAGAAAAAATTCGAAACCAAAGTTCATCGAAAAATATTAAATCCAGTC
TTTAATGAGACATTTGTATTCAAGATTCCTTATTCTGAGGTCGGGTCTAA
AACTTTGGTATTTAATGTTTTCGATTTCGACAGATTTTCAAAGCATGATC
AAATTGGGCAAATCCAAATTCCACTGGGTTCAGTAGATTTATGCAAAGTT
ATTGAGGAATGGAAGGAACTCGGCCCACCTGACAGTGATAATGAAAAGGA
AAATCGATTAGGAGACATTTGTTTTTCTTTGAGATATGTTCCAACGTCTG
GAAAGTTGAATATCGTCATTCTGGAAGCTAAAAACCTCAAGAAAATGGAT
GTTGGAGGATTGTCGGATCCTTACGTGAAACTATCGTTGATGCTTAACGG
CAAACGAGTGAAAAAGAAGAAAACCACAATAAAAAAATACACATTAAATC
CTTATTATAATGAGTCATTTTCATTCGAAGTTCCATTCGAGCAAATACAA
AAAGTTAATTTAATAGTGACAGTAGTTGATTATGATAGAATTGGAACAAG
TGAACCTATTGGAAGAGTAGTTCTTGGATGCAATGCTACAGGAGCAGAAC
TTCGGCACTGGTCCGATATGCTTGCTAATCCTAGGAGACCAATTGCCCAG
TGGCATACCCTTCAAGATATGCCGGAGAAGAGCTGATTTCATTGATTTTA
ATTTTAAAATCTGTCATATTTTGTGATAAATTTTGCGTATTTATACAATC
ATTCGATTCGATCTTTCCATCAAGTTTCGTAAAATCTGCAGACATTCACG
AGGATGCAGAAGAAATAGAAACTTTGTAATAAATTAGCATTAGCTGTGAT
CTCCTATTGACCAAAAAACATAAACTTAATTTTTATAAAGAATTGTGGTG
AAATGTTGTTAGGTTTCAGTCATAGATAACTGTATTTGTGTAATAGTTTG
TGTATTTCTCGTCCTGGCCCGATTTTGTGCATTCCACTGGCAATACTATT
TCACTAATAAATTATGTCTGATAATGTATACCAGTATAGGATTTTGTTTG
AATTAATGAA
back to top

protein sequence of SMED30019471-orf-1

>SMED30019471-orf-1 ID=SMED30019471-orf-1|Name=SMED30019471-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=421bp
MSISNNISSASNMTIKMQQNVEKSVSQHVTAQTKESTSNKLHTTTAGISV
LEKTLKTFHMSTGTLIGIGVTVSIVVLLLLYCICKRCIKKRKKKKDGGKK
GGKGVDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQ
YSLDYDFTKGELTVGVIQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETK
VHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIP
LGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVIL
EAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFS
FEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDML
ANPRRPIAQWHTLQDMPEKS*
back to top
Aliases
The feature 'Synaptotagmin' has the following synonyms
Synonym
Dj-syt
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000463cholinergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR015428Synaptotagmin1
IPR001565Synaptotagmin
IPR000008C2_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0008021synaptic vesicle
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0030285integral component of synaptic vesicle membrane
GO:0030672synaptic vesicle membrane
GO:0031410cytoplasmic vesicle
GO:0045202synapse
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0000149SNARE binding
GO:0005509calcium ion binding
GO:0005544calcium-dependent phospholipid binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0007269neurotransmitter secretion
GO:0016079synaptic vesicle exocytosis
GO:0045955negative regulation of calcium ion-dependent exocytosis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000008C2 domainPRINTSPR00360C2DOMAINcoord: 177..189
score: 59.3
coord: 204..217
score: 57.48
coord: 228..236
score: 47.93
IPR000008C2 domainSMARTSM00239C2_3ccoord: 161..263
e-value: 8.4E-22
score: 88.4
coord: 294..408
e-value: 6.5E-24
score: 95.4
IPR000008C2 domainPFAMPF00168C2coord: 160..266
e-value: 2.0E-28
score: 98.7
coord: 293..397
e-value: 3.5E-23
score: 81.8
IPR000008C2 domainPROSITEPS50004C2coord: 161..248
score: 20.18
IPR000008C2 domainPROSITEPS50004C2coord: 292..383
score: 20.713
IPR001565SynaptotagminPRINTSPR00399SYNAPTOTAGMNcoord: 219..234
score: 36.76
coord: 239..249
score: 43.05
coord: 164..177
score: 47.69
coord: 149..164
score: 46.69
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 132..272
e-value: 1.3E-46
score: 160.0
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 273..419
e-value: 9.4E-55
score: 186.6
NoneNo IPR availablePANTHERPTHR10024SYNAPTOTAGMINcoord: 18..415
NoneNo IPR availableCDDcd08385C2A_Synaptotagmin-1-5-6-9-10coord: 145..268
e-value: 1.96402E-85
score: 254.497
NoneNo IPR availableCDDcd08402C2B_Synaptotagmin-1coord: 279..414
e-value: 3.73947E-91
score: 269.656
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 279..414
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 141..270
NoneNo IPR availableTMHMMTMhelixcoord: 62..84
IPR015428Synaptotagmin 1PANTHERPTHR10024:SF239SYNAPTOTAGMIN-1coord: 18..415