protein arginine methyltransferase 1-like protein

Overview
Nameprotein arginine methyltransferase 1-like protein (AEX33824.1)
Smed IDSMED30019468
Length (bp)1155
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of protein arginine methyltransferase 1-like protein (SMED30019468) t-SNE clustered cells

Violin plots show distribution of expression levels for protein arginine methyltransferase 1-like protein (SMED30019468) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of protein arginine methyltransferase 1-like protein (SMED30019468) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for protein arginine methyltransferase 1-like protein (SMED30019468) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019468

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30019468SMESG000038790.1 SmedASXL_008670SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30019468SMESG000038790.1 dd_Smed_v4_1302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30019468SMESG000038790.1 dd_Smed_v4_1302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019468SMESG000038790.1 dd_Smed_v4_1302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019468SMESG000038790.1 dd_Smed_v4_1302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019468SMESG000038790.1 dd_Smed_v4_1302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019468SMESG000038790.1 dd_Smed_v4_1302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019468SMESG000038790.1 dd_Smed_v4_1302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019468SMESG000038790.1 Contig41176uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019468SMESG000038790.1 Contig41176newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynx musculatureSMED30019468SMESG000038790.1 dd_Smed_v4_1302_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30019468SMESG000038790.1 dd_Smed_v4_1302_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Human
Match: PRMT1 (protein arginine methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:5187])

HSP 1 Score: 458.373 bits (1178), Expect = 2.113e-161
Identity = 217/341 (63.64%), Postives = 274/341 (80.35%), Query Frame = 1
Query:   94 NSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            +S   +  DMT+KDYYFDSYAHFGIHEEMLKDE+RT++YRN+++HN HL KDKVVLDVG GTGILCMFA +AGA++VIGI+CS+I DYA +IVKANK+D  +T+IKGKVEEVELP +  KVD+IISEWMGYCL YESMLNTVL+ARDKWLAP G+I PD+ATL++ AIEDR+YKD KI+WW+NVYGFDMSCI+  A  EPLVDVV+P Q+V++ CL+KE+++Y + V+DLTF++PF L + RNDYVHA+V YFNIEFT   K   FST+P +   THWKQ+VFY+    +D + VK GEEI G   ++PNA   R +D +IDL FKG+L  +    +Y M+
Sbjct:   20 SSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVE--KVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYM----EDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR 353          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Human
Match: PRMT1 (protein arginine methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:5187])

HSP 1 Score: 458.759 bits (1179), Expect = 2.576e-161
Identity = 217/341 (63.64%), Postives = 274/341 (80.35%), Query Frame = 1
Query:   94 NSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            +S   +  DMT+KDYYFDSYAHFGIHEEMLKDE+RT++YRN+++HN HL KDKVVLDVG GTGILCMFA +AGA++VIGI+CS+I DYA +IVKANK+D  +T+IKGKVEEVELP +  KVD+IISEWMGYCL YESMLNTVL+ARDKWLAP G+I PD+ATL++ AIEDR+YKD KI+WW+NVYGFDMSCI+  A  EPLVDVV+P Q+V++ CL+KE+++Y + V+DLTF++PF L + RNDYVHA+V YFNIEFT   K   FST+P +   THWKQ+VFY+    +D + VK GEEI G   ++PNA   R +D +IDL FKG+L  +    +Y M+
Sbjct:   38 SSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVE--KVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYM----EDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR 371          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Human
Match: PRMT1 (protein arginine methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:5187])

HSP 1 Score: 454.907 bits (1169), Expect = 1.902e-160
Identity = 215/332 (64.76%), Postives = 270/332 (81.33%), Query Frame = 1
Query:  121 MTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            MT+KDYYFDSYAHFGIHEEMLKDE+RT++YRN+++HN HL KDKVVLDVG GTGILCMFA +AGA++VIGI+CS+I DYA +IVKANK+D  +T+IKGKVEEVELP +  KVD+IISEWMGYCL YESMLNTVL+ARDKWLAP G+I PD+ATL++ AIEDR+YKD KI+WW+NVYGFDMSCI+  A  EPLVDVV+P Q+V++ CL+KE+++Y + V+DLTF++PF L + RNDYVHA+V YFNIEFT   K   FST+P +   THWKQ+VFY+    +D + VK GEEI G   ++PNA   R +D +IDL FKG+L  +    +Y M+
Sbjct:    1 MTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVE--KVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYM----EDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR 325          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Human
Match: PRMT8 (protein arginine methyltransferase 8 [Source:HGNC Symbol;Acc:HGNC:5188])

HSP 1 Score: 450.669 bits (1158), Expect = 7.467e-158
Identity = 209/340 (61.47%), Postives = 272/340 (80.00%), Query Frame = 1
Query:   97 SNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            S  ++  +MT++DYYFDSYAHFGIHEEMLKDE+RT++YRN++YHN+H+ KDKVVLDVG GTGIL MFA +AGAK+V GI+CS+I DY+++I+KAN +D  IT+ KGKVEEVELP +  KVD+IISEWMGYCL YESMLNTV+FARDKWL PGG++ PD+A L++VAIEDR+YKD KI+WW+NVYGFDM+CIR  A  EPLVD+V+P Q+V++ CL+KE+++Y +  ++L+F++ F L + RNDYVHA+VTYFNIEFT   K + FSTAP     THWKQ+VFYL    +D + V+RGEEI G  S+KPNA   R +D ++DL FKG+L       +Y M+
Sbjct:   62 SKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVE--KVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDA-PYTHWKQTVFYL----EDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR 394          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Human
Match: PRMT8 (protein arginine methyltransferase 8 [Source:HGNC Symbol;Acc:HGNC:5188])

HSP 1 Score: 450.284 bits (1157), Expect = 8.826e-158
Identity = 209/340 (61.47%), Postives = 272/340 (80.00%), Query Frame = 1
Query:   97 SNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            S  ++  +MT++DYYFDSYAHFGIHEEMLKDE+RT++YRN++YHN+H+ KDKVVLDVG GTGIL MFA +AGAK+V GI+CS+I DY+++I+KAN +D  IT+ KGKVEEVELP +  KVD+IISEWMGYCL YESMLNTV+FARDKWL PGG++ PD+A L++VAIEDR+YKD KI+WW+NVYGFDM+CIR  A  EPLVD+V+P Q+V++ CL+KE+++Y +  ++L+F++ F L + RNDYVHA+VTYFNIEFT   K + FSTAP     THWKQ+VFYL    +D + V+RGEEI G  S+KPNA   R +D ++DL FKG+L       +Y M+
Sbjct:   53 SKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVE--KVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPY-THWKQTVFYL----EDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR 385          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Celegans
Match: prmt-1 (Protein arginine N-methyltransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2X0])

HSP 1 Score: 385.571 bits (989), Expect = 3.114e-133
Identity = 180/333 (54.05%), Postives = 248/333 (74.47%), Query Frame = 1
Query:  118 DMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEV-ELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSM 1104
            ++T+KDYYFDSYAHFGIHEEMLKDE+RT +YRN++YHN HL KDKVV+DVG GTGIL MFA +AGAK+V  ++ SN+   +++I+  N +D  + +I+ KVE+V ELP  + KVD+IISEWMGYCL YESMLNTVL ARD+WLAP G++ PDKA L++ AIEDR+YK++KI+WW +VYGF+MS I+  A  EPLVD+V+  Q+ ++ CL+K++++Y + ++DLTF + F L   R+DY+ A VT+F +EF+   K   FST P   + THWKQ+VFYL D     + VK+GEEI G F + PN    R +D++I   FKGE+  +++   Y+M
Sbjct:   20 ELTSKDYYFDSYAHFGIHEEMLKDEVRTTTYRNSIYHNSHLFKDKVVMDVGSGTGILSMFAAKAGAKKVFAMEFSNMALTSRKIIADNNLDHIVEVIQAKVEDVHELPGGIEKVDIIISEWMGYCLFYESMLNTVLVARDRWLAPNGMLFPDKARLYVCAIEDRQYKEDKIHWWDSVYGFNMSAIKNVAIKEPLVDIVDNAQVNTNNCLLKDVDLYTVKIEDLTFKSDFKLRCTRSDYIQAFVTFFTVEFSKCHKKTGFSTGP-DVQYTHWKQTVFYLKDA----LTVKKGEEITGSFEMAPNKNNERDLDINISFDFKGEVCDLNEQNTYTM 347          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Celegans
Match: prmt-1 (Protein arginine N-methyltransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2X0])

HSP 1 Score: 385.571 bits (989), Expect = 3.114e-133
Identity = 180/333 (54.05%), Postives = 248/333 (74.47%), Query Frame = 1
Query:  118 DMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEV-ELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSM 1104
            ++T+KDYYFDSYAHFGIHEEMLKDE+RT +YRN++YHN HL KDKVV+DVG GTGIL MFA +AGAK+V  ++ SN+   +++I+  N +D  + +I+ KVE+V ELP  + KVD+IISEWMGYCL YESMLNTVL ARD+WLAP G++ PDKA L++ AIEDR+YK++KI+WW +VYGF+MS I+  A  EPLVD+V+  Q+ ++ CL+K++++Y + ++DLTF + F L   R+DY+ A VT+F +EF+   K   FST P   + THWKQ+VFYL D     + VK+GEEI G F + PN    R +D++I   FKGE+  +++   Y+M
Sbjct:   20 ELTSKDYYFDSYAHFGIHEEMLKDEVRTTTYRNSIYHNSHLFKDKVVMDVGSGTGILSMFAAKAGAKKVFAMEFSNMALTSRKIIADNNLDHIVEVIQAKVEDVHELPGGIEKVDIIISEWMGYCLFYESMLNTVLVARDRWLAPNGMLFPDKARLYVCAIEDRQYKEDKIHWWDSVYGFNMSAIKNVAIKEPLVDIVDNAQVNTNNCLLKDVDLYTVKIEDLTFKSDFKLRCTRSDYIQAFVTFFTVEFSKCHKKTGFSTGP-DVQYTHWKQTVFYLKDA----LTVKKGEEITGSFEMAPNKNNERDLDINISFDFKGEVCDLNEQNTYTM 347          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Celegans
Match: prmt-7 (Protein arginine N-methyltransferase 7 [Source:UniProtKB/Swiss-Prot;Acc:Q9XW42])

HSP 1 Score: 54.6842 bits (130), Expect = 6.955e-8
Identity = 34/116 (29.31%), Postives = 59/116 (50.86%), Query Frame = 1
Query:  256 VLDVGCGTGILCMFAVRAGAKRVIGIDC-SNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIE 600
            VLD+G GTG+L + A R GA +V  ++    + D A+ I   +    KIT+I  +  +V       + D+I++E     L+ E  L T   A ++   PG  ++P    +++V +E
Sbjct:   68 VLDIGTGTGLLSLMAAREGADKVTALEVFKPMGDCARHITSNSPWSDKITVISERSTDVSQIGGS-RADIIVAEVFDTELIGEGALRTFKEALERLAKPGCRVVPSTGNVYIVPVE 182          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Celegans
Match: prmt-9 (PRotein arginine MethylTransferase [Source:UniProtKB/TrEMBL;Acc:O02325])

HSP 1 Score: 48.1358 bits (113), Expect = 7.836e-6
Identity = 42/155 (27.10%), Postives = 74/155 (47.74%), Query Frame = 1
Query:  169 HEEMLKDEIRTISYRNALYHNEHLVKDK--VVLDVGCGTGILCMFAVRAGAKRVIGID---CSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKD 618
            H  M+ D  R  ++  AL      +K +  VV D+G GTGIL   A R     V  ++   C  +I  +KE++K N +++++ +        E      K D+++SE +  C+  E ++ T L A  ++     I +P +AT+++     RE  D
Sbjct:  142 HIRMINDVKRNEAFAKAL---NDTIKSRITVVFDIGSGTGILSAIAARK-TNLVTALEENMCLTMI--SKEVLKRNGVESRVNVHAKNSTYFET---CEKADIVVSETLDCCVFGEKIVETFLDAHVRFSHDRTIFIPHQATVYVRLFSCREIFD 287          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Fly
Match: Art1 (gene:FBgn0037834 transcript:FBtr0082304)

HSP 1 Score: 439.884 bits (1130), Expect = 3.796e-154
Identity = 204/341 (59.82%), Postives = 263/341 (77.13%), Query Frame = 1
Query:   94 NSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNARA---IDVSIDLKFKGELKTVDKVYNYSMK 1107
            N NA + ++MT++DYYFDSYAHFGIHEEMLKDE+RT++YRNA+YHN+HL + K VLDVGCGTGIL MFA +AGA +VI +DCSNII++A+++V  N +   IT++KGK+EE+ELP  +  VD+IISEWMGYCL YESML+TVL+ARDKWL   G++ PD+ TL++ AIEDR+YKDEKINWW +VYGFDMSCIRK A +EPLVDVV+P Q+VS  C+VKE+++Y +   DL FS+ F+L + RND+V A+VTYFNIEFT   K + FST+P     THWKQ+VFYLDD     +  K+ EEI G F +KPN R    +D  ID+ FKGEL  + +   Y M+
Sbjct:   42 NPNA-NADEMTSRDYYFDSYAHFGIHEEMLKDEVRTVTYRNAMYHNKHLFQGKTVLDVGCGTGILSMFAAKAGAAQVIAVDCSNIIEFARQVVIDNNLQDVITVVKGKIEEIELPNGIEGVDIIISEWMGYCLFYESMLDTVLYARDKWLKKDGMMFPDRGTLYITAIEDRQYKDEKINWWDDVYGFDMSCIRKVAVTEPLVDVVDPKQVVSTSCMVKEVDLYTVQKADLNFSSKFSLCIKRNDFVQALVTYFNIEFTKCHKRLGFSTSP-DSTYTHWKQTVFYLDDH----MTAKKNEEITGTFQMKPNERNNRDLDFVIDINFKGELSQIQESNTYRMR 376          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Fly
Match: Art2 (gene:FBgn0031592 transcript:FBtr0077476)

HSP 1 Score: 274.633 bits (701), Expect = 1.710e-89
Identity = 139/338 (41.12%), Postives = 216/338 (63.91%), Query Frame = 1
Query:   85 MDHN---SNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNARAI-DVSIDL--KFKGELKTV 1080
            MD N   +N +  +    +++YF  Y    IHE +LKD +R  +YR A+ HNE   + K VLDVGCG G+L MFA +AG+KRV+ ++ + I ++A+++V+ N+    I +I+GKVE++ELP  + KVD+I+ +WMG CL   +ML ++LFARDKWL+  G I PD A L++ AI+ R   D+ + +W +V+GFD+S IR+   S+ +V+ V  DQ++S +CLVK +++Y          + F L + RN +VH +V YF++ F+ S + I+FST+P+    THW Q+VFYL    +  +PV+ GE I GV ++KP+  +I D   D+   F G  K+V
Sbjct:   12 MDGNHTDANQIIKDRRRQEEHYFKLYGRIEIHEWLLKDSVRIKAYREAIQHNE-FFRHKTVLDVGCGMGVLSMFAAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIKKVDIIVCDWMGSCLFSGNMLESLLFARDKWLSATGHIYPDTAQLYLAAIKGR---DQDLGFWHDVHGFDLSAIRRRCESKAVVEHVTGDQMMSRVCLVKSLDLYTEPRQSAKSRSLFELKVSRNGWVHGLVAYFDVGFSKSTQRISFSTSPSA-PWTHWNQTVFYL----ETPLPVRAGECIKGVLTMKPSEDSIFDTEFDIFVNFDGREKSV 340          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Fly
Match: Art2 (gene:FBgn0031592 transcript:FBtr0345748)

HSP 1 Score: 274.633 bits (701), Expect = 1.710e-89
Identity = 139/338 (41.12%), Postives = 216/338 (63.91%), Query Frame = 1
Query:   85 MDHN---SNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNARAI-DVSIDL--KFKGELKTV 1080
            MD N   +N +  +    +++YF  Y    IHE +LKD +R  +YR A+ HNE   + K VLDVGCG G+L MFA +AG+KRV+ ++ + I ++A+++V+ N+    I +I+GKVE++ELP  + KVD+I+ +WMG CL   +ML ++LFARDKWL+  G I PD A L++ AI+ R   D+ + +W +V+GFD+S IR+   S+ +V+ V  DQ++S +CLVK +++Y          + F L + RN +VH +V YF++ F+ S + I+FST+P+    THW Q+VFYL    +  +PV+ GE I GV ++KP+  +I D   D+   F G  K+V
Sbjct:   12 MDGNHTDANQIIKDRRRQEEHYFKLYGRIEIHEWLLKDSVRIKAYREAIQHNE-FFRHKTVLDVGCGMGVLSMFAAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIKKVDIIVCDWMGSCLFSGNMLESLLFARDKWLSATGHIYPDTAQLYLAAIKGR---DQDLGFWHDVHGFDLSAIRRRCESKAVVEHVTGDQMMSRVCLVKSLDLYTEPRQSAKSRSLFELKVSRNGWVHGLVAYFDVGFSKSTQRISFSTSPSA-PWTHWNQTVFYL----ETPLPVRAGECIKGVLTMKPSEDSIFDTEFDIFVNFDGREKSV 340          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Fly
Match: Art6 (gene:FBgn0038189 transcript:FBtr0082878)

HSP 1 Score: 253.832 bits (647), Expect = 1.429e-81
Identity = 124/326 (38.04%), Postives = 202/326 (61.96%), Query Frame = 1
Query:  139 YFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTS--SLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKP---NARAIDVSIDLKFKGELKTVDKVYNYS 1101
            YF SY+    H  ML+D +R  ++R+A+  +  L +DK+VLDVGCGTGIL +FA  AGA +VI ++C++I D A+EI++ N+ +  + ++KG VE+VELP  + KVD+I+SEWMG  L  E+M+N+VLFARDKWL  GG I+P    L ++   D  ++   +N+W NV G DM C+RK  + EPLV+ V   Q+++D C +   N+       + F + F L ++R   ++ +V YF++ F S  S K ++ +T+P     THW+Q+V +L    D+ + V+  + + GV ++ P   + R ++  + + F+GE   V+   ++S
Sbjct:   19 YFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASKVIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINSVLFARDKWLTRGGRILPSTGNLWLMGAYD-PHRRTNLNFWCNVEGIDMGCVRKPFSQEPLVEFVPIQQLLTDECFIHSTNLAVARNQPVEFQSNFQLKVMRTGIINMLVLYFDVLFPSGKSNKSVSLTTSP-HSPWTHWEQTVLHL----DEPLYVRIRDRVRGVLAMTPTGQDGRGMNFDLHISFRGERTRVESFKSFS 338          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Fly
Match: Art3 (gene:FBgn0038306 transcript:FBtr0083135)

HSP 1 Score: 244.202 bits (622), Expect = 2.690e-76
Identity = 129/321 (40.19%), Postives = 205/321 (63.86%), Query Frame = 1
Query:  100 NAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSL---KPNARAIDVSIDL 1053
             ++  N++   + YF SYAHFGIH EML D++RT +YR +L  NE +V+ K VLDVGCGTGIL +FA +AGA RV+GID S+I+  A +I++ NK++  + LIKG++E+ +LP    K D+IISEWMGY LLYESML+++++AR+  L P GII+P + TL ++   D     +++ +W NVY  DMS +RK +  EPL+ VV+ + ++++   +   ++  + ++   F+  F+L + +   + A V YF   F     P+ FST+P+    THWKQ+VF++++ +     VK G+ I G  +    K + R + V I++
Sbjct:  153 QSVPRNNVCLDNEYFKSYAHFGIHHEMLSDKVRTSTYRASLLQNEAVVRGKTVLDVGCGTGILSIFASKAGAARVVGIDNSDIVYTAMDIIRKNKVEN-VELIKGRLEDTDLPE--TKYDIIISEWMGYFLLYESMLDSIIYARENHLNPNGIILPSRCTLSLLGYGDDTLYADEVEFWSNVYEVDMSDLRKQSIEEPLMQVVDAEFMLTEPEQIANFDIMTVDMNYPNFTHQFSLKVTKPGRLSAFVGYFETLFELP-SPVMFSTSPSA-TPTHWKQTVFFIENPQ----VVKEGDVICGKITSRRHKEDVRGLSVDIEV 464          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Zebrafish
Match: prmt1 (protein arginine methyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-693])

HSP 1 Score: 460.685 bits (1184), Expect = 1.073e-162
Identity = 216/333 (64.86%), Postives = 272/333 (81.68%), Query Frame = 1
Query:  118 DMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            DMT+KDYYFDSYAHFGIHEEMLKDE+RT++YRN+++HN+HL KDKVVLDVG GTGILCMFA +AGAK+VIGI+CS+I DYA +IVKANK+D  +T+IKGKVEEVELP +   VD+IISEWMGYCL YESMLNTV++ARDKWL P G+I PD+ATL++ AIEDR+YKD KI+WW+NVYGFDMSCI++ A +EPLVDVV+P Q+VS  CL+KE+++Y + ++DL+F++PF L + RNDY+HA+VTYFNIEFT   K   FST+P +   THWKQ+VFYL    DD + VK GEEI G  S+KPN    R +D ++D+ FKG+L  V K   Y M+
Sbjct:   23 DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNKHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAVKIVKANKLDHIVTIIKGKVEEVELPVE--NVDIIISEWMGYCLFYESMLNTVIYARDKWLKPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKEVAITEPLVDVVDPKQLVSTACLIKEVDIYTVKIEDLSFTSPFCLQVKRNDYIHALVTYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYL----DDYLTVKTGEEIFGTISMKPNVKNNRDLDFTVDIDFKGQLCEVSKTSEYRMR 348          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Zebrafish
Match: prmt8b (protein arginine methyltransferase 8b [Source:NCBI gene;Acc:564110])

HSP 1 Score: 439.499 bits (1129), Expect = 1.654e-154
Identity = 202/337 (59.94%), Postives = 270/337 (80.12%), Query Frame = 1
Query:  106 MDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKP---NARAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            ++  +MT++DYYFDSYAHFGIHEEMLKDE+RT++YRN++YHN+H+ KDK+VLDVG GTGIL MFA +AGAK V GI+CS+I +Y+++I+K+N +D+ IT++KGKVEE ELP D  +VD+IISEWMGYCL YESMLNTV++ARDKWL PGG + PD+ATL++VAIEDR+YKD KI+WW+NVYGFDM+CIR  A  EPLVD+V+P Q+V++ CLVKE+++Y +  +DL+F++ F L + RNDYVHA+VTYFNIEFT   K   FSTAP    +THWKQ+VFYL    +D + V+RGEEI G  +++P   N R +D + +L FKG+L      ++Y M+
Sbjct:    5 LNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKIVLDVGSGTGILSMFAAKAGAKHVYGIECSSISEYSEKIIKSNHLDSVITILKGKVEETELPVD--QVDIIISEWMGYCLFYESMLNTVIYARDKWLKPGGFMFPDRATLYVVAIEDRQYKDFKIHWWENVYGFDMTCIRNVAMMEPLVDIVDPKQVVTNSCLVKEVDIYTVKTEDLSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKTGFSTAPDA-PSTHWKQTVFYL----EDYLTVRRGEEILGSITVRPNENNERDLDFTFELDFKGQLCDAAISHDYKMR 334          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Zebrafish
Match: prmt8b (protein arginine methyltransferase 8b [Source:NCBI gene;Acc:564110])

HSP 1 Score: 439.884 bits (1130), Expect = 2.038e-153
Identity = 202/337 (59.94%), Postives = 270/337 (80.12%), Query Frame = 1
Query:  106 MDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKP---NARAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            ++  +MT++DYYFDSYAHFGIHEEMLKDE+RT++YRN++YHN+H+ KDK+VLDVG GTGIL MFA +AGAK V GI+CS+I +Y+++I+K+N +D+ IT++KGKVEE ELP D  +VD+IISEWMGYCL YESMLNTV++ARDKWL PGG + PD+ATL++VAIEDR+YKD KI+WW+NVYGFDM+CIR  A  EPLVD+V+P Q+V++ CLVKE+++Y +  +DL+F++ F L + RNDYVHA+VTYFNIEFT   K   FSTAP    +THWKQ+VFYL    +D + V+RGEEI G  +++P   N R +D + +L FKG+L      ++Y M+
Sbjct:   90 LNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKIVLDVGSGTGILSMFAAKAGAKHVYGIECSSISEYSEKIIKSNHLDSVITILKGKVEETELPVD--QVDIIISEWMGYCLFYESMLNTVIYARDKWLKPGGFMFPDRATLYVVAIEDRQYKDFKIHWWENVYGFDMTCIRNVAMMEPLVDIVDPKQVVTNSCLVKEVDIYTVKTEDLSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKTGFSTAPDA-PSTHWKQTVFYL----EDYLTVRRGEEILGSITVRPNENNERDLDFTFELDFKGQLCDAAISHDYKMR 419          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Zebrafish
Match: prmt8b (protein arginine methyltransferase 8b [Source:NCBI gene;Acc:564110])

HSP 1 Score: 439.884 bits (1130), Expect = 2.109e-153
Identity = 202/337 (59.94%), Postives = 270/337 (80.12%), Query Frame = 1
Query:  106 MDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKP---NARAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            ++  +MT++DYYFDSYAHFGIHEEMLKDE+RT++YRN++YHN+H+ KDK+VLDVG GTGIL MFA +AGAK V GI+CS+I +Y+++I+K+N +D+ IT++KGKVEE ELP D  +VD+IISEWMGYCL YESMLNTV++ARDKWL PGG + PD+ATL++VAIEDR+YKD KI+WW+NVYGFDM+CIR  A  EPLVD+V+P Q+V++ CLVKE+++Y +  +DL+F++ F L + RNDYVHA+VTYFNIEFT   K   FSTAP    +THWKQ+VFYL    +D + V+RGEEI G  +++P   N R +D + +L FKG+L      ++Y M+
Sbjct:   91 LNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKIVLDVGSGTGILSMFAAKAGAKHVYGIECSSISEYSEKIIKSNHLDSVITILKGKVEETELPVD--QVDIIISEWMGYCLFYESMLNTVIYARDKWLKPGGFMFPDRATLYVVAIEDRQYKDFKIHWWENVYGFDMTCIRNVAMMEPLVDIVDPKQVVTNSCLVKEVDIYTVKTEDLSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKTGFSTAPDA-PSTHWKQTVFYL----EDYLTVRRGEEILGSITVRPNENNERDLDFTFELDFKGQLCDAAISHDYKMR 420          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Zebrafish
Match: PRMT8 (protein arginine N-methyltransferase 8-B-like [Source:NCBI gene;Acc:556054])

HSP 1 Score: 437.573 bits (1124), Expect = 1.450e-152
Identity = 201/337 (59.64%), Postives = 267/337 (79.23%), Query Frame = 1
Query:  106 MDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKP---NARAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            ++  +MT++DYYFDSYAHFGIHEEMLKDE+RT++YRN++YHN+H+ KDK+VLDVG GTGIL MFA +AGAK V GI+CS+I +Y+++I+KAN +D+ IT+ KGKVEE ELP D  +VD+IISEWMGYCL YESMLNTV++ARDKWL PGG++ PD+A L++VAIEDR+YKD KI+WW+NVYGFDM+CIR  A  EPLVD+V+  Q+VS+ CL+KE+++Y +  ++L+F++ F L + RNDY+HA+VTYFNIEFT   K   FSTAP     THWKQ+VFYL    ++ + VKRGEEI G  S+KP   N R +D + +L FKG+L      ++Y M+
Sbjct:   81 LNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKIVLDVGSGTGILSMFAAKAGAKHVYGIECSSISEYSEKIIKANHLDSVITIFKGKVEETELPVD--QVDIIISEWMGYCLFYESMLNTVIYARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRNVAMKEPLVDIVDSKQVVSNSCLIKEVDIYTVKPEELSFTSSFCLQIQRNDYIHALVTYFNIEFTKCHKKTGFSTAPDA-PFTHWKQTVFYL----EEYLTVKRGEEIVGTVSMKPNEKNVRDLDFTFELDFKGQLCEAAIAHDYKMR 410          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Xenopus
Match: il1rap (interleukin 1 receptor accessory protein [Source:Xenbase;Acc:XB-GENE-492428])

HSP 1 Score: 457.988 bits (1177), Expect = 1.672e-161
Identity = 217/345 (62.90%), Postives = 275/345 (79.71%), Query Frame = 1
Query:   82 TMDHNSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            T   +S   +  DMT+KDYYFDSYAHFGIHEEMLKDE+RT++YRN+++HN HL KDKVVLDVG GTGILCMFA +AGAK+VIGI+CS+I DYA +IVKANK+D  +T+IKGKVEEVELP +  KVD+IISEWMGYCL YESMLNTV++ARDKWL P G+I PD+ATL++ AIEDR+YKD KI+WW+NVYGFDMSCI+  A  EPLVDVV+P Q+V++ CL+KE+++Y + VDDLTF++PF L + RNDY+HA+V YFNIEFT   K   FST+P +   THWKQ+VFY+    +D + VK GEEI G  S+KPNA   R +D ++D+ FKG+L  +    +Y M+
Sbjct:   10 TQPESSVKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAIKIVKANKLDHVVTIIKGKVEEVELPVE--KVDIIISEWMGYCLFYESMLNTVIYARDKWLTPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVDDLTFTSPFCLQVKRNDYIHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYM----EDYLTVKTGEEIFGTISMKPNAKNNRDLDFTVDIDFKGQLCELSCSTDYRMR 347          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Xenopus
Match: il1rap (interleukin 1 receptor accessory protein [Source:Xenbase;Acc:XB-GENE-492428])

HSP 1 Score: 458.373 bits (1178), Expect = 1.894e-161
Identity = 217/345 (62.90%), Postives = 275/345 (79.71%), Query Frame = 1
Query:   82 TMDHNSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            T   +S   +  DMT+KDYYFDSYAHFGIHEEMLKDE+RT++YRN+++HN HL KDKVVLDVG GTGILCMFA +AGAK+VIGI+CS+I DYA +IVKANK+D  +T+IKGKVEEVELP +  KVD+IISEWMGYCL YESMLNTV++ARDKWL P G+I PD+ATL++ AIEDR+YKD KI+WW+NVYGFDMSCI+  A  EPLVDVV+P Q+V++ CL+KE+++Y + VDDLTF++PF L + RNDY+HA+V YFNIEFT   K   FST+P +   THWKQ+VFY+    +D + VK GEEI G  S+KPNA   R +D ++D+ FKG+L  +    +Y M+
Sbjct:   16 TQPESSVKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAIKIVKANKLDHVVTIIKGKVEEVELPVE--KVDIIISEWMGYCLFYESMLNTVIYARDKWLTPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVDDLTFTSPFCLQVKRNDYIHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYM----EDYLTVKTGEEIFGTISMKPNAKNNRDLDFTVDIDFKGQLCELSCSTDYRMR 353          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Xenopus
Match: il1rap (interleukin 1 receptor accessory protein [Source:Xenbase;Acc:XB-GENE-492428])

HSP 1 Score: 457.988 bits (1177), Expect = 2.002e-161
Identity = 217/345 (62.90%), Postives = 275/345 (79.71%), Query Frame = 1
Query:   82 TMDHNSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            T   +S   +  DMT+KDYYFDSYAHFGIHEEMLKDE+RT++YRN+++HN HL KDKVVLDVG GTGILCMFA +AGAK+VIGI+CS+I DYA +IVKANK+D  +T+IKGKVEEVELP +  KVD+IISEWMGYCL YESMLNTV++ARDKWL P G+I PD+ATL++ AIEDR+YKD KI+WW+NVYGFDMSCI+  A  EPLVDVV+P Q+V++ CL+KE+++Y + VDDLTF++PF L + RNDY+HA+V YFNIEFT   K   FST+P +   THWKQ+VFY+    +D + VK GEEI G  S+KPNA   R +D ++D+ FKG+L  +    +Y M+
Sbjct:   12 TQPESSVKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAIKIVKANKLDHVVTIIKGKVEEVELPVE--KVDIIISEWMGYCLFYESMLNTVIYARDKWLTPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVDDLTFTSPFCLQVKRNDYIHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYM----EDYLTVKTGEEIFGTISMKPNAKNNRDLDFTVDIDFKGQLCELSCSTDYRMR 349          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Xenopus
Match: il1rap (interleukin 1 receptor accessory protein [Source:Xenbase;Acc:XB-GENE-492428])

HSP 1 Score: 457.988 bits (1177), Expect = 2.079e-161
Identity = 217/345 (62.90%), Postives = 275/345 (79.71%), Query Frame = 1
Query:   82 TMDHNSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            T   +S   +  DMT+KDYYFDSYAHFGIHEEMLKDE+RT++YRN+++HN HL KDKVVLDVG GTGILCMFA +AGAK+VIGI+CS+I DYA +IVKANK+D  +T+IKGKVEEVELP +  KVD+IISEWMGYCL YESMLNTV++ARDKWL P G+I PD+ATL++ AIEDR+YKD KI+WW+NVYGFDMSCI+  A  EPLVDVV+P Q+V++ CL+KE+++Y + VDDLTF++PF L + RNDY+HA+V YFNIEFT   K   FST+P +   THWKQ+VFY+    +D + VK GEEI G  S+KPNA   R +D ++D+ FKG+L  +    +Y M+
Sbjct:   14 TQPESSVKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAIKIVKANKLDHVVTIIKGKVEEVELPVE--KVDIIISEWMGYCLFYESMLNTVIYARDKWLTPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVDDLTFTSPFCLQVKRNDYIHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYM----EDYLTVKTGEEIFGTISMKPNAKNNRDLDFTVDIDFKGQLCELSCSTDYRMR 351          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Xenopus
Match: il1rap (interleukin 1 receptor accessory protein [Source:Xenbase;Acc:XB-GENE-492428])

HSP 1 Score: 457.988 bits (1177), Expect = 2.762e-161
Identity = 217/345 (62.90%), Postives = 275/345 (79.71%), Query Frame = 1
Query:   82 TMDHNSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            T   +S   +  DMT+KDYYFDSYAHFGIHEEMLKDE+RT++YRN+++HN HL KDKVVLDVG GTGILCMFA +AGAK+VIGI+CS+I DYA +IVKANK+D  +T+IKGKVEEVELP +  KVD+IISEWMGYCL YESMLNTV++ARDKWL P G+I PD+ATL++ AIEDR+YKD KI+WW+NVYGFDMSCI+  A  EPLVDVV+P Q+V++ CL+KE+++Y + VDDLTF++PF L + RNDY+HA+V YFNIEFT   K   FST+P +   THWKQ+VFY+    +D + VK GEEI G  S+KPNA   R +D ++D+ FKG+L  +    +Y M+
Sbjct:   18 TQPESSVKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAIKIVKANKLDHVVTIIKGKVEEVELPVE--KVDIIISEWMGYCLFYESMLNTVIYARDKWLTPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVDDLTFTSPFCLQVKRNDYIHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYM----EDYLTVKTGEEIFGTISMKPNAKNNRDLDFTVDIDFKGQLCELSCSTDYRMR 355          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Mouse
Match: Prmt1 (protein arginine N-methyltransferase 1 [Source:MGI Symbol;Acc:MGI:107846])

HSP 1 Score: 456.833 bits (1174), Expect = 4.776e-161
Identity = 217/341 (63.64%), Postives = 273/341 (80.06%), Query Frame = 1
Query:   94 NSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            +S   +  DMT+KDYYFDSYAHFGIHEEMLKDE+RT++YRN+++HN HL KDKVVLDVG GTGILCMFA +AGA++VIGI+CS+I DYA +IVKANK+D  +T+IKGKVEEVELP +  KVD+IISEWMGYCL YESMLNTVL ARDKWLAP G+I PD+ATL++ AIEDR+YKD KI+WW+NVYGFDMSCI+  A  EPLVDVV+P Q+V++ CL+KE+++Y + V+DLTF++PF L + RNDYVHA+V YFNIEFT   K   FST+P +   THWKQ+VFY+    +D + VK GEEI G   ++PNA   R +D +IDL FKG+L  +    +Y M+
Sbjct:   20 SSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVE--KVDIIISEWMGYCLFYESMLNTVLHARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYM----EDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR 353          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Mouse
Match: Prmt1 (protein arginine N-methyltransferase 1 [Source:MGI Symbol;Acc:MGI:107846])

HSP 1 Score: 457.218 bits (1175), Expect = 7.164e-161
Identity = 217/341 (63.64%), Postives = 273/341 (80.06%), Query Frame = 1
Query:   94 NSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            +S   +  DMT+KDYYFDSYAHFGIHEEMLKDE+RT++YRN+++HN HL KDKVVLDVG GTGILCMFA +AGA++VIGI+CS+I DYA +IVKANK+D  +T+IKGKVEEVELP +  KVD+IISEWMGYCL YESMLNTVL ARDKWLAP G+I PD+ATL++ AIEDR+YKD KI+WW+NVYGFDMSCI+  A  EPLVDVV+P Q+V++ CL+KE+++Y + V+DLTF++PF L + RNDYVHA+V YFNIEFT   K   FST+P +   THWKQ+VFY+    +D + VK GEEI G   ++PNA   R +D +IDL FKG+L  +    +Y M+
Sbjct:   38 SSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVE--KVDIIISEWMGYCLFYESMLNTVLHARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYM----EDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR 371          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Mouse
Match: Prmt8 (protein arginine N-methyltransferase 8 [Source:MGI Symbol;Acc:MGI:3043083])

HSP 1 Score: 451.055 bits (1159), Expect = 4.801e-158
Identity = 209/340 (61.47%), Postives = 272/340 (80.00%), Query Frame = 1
Query:   97 SNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            S  ++  +MT++DYYFDSYAHFGIHEEMLKDE+RT++YRN++YHN+H+ KDKVVLDVG GTGIL MFA +AGAK+V GI+CS+I DY+++I+KAN +D  IT+ KGKVEEVELP +  KVD+IISEWMGYCL YESMLNTV+FARDKWL PGG++ PD+A L++VAIEDR+YKD KI+WW+NVYGFDM+CIR  A  EPLVD+V+P Q+V++ CL+KE+++Y +  ++L+F++ F L + RNDYVHA+VTYFNIEFT   K + FSTAP     THWKQ+VFYL    +D + V+RGEEI G  S+KPNA   R +D ++DL FKG+L       +Y M+
Sbjct:   62 SKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNVITIFKGKVEEVELPVE--KVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDA-PYTHWKQTVFYL----EDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR 394          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Mouse
Match: Prmt1 (protein arginine N-methyltransferase 1 [Source:MGI Symbol;Acc:MGI:107846])

HSP 1 Score: 414.846 bits (1065), Expect = 4.672e-145
Identity = 198/314 (63.06%), Postives = 251/314 (79.94%), Query Frame = 1
Query:  175 EMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            EMLKDE+RT++YRN+++HN HL KDKVVLDVG GTGILCMFA +AGA++VIGI+CS+I DYA +IVKANK+D  +T+IKGKVEEVELP +  KVD+IISEWMGYCL YESMLNTVL ARDKWLAP G+I PD+ATL++ AIEDR+YKD KI+WW+NVYGFDMSCI+  A  EPLVDVV+P Q+V++ CL+KE+++Y + V+DLTF++PF L + RNDYVHA+V YFNIEFT   K   FST+P +   THWKQ+VFY+    +D + VK GEEI G   ++PNA   R +D +IDL FKG+L  +    +Y M+
Sbjct:   12 EMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVE--KVDIIISEWMGYCLFYESMLNTVLHARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYM----EDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR 318          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Mouse
Match: Prmt3 (protein arginine N-methyltransferase 3 [Source:MGI Symbol;Acc:MGI:1919224])

HSP 1 Score: 290.426 bits (742), Expect = 2.610e-93
Identity = 146/298 (48.99%), Postives = 202/298 (67.79%), Query Frame = 1
Query:  139 YFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSL-KPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNAR 1029
            YF SY H+GIHEEMLKD++RT SYR+ +Y N H+ KDKVVLDVGCGTGIL MFA + GAK+VI +D S I+  A +I++ NK++  I LIKGK+EEV LP  V KVDVIISEWMGY LL+ESML++VL+A+ K+LA GG + PD  T+ +VA+ D     ++I +W +VYGF+MSC++K    E +V+VV+   ++SD C +K I+ +  ++ DL FS+ FTL   +     A+  YF+I F  +    + FST P   + THWKQ+VF L    +   PVK GE + G  ++  N +
Sbjct:  217 YFSSYGHYGIHEEMLKDKVRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKVGAKKVIAVDQSEILYQAMDIIRLNKLEDTIVLIKGKIEEVSLP--VEKVDVIISEWMGYFLLFESMLDSVLYAKSKYLAKGGSVYPDICTISLVAVSDVSKHADRIAFWDDVYGFNMSCMKKAVIPEAVVEVVDHKTLISDPCDIKHIDCHTTSISDLEFSSDFTLRTTKTAMCTAVAGYFDIYFEKNCHNRVVFSTGPQSTK-THWKQTVFLL----EKPFPVKAGEALKGKITVHKNKK 507          
BLAST of protein arginine methyltransferase 1-like protein vs. UniProt/SwissProt
Match: sp|Q6VRB0|ANM1B_XENLA (Protein arginine N-methyltransferase 1-B OS=Xenopus laevis OX=8355 GN=prmt1-b PE=1 SV=1)

HSP 1 Score: 458.759 bits (1179), Expect = 6.447e-161
Identity = 217/336 (64.58%), Postives = 272/336 (80.95%), Query Frame = 1
Query:  109 DTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            +  DMT+KDYYFDSYAHFGIHEEMLKDE+RT++YRN+++HN HL KDKVVLDVG GTGILCMFA +AGAK+VIGI+CS+I DYA +IVKANK+D  +T+IKGKVEEVELP +  KVD+IISEWMGYCL YESMLNTV++ARDKWL P G+I PD+ATL++ AIEDR+YKD KI+WW+NVYGFDMSCI+  A  EPLVDVV+P Q+VS+ CL+KE+++Y + VDDLTF++PF L + RNDY+HAMV YFNIEFT   K   FST+P +   THWKQ+VFY+    +D + VK GEEI G  S+KPNA   R +D ++D+ FKG+L  +    +Y M+
Sbjct:   23 NAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAIKIVKANKLDHVVTIIKGKVEEVELPVE--KVDIIISEWMGYCLFYESMLNTVIYARDKWLNPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVSNACLIKEVDIYTVKVDDLTFTSPFCLQVKRNDYIHAMVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYM----EDYLTVKTGEEIFGTISMKPNAKNNRDLDFTVDIDFKGQLCELSCSTDYRMR 351          
BLAST of protein arginine methyltransferase 1-like protein vs. UniProt/SwissProt
Match: sp|Q28F07|ANM1_XENTR (Protein arginine N-methyltransferase 1 OS=Xenopus tropicalis OX=8364 GN=prmt1 PE=2 SV=1)

HSP 1 Score: 457.988 bits (1177), Expect = 1.102e-160
Identity = 217/345 (62.90%), Postives = 275/345 (79.71%), Query Frame = 1
Query:   82 TMDHNSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            T   +S   +  DMT+KDYYFDSYAHFGIHEEMLKDE+RT++YRN+++HN HL KDKVVLDVG GTGILCMFA +AGAK+VIGI+CS+I DYA +IVKANK+D  +T+IKGKVEEVELP +  KVD+IISEWMGYCL YESMLNTV++ARDKWL P G+I PD+ATL++ AIEDR+YKD KI+WW+NVYGFDMSCI+  A  EPLVDVV+P Q+V++ CL+KE+++Y + VDDLTF++PF L + RNDY+HA+V YFNIEFT   K   FST+P +   THWKQ+VFY+    +D + VK GEEI G  S+KPNA   R +D ++D+ FKG+L  +    +Y M+
Sbjct:   14 TQPESSVKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAIKIVKANKLDHVVTIIKGKVEEVELPVE--KVDIIISEWMGYCLFYESMLNTVIYARDKWLTPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVDDLTFTSPFCLQVKRNDYIHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYM----EDYLTVKTGEEIFGTISMKPNAKNNRDLDFTVDIDFKGQLCELSCSTDYRMR 351          
BLAST of protein arginine methyltransferase 1-like protein vs. UniProt/SwissProt
Match: sp|Q99873|ANM1_HUMAN (Protein arginine N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=PRMT1 PE=1 SV=3)

HSP 1 Score: 458.759 bits (1179), Expect = 1.237e-160
Identity = 217/341 (63.64%), Postives = 274/341 (80.35%), Query Frame = 1
Query:   94 NSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            +S   +  DMT+KDYYFDSYAHFGIHEEMLKDE+RT++YRN+++HN HL KDKVVLDVG GTGILCMFA +AGA++VIGI+CS+I DYA +IVKANK+D  +T+IKGKVEEVELP +  KVD+IISEWMGYCL YESMLNTVL+ARDKWLAP G+I PD+ATL++ AIEDR+YKD KI+WW+NVYGFDMSCI+  A  EPLVDVV+P Q+V++ CL+KE+++Y + V+DLTF++PF L + RNDYVHA+V YFNIEFT   K   FST+P +   THWKQ+VFY+    +D + VK GEEI G   ++PNA   R +D +IDL FKG+L  +    +Y M+
Sbjct:   38 SSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVE--KVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYM----EDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR 371          
BLAST of protein arginine methyltransferase 1-like protein vs. UniProt/SwissProt
Match: sp|Q63009|ANM1_RAT (Protein arginine N-methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Prmt1 PE=1 SV=1)

HSP 1 Score: 456.833 bits (1174), Expect = 3.341e-160
Identity = 217/341 (63.64%), Postives = 273/341 (80.06%), Query Frame = 1
Query:   94 NSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            +S   +  DMT+KDYYFDSYAHFGIHEEMLKDE+RT++YRN+++HN HL KDKVVLDVG GTGILCMFA +AGA++VIGI+CS+I DYA +IVKANK+D  +T+IKGKVEEVELP +  KVD+IISEWMGYCL YESMLNTVL ARDKWLAP G+I PD+ATL++ AIEDR+YKD KI+WW+NVYGFDMSCI+  A  EPLVDVV+P Q+V++ CL+KE+++Y + V+DLTF++PF L + RNDYVHA+V YFNIEFT   K   FST+P +   THWKQ+VFY+    +D + VK GEEI G   ++PNA   R +D +IDL FKG+L  +    +Y M+
Sbjct:   20 SSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVE--KVDIIISEWMGYCLFYESMLNTVLHARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYM----EDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR 353          
BLAST of protein arginine methyltransferase 1-like protein vs. UniProt/SwissProt
Match: sp|Q9JIF0|ANM1_MOUSE (Protein arginine N-methyltransferase 1 OS=Mus musculus OX=10090 GN=Prmt1 PE=1 SV=1)

HSP 1 Score: 457.218 bits (1175), Expect = 5.011e-160
Identity = 217/341 (63.64%), Postives = 273/341 (80.06%), Query Frame = 1
Query:   94 NSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            +S   +  DMT+KDYYFDSYAHFGIHEEMLKDE+RT++YRN+++HN HL KDKVVLDVG GTGILCMFA +AGA++VIGI+CS+I DYA +IVKANK+D  +T+IKGKVEEVELP +  KVD+IISEWMGYCL YESMLNTVL ARDKWLAP G+I PD+ATL++ AIEDR+YKD KI+WW+NVYGFDMSCI+  A  EPLVDVV+P Q+V++ CL+KE+++Y + V+DLTF++PF L + RNDYVHA+V YFNIEFT   K   FST+P +   THWKQ+VFY+    +D + VK GEEI G   ++PNA   R +D +IDL FKG+L  +    +Y M+
Sbjct:   38 SSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVE--KVDIIISEWMGYCLFYESMLNTVLHARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYM----EDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR 371          
BLAST of protein arginine methyltransferase 1-like protein vs. TrEMBL
Match: H2ESE0 (Protein arginine methyltransferase 1-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 340/342 (99.42%), Postives = 341/342 (99.71%), Query Frame = 1
Query:   85 MDHNSNAMD-TNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNARAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            MDHNSNAMD TNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNI+FTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNARAIDVSIDLKFKGELKTVDKVYNYSMK
Sbjct:    1 MDHNSNAMDDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIKFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNARAIDVSIDLKFKGELKTVDKVYNYSMK 342          
BLAST of protein arginine methyltransferase 1-like protein vs. TrEMBL
Match: A0A4Y5WRE5 (Protein arginine methyltransferase 1 OS=Dugesia japonica OX=6161 GN=Prmt1 PE=2 SV=1)

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 260/347 (74.93%), Postives = 311/347 (89.63%), Query Frame = 1
Query:   85 MDH---NSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNARA---IDVSIDLKFKGELKTVDKVYNYSMK 1107
            M+H   N +A++ +DMT+KDYYFDSYAHFGIHEEMLKDE+RT++YRNALYHN+HLVKDKVVLDVGCGTGILCMFAV+AGAK+VIGIDCSNIIDYAKEI+KANKM+ KITLIKGKVEEVELP DVLKVD+IISEWMGYCL YESMLNTVLFARDKWL  GGIIMPDKATLH+ AIEDR+YKDEKINWW+NVYGFDMSCIRK A SEPLVDVVNP+QIVS+ C+VKE+NMY+I V+DL+FS+PFTL++ +NDY+HA+V +FNI+FTSS K I FST P+ RR THWKQ+VFYLDDG +D++ V  GEEI G+FSLKPNAR    +D+SI++KF+G++  +++ +NY M+
Sbjct:    1 MEHASVNGDAIEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHLVKDKVVLDVGCGTGILCMFAVKAGAKKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPEDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFSSPFTLAVRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDISIEVKFRGKISQMEETFNYRMR 347          
BLAST of protein arginine methyltransferase 1-like protein vs. TrEMBL
Match: H2ESD9 (Protein arginine methyltransferase 1-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 254/345 (73.62%), Postives = 306/345 (88.70%), Query Frame = 1
Query:   85 MDH---NSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNARA---IDVSIDLKFKGELKTVDKVYNYS 1101
            M+H   N +A++ +DMT+KDYYFDSYAHFGI EEMLKDE+RT++YRNALYHN+HLVKDKVVLDVGCGTGILCMFAV+AGA++VIGIDCSNIIDYAKEI+KANKM+ KITLIKGKVEEVELP DVLKVD+IISEWMGYCL YESMLNTVLFARDKWL  GGIIMPDKATLH+ AIEDR+YKDEKINWW+NVYGFDMSCIRK A SEPLVDVVNP+QIVS+ C+VKE+NMY+I V+DL+F++PFTL++ +NDY+HA+V +FNI+FTSS K I FST P+ RR THWKQ+VFYLDDG +D + V  GEEI G+FSLKPNAR    +D++I++KF+G++  +++ +  S
Sbjct:    1 MEHASINGDAIEASDMTSKDYYFDSYAHFGIPEEMLKDEVRTLTYRNALYHNKHLVKDKVVLDVGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDALTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFQLS 345          
BLAST of protein arginine methyltransferase 1-like protein vs. TrEMBL
Match: C7TY98 (Arginine methyltransferase 1 OS=Schistosoma japonicum OX=6182 GN=Art1 PE=2 SV=1)

HSP 1 Score: 521.931 bits (1343), Expect = 0.000e+0
Identity = 237/339 (69.91%), Postives = 293/339 (86.43%), Query Frame = 1
Query:  100 NAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNARA---IDVSIDLKFKGELKTVDKVYNYSMK 1107
            +A +++DMT+KDYYFDSYAHFGIHEEMLKDEIRT++YR+AL HN+HLVKDKVVLDVGCGT ILC+FA++AGAK  IGI+CSNIID A E+V+AN M  +ITLIKGKVEEVELP +  KVD++ISEWMGYCL YESMLNTV++ARDKWLAPGGIIMPD+ATL++ AIEDR+YKDEKINWW +VYGFDMSCIRK A +EPLVDVV+P+Q+V++ CLVKE++MY ITV DLTFS PFTL+  RNDY+ A+VT+FNI+FTS  KP  FST P +RR THWKQ+VFYLD+G DD + VK+GE+INGV S+KPN R    +D++I ++F+GEL ++D  +NY M+
Sbjct:   22 SATESSDMTSKDYYFDSYAHFGIHEEMLKDEIRTLTYRSALIHNKHLVKDKVVLDVGCGTAILCLFAIKAGAKHAIGIECSNIIDRAVEVVRANNMSDRITLIKGKVEEVELPPEFPKVDIVISEWMGYCLFYESMLNTVIYARDKWLAPGGIIMPDRATLYVCAIEDRQYKDEKINWWDSVYGFDMSCIRKVALTEPLVDVVDPNQVVTNCCLVKEVDMYSITVPDLTFSAPFTLTCKRNDYIQALVTFFNIDFTSCHKPTGFSTGPDERRYTHWKQTVFYLDNGDDDCLTVKKGEQINGVMSIKPNERNNRDLDINIKVEFEGELSSIDTTFNYRMR 360          
BLAST of protein arginine methyltransferase 1-like protein vs. TrEMBL
Match: A0A504Z1W6 (Arginine methyltransferase 1 OS=Fasciola gigantica OX=46835 GN=FGIG_00455 PE=3 SV=1)

HSP 1 Score: 521.546 bits (1342), Expect = 0.000e+0
Identity = 237/335 (70.75%), Postives = 290/335 (86.57%), Query Frame = 1
Query:  112 TNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNARA---IDVSIDLKFKGELKTVDKVYNYSMK 1107
            +++MT+KDYYFDSYAHFGIHEEMLKDE RT++YR+AL HN+HLVKDKVVLDVGCGTGILC+FA++AGA+  IGI+CSNIID A EIVKAN M  +ITLIKGKVEEVELP    KVD+IISEWMGYCL YESMLNTVLFARDKWLAPGGIIMPD+ATL++ AIEDR+YKDEKINWW +VYGFDMSCIRK A +EPLVDVV+P+Q+V++ CLVKE++MY ITVDDL+F+ PFTL+  RNDY+ A+VT+FNI+FT   KP  FST P +RR THWKQ+VFYLD+G+DD + VK+GE++NG  S+KPNAR    +D+S+ + F+GEL ++D V+NY M+
Sbjct:   17 SSEMTSKDYYFDSYAHFGIHEEMLKDETRTLTYRSALIHNKHLVKDKVVLDVGCGTGILCLFAIKAGARHAIGIECSNIIDRAMEIVKANNMSDRITLIKGKVEEVELPDGFCKVDIIISEWMGYCLFYESMLNTVLFARDKWLAPGGIIMPDRATLYVCAIEDRQYKDEKINWWDSVYGFDMSCIRKVALTEPLVDVVDPNQVVTNCCLVKEVDMYTITVDDLSFTAPFTLTCKRNDYIQALVTFFNIDFTCCHKPTGFSTGPDERRYTHWKQTVFYLDNGEDDCLTVKKGEQVNGSMSIKPNARNNRDLDISVKILFEGELSSMDSVFNYRMR 351          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Cavefish
Match: prmt1 (protein arginine methyltransferase 1 [Source:NCBI gene;Acc:103022674])

HSP 1 Score: 460.299 bits (1183), Expect = 2.815e-162
Identity = 216/346 (62.43%), Postives = 275/346 (79.48%), Query Frame = 1
Query:   79 LTMDHNSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            ++   +S      DMT+KDYYFDSYAHFGIHEEMLKDE+RT++YRN+++HN+HL KDKVVLDVG GTGILCMFA +AGAK+VIGI+CS+I DYA +IVKANK+D  +T+IKGKVEEVELP +   VD+IISEWMGYCL YESMLNTV++ARDKWL P G+I PD+ATL++ AIEDR+YKD KI+WW+NVYGFDMSCI++ A  EPLVDVV+P Q+VS  CL+KE+++Y + ++DL+F++PF L + RNDY+HA+VTYFNIEFT   K   FST+P +   THWKQ+VFYL    DD + VK GEEI G  S+KPN    R +D ++D+ FKG+L  + K   Y M+
Sbjct:   24 VSQGESSEKPAAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNKHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAVKIVKANKLDHIVTIIKGKVEEVELPVE--HVDIIISEWMGYCLFYESMLNTVIYARDKWLKPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKEVAIKEPLVDVVDPKQLVSSACLIKEVDIYTVKIEDLSFTSPFCLQVKRNDYIHALVTYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYL----DDYLTVKTGEEIFGTISMKPNVKNNRDLDFTVDIDFKGQLCEMSKTSEYRMR 362          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Cavefish
Match: prmt8b (protein arginine N-methyltransferase 8-B [Source:NCBI gene;Acc:103024775])

HSP 1 Score: 436.032 bits (1120), Expect = 6.276e-152
Identity = 200/337 (59.35%), Postives = 267/337 (79.23%), Query Frame = 1
Query:  106 MDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKP---NARAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            ++  +MT++DYYFDSYAHFGIHEEMLKDE+RT++YRN++YHN+HL KDK+VLDVG GTGIL MFA +AGAK V GI+CS+I +Y+++I+K+N +D  IT+ KGKVEE ELP D  +VD+I+SEWMGYCL YESML TV++ARDKWL PGG + PD+ATL++VAIEDR+YKD KI+WW+NVYGFDM+CIR  A  EPLVD+V+P Q+V++ CL+KE+++Y + ++DL F++ F L + RNDY+HA+VTYFNIEFT   K   FSTAP    +THWKQ+VFYL    +D + V+RGEEI G  ++KP   N R +D + +L FKG+L      ++Y M+
Sbjct:   84 LNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHLFKDKIVLDVGSGTGILSMFAAKAGAKHVYGIECSSISEYSEKIIKSNHLDDVITIFKGKVEETELPVD--QVDIIVSEWMGYCLFYESMLKTVIYARDKWLKPGGYMFPDRATLYVVAIEDRQYKDFKIHWWENVYGFDMTCIRNVAMMEPLVDIVDPKQVVTNSCLIKEVDIYTVKLEDLAFTSAFCLQIQRNDYIHALVTYFNIEFTKCHKKTGFSTAPDA-PSTHWKQTVFYL----EDYLTVRRGEEILGSIAVKPNENNERDLDFTFELDFKGQLCDAAISHDYKMR 413          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Cavefish
Match: prmt1 (protein arginine methyltransferase 1 [Source:NCBI gene;Acc:103022674])

HSP 1 Score: 418.698 bits (1075), Expect = 1.377e-146
Identity = 198/318 (62.26%), Postives = 253/318 (79.56%), Query Frame = 1
Query:  163 GIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            G   EMLKDE+RT++YRN+++HN+HL KDKVVLDVG GTGILCMFA +AGAK+VIGI+CS+I DYA +IVKANK+D  +T+IKGKVEEVELP +   VD+IISEWMGYCL YESMLNTV++ARDKWL P G+I PD+ATL++ AIEDR+YKD KI+WW+NVYGFDMSCI++ A  EPLVDVV+P Q+VS  CL+KE+++Y + ++DL+F++PF L + RNDY+HA+VTYFNIEFT   K   FST+P +   THWKQ+VFYL    DD + VK GEEI G  S+KPN    R +D ++D+ FKG+L  + K   Y M+
Sbjct:    6 GASGEMLKDEVRTLTYRNSMFHNKHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAVKIVKANKLDHIVTIIKGKVEEVELPVE--HVDIIISEWMGYCLFYESMLNTVIYARDKWLKPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKEVAIKEPLVDVVDPKQLVSSACLIKEVDIYTVKIEDLSFTSPFCLQVKRNDYIHALVTYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYL----DDYLTVKTGEEIFGTISMKPNVKNNRDLDFTVDIDFKGQLCEMSKTSEYRMR 316          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Cavefish
Match: prmt6 (protein arginine methyltransferase 6 [Source:NCBI gene;Acc:448867])

HSP 1 Score: 239.58 bits (610), Expect = 1.122e-75
Identity = 134/351 (38.18%), Postives = 211/351 (60.11%), Query Frame = 1
Query:   85 MDHNSNAMDTNDMTAKD-YYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNV---YGFDMSCIRKFATS-----EPLVDVVNPDQIVSDICLVKEINMYDITVDDL-TFSTPFTLSMLRNDYVHAMVTYFNIEFTSS-LKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKP---NARAIDVSIDLKFKGELKTVDKVYN 1095
             D+NS    +   +A+D  YF SYA   IHEEML D +RT +YR A++     +  K VLDVG GTG+L +F  +AGA+RV  ++ S+I + A  IV+ N+++ ++ +I+G VE VELP    +VDVI+SEWMGY LL+ESMLN+V+ ARD+WL PGG+I+P++A L +  I D    +E++N+W  V   YG DMSC+ +FA S     E  V  V  + ++S  C   ++++  +T+++L   S  F      +  ++A+  +F + F +  + P+  ST+P K   THWKQ+V YLD+  D    V++  ++ G  S+ P   ++R + + +D    GE K   K ++
Sbjct:   18 QDNNS----SGGGSAQDSLYFQSYADVSIHEEMLADTVRTDTYRRAIFRCAAALAGKAVLDVGAGTGVLSVFCAQAGARRVYAVEASSIAEQAARIVRQNRVEDRVQVIRGTVESVELPE---RVDVIVSEWMGYALLHESMLNSVITARDRWLKPGGLILPERAELFVAPISDL-VAEERLNFWDTVKGQYGVDMSCMAEFARSCVLNGEIAVHPVTVEDVLSHPCRFAQLDLRTVTLEELKRVSGAFCCQCFGSSSLNALCVWFTVTFPAEDMPPLVLSTSPFKAE-THWKQAVLYLDEPVD----VRQDTKVEGNISMYPSEKSSRYVCIHVDYTV-GEHKQKSKTFS 354          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Cavefish
Match: prmt3 (protein arginine methyltransferase 3 [Source:ZFIN;Acc:ZDB-GENE-041105-1])

HSP 1 Score: 236.498 bits (602), Expect = 1.356e-73
Identity = 114/228 (50.00%), Postives = 165/228 (72.37%), Query Frame = 1
Query:  139 YFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRN 822
            YF SY H+ IHEEMLKD +RT SYR+ +Y N  + KDKVVLDVGCGTGIL MFA R+GAK+VI +D S II  A +IV++N+++  ITLIKG++E+V+LP  V KVD+IISEWMGY LL+ESML++VL+ARD++LA GG++ PD+  + + A+ D E   ++I +W NVYGF M C+++    E +V+V+ P+ ++S+  +++        V   T S+  TL+++ N
Sbjct:  219 YFSSYGHYSIHEEMLKDTVRTESYRDFIYGNPDVFKDKVVLDVGCGTGILSMFAARSGAKKVIAVDQSEIIYQAIDIVRSNQLENTITLIKGRIEDVDLP--VEKVDIIISEWMGYFLLFESMLDSVLWARDRYLADGGLVFPDRCIISLAAVGDTEKHSDRIAFWDNVYGFKMECMKEVVIPEAVVEVLKPETVISEPAVIQ--------VSKDTDSSTLTLTVVLN 436          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Sea Lamprey
Match: prmt1 (protein arginine methyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-693])

HSP 1 Score: 457.988 bits (1177), Expect = 2.461e-162
Identity = 218/340 (64.12%), Postives = 268/340 (78.82%), Query Frame = 1
Query:   97 SNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
              A + ++MT+KDYYFDSYAHFGIHEEMLKDE+RT +YRNA+YHN HL KDKVVLDVG GTGILCMFA +AGAK+V GI+CSNI DY+++I+KAN +D+ IT++KGKVEEV+L  D  KVD+IISEWMGYCLLYESMLNTV+ ARDKWL PGG I PD+A+L + AIEDR+YK+ KINWW++VYGFDMSCIR  A  EPLVDVV P Q+V++ CLVKE+++Y + VDDLTF++PF L + R DYVHA+V YF +EFT   K   FSTAP     THWKQ+VFYL   K+D + VK GEEI G  SL+PNA   R +D +ID++FKG+L  V     Y M+
Sbjct:   19 GTAPNADEMTSKDYYFDSYAHFGIHEEMLKDEVRTRTYRNAMYHNRHLFKDKVVLDVGSGTGILCMFAAKAGAKKVFGIECSNIADYSQQIIKANNLDSVITIVKGKVEEVDLLVD--KVDIIISEWMGYCLLYESMLNTVICARDKWLKPGGAIFPDRASLFLTAIEDRQYKENKINWWEDVYGFDMSCIRDVAIQEPLVDVVEPKQVVTNSCLVKEVDIYTVKVDDLTFTSPFCLQVRRADYVHALVAYFTVEFTRCHKRTGFSTAPDAPY-THWKQTVFYL---KEDCLTVKPGEEIYGTISLRPNAKNNRDLDFTIDVEFKGQLCEVSSSQEYRMR 352          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Sea Lamprey
Match: prmt2 (protein arginine methyltransferase 2 [Source:ZFIN;Acc:ZDB-GENE-041104-1])

HSP 1 Score: 185.652 bits (470), Expect = 5.725e-55
Identity = 107/316 (33.86%), Postives = 169/316 (53.48%), Query Frame = 1
Query:  106 MDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVR-AGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIE-DREYKDEKINWWQNVYGFDMSCIRKFAT----SEPLVD-VVNPDQIVSDICLVKEINMYDITVDDL-TFSTPFTLSMLRNDYVHAMVTYFNIEFTS--SLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPN 1023
            +   D    D YF+SY+   + +EML D +RT +Y   +  +   ++ K VLDVGCG+GI+ M   + A   RV  ++ S +    +++V+ N M   + +++G+VE+VELP     VD ++SEWMG CLL+E M+ +VL ARD+WL  GG++ P  A LH+      REY D KI +W   Y  D S +R  A     S+P  D  ++PD  +++ C + +++M  +   +L   +  F   + +   +H    +F+ EF    S   I   T P    ATHWKQ++F L    D  V V  G+ + G  +L+ N
Sbjct:   88 LGEEDTWQDDEYFNSYSKLKLQQEMLADRVRTETYGAVMKRSRAWLRGKAVLDVGCGSGIISMLCAKHAQPSRVYAVEASELARLTEQVVRCNGMKDTVRVLQGRVEDVELPG---SVDCLVSEWMGTCLLFEFMIESVLQARDRWLRDGGVMWPSTAALHLTPCSAQREYTD-KIGFWDWQYELDFSQLRTEAAKEYFSKPKHDHQMDPDDCLAEPCCILQLDMSKVQTSELEEITYEFIFEVKKAGPMHGFAAWFSTEFKCPDSNPSIILDTGPMS-TATHWKQTLFML----DSPVAVTPGDFVVGSVALRRN 394          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Sea Lamprey
Match: carm1 (coactivator-associated arginine methyltransferase 1 [Source:NCBI gene;Acc:445251])

HSP 1 Score: 180.644 bits (457), Expect = 1.246e-51
Identity = 109/307 (35.50%), Postives = 168/307 (54.72%), Query Frame = 1
Query:  139 YFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDE---KINWW--QNVYGFDMSCIRKFATSE----PLVDVVNPDQIVSDICLVKEINMYDITVDDL-TFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNAR 1029
            YF  Y +    + M++D IRT +Y+ A+  N    +DK+VLDVGCG+GIL  FAV+AGA++V  ++ S++  +A+ +V++N +  +I +I GKVE+V +P    KVDVIISE MGY L  E ML + L A+ KWL P G + P    +H+    D +   E   K N+W  Q+ +G D+S +R  A  E    P+VD  +  +I+    +   +N      +DL     PF   ML++  VH +  +F++ F  S+  +  STAPT+   THW Q    L       +  K G+ ++G   +  N R
Sbjct:  125 YFQFYGYLSQQQNMMQDYIRTGTYQRAILQNHADFRDKIVLDVGCGSGILSFFAVQAGARKVYAVEASSMAQHAEVLVRSNNLQDRIVVIPGKVEDVSIPD---KVDVIISEPMGYMLFNERMLESYLHAK-KWLKPNGNMFPTLGDVHLAPFTDEQLYMEQFSKANFWYQQSFHGVDLSSLRGAALEEYFRQPIVDTFD-IRILMARSIKYTVNFQQAREEDLHRIEIPFKFQMLQSGLVHGLAFWFDVAFVGSMLTVWLSTAPTE-PLTHWYQVRCLL----QSPLFTKAGDTLSGTVVMIANKR 421          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Yeast
Match: HMT1 (Nuclear SAM-dependent mono- and asymmetric methyltransferase; modifies hnRNPs, including Npl3p and Hrp1p, affecting their activity and nuclear export; methylates U1 snRNP protein Snp1p, ribosomal protein Rps2p, and histones H3 and H4; interacts genetically with genes encoding components of Rpd3(L) and this interaction is important for Rpd3 recruitment to the subtelomeric region [Source:SGD;Acc:S000000238])

HSP 1 Score: 308.145 bits (788), Expect = 1.606e-103
Identity = 153/322 (47.52%), Postives = 217/322 (67.39%), Query Frame = 1
Query:  127 AKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTS--SLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNAR-AIDVSIDLKFKGELKTVD 1083
            ++ +YF+SY H+GIHEEML+D +RT+SYRNA+  N+ L KDK+VLDVGCGTGIL MFA + GAK VIG+D S+II+ AKE+V+ N    KITL++GK+E+V LP    KVD+IISEWMGY LLYESM++TVL+ARD +L  GG+I PDK ++H+  +ED +YKDEK+N+WQ+VYGFD S        EP+VD V  + + +    + E ++  + + DL F + F L+  R D ++ +VT+F+I F +    +P+ FST P     THWKQ++FY  D  D     + G+ I G     PN +   D++I + +K E   +D
Sbjct:   19 SEQHYFNSYDHYGIHEEMLQDTVRTLSYRNAIIQNKDLFKDKIVLDVGCGTGILSMFAAKHGAKHVIGVDMSSIIEMAKELVELNGFSDKITLLRGKLEDVHLP--FPKVDIIISEWMGYFLLYESMMDTVLYARDHYLVEGGLIFPDKCSIHLAGLEDSQYKDEKLNYWQDVYGFDYSPFVPLVLHEPIVDTVERNNVNTTSDKLIEFDLNTVKISDLAFKSNFKLTAKRQDMINGIVTWFDIVFPAPKGKRPVEFSTGP-HAPYTHWKQTIFYFPDDLD----AETGDTIEGELVCSPNEKNNRDLNIKISYKFESNGID 333          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Nematostella
Match: EDO47611 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLI7])

HSP 1 Score: 425.631 bits (1093), Expect = 8.511e-149
Identity = 206/335 (61.49%), Postives = 258/335 (77.01%), Query Frame = 1
Query:  112 TNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNARA---IDVSIDLKFKGELKTVDKVYNYSMK 1107
             ++MT+ DYYFDSYAHFGIHEEMLKDE+RT++YRN++YHN+HL +DK+VLDVGCGTGIL MFA +AGAK V  I+ S+I+DY+K I+K N  D+ ITLIKGKVE+VELP  V KVD+IISEWMGYCL YESML+TVL+ARDKWL P G++ PDKA L++ AIEDR+YK+EKI WW  VYGFDMS IRK A SEPLVDVV+P Q+V++ C+VKE+++  +  +DL F+ PF L   RNDYVHA+V++F IEFT   K   FSTAP     THWKQ+VFYL    +D + VK GEEI G   ++PNAR    ID +I ++F+GEL   DK   Y M+
Sbjct:   53 ASEMTSADYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHLFRDKIVLDVGCGTGILSMFAAKAGAKHVYAIEMSSIVDYSKTIIKDNNFDSVITLIKGKVEDVELP--VEKVDIIISEWMGYCLFYESMLDTVLYARDKWLKPDGMLFPDKAKLYVCAIEDRQYKEEKIYWWDRVYGFDMSSIRKVALSEPLVDVVDPKQVVTNSCMVKEVDIQTVKKEDLNFTAPFRLYCHRNDYVHALVSFFTIEFTHCHKRTGFSTAP-DCPYTHWKQTVFYL----EDYLTVKYGEEITGSIHMEPNARNNRDIDFNIGIQFEGELSNYDKEQKYRMR 380          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Nematostella
Match: EDO49961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RER6])

HSP 1 Score: 306.605 bits (784), Expect = 5.688e-100
Identity = 159/318 (50.00%), Postives = 213/318 (66.98%), Query Frame = 1
Query:  139 YFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKP-ITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPN---ARAIDVSIDLKFKGELKTV 1080
            YF SY+HFGIHEEMLKD++RT SYR+ +Y N  + KDKVVLDVGCGTGIL MFA R+GA++VIGID S II  A +I++ N  +  ITLIKGK EEV LP  V +VDVIISEWMGY LL+ESML+TVLF RDKWL P G + PDK T+H+VAI   E K  KIN+W +VYGF MSC++K  + E  ++ V+ D ++S  C +K I++     +DL F + F   + + D+   +V+YF+I F    K  + FST+P     THWKQ++FY      + +PV +G+ + G  S   N    R++DV I++  KG  K +
Sbjct:  223 YFSSYSHFGIHEEMLKDKVRTESYRDFIYGNPDIFKDKVVLDVGCGTGILSMFAARSGARQVIGIDQSEIIYQAMDIIRENGFEKTITLIKGKAEEVTLP--VEQVDVIISEWMGYFLLFESMLDTVLFCRDKWLNPQGSVYPDKCTMHLVAIGTGEKKQPKINFWDDVYGFKMSCMKKTVSKEAAIETVDVDALISTHCTIKSIDINSCKKEDLNFISSFRFEIKKPDFFTGIVSYFDIFFEHEAKEKVVFSTSPA-HTPTHWKQAIFYF----QNPIPVTQGQILTGHISCYKNLKEPRSLDVRIEVVDKGTEKVL 533          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Nematostella
Match: EDO39146 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAV4])

HSP 1 Score: 191.43 bits (485), Expect = 4.894e-57
Identity = 123/324 (37.96%), Postives = 176/324 (54.32%), Query Frame = 1
Query:  133 DYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAG-AKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFD----MSCIRKFATSEPLVD-VVNPDQIVSDICLVKEINMYDITVDDLTFST-PFTLSMLRNDYVHAMVTYFNIEFTS-------SLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDL 1053
            D YF  Y    IH EMLKD+ RT SYR A+       KDKVVLDVGCGTGIL +F  R G A +V  ++ S I    +EI+K N +D KIT+I+GK+EEVELP    KVD+I+SEWMG  L++E ML +VL ARD WL P G++ P +A L +V    +   DE I+ W++ YGFD    +S  ++   S P+ + V N +  +S    + +++       DL  S   F   + ++  ++   ++F++ F +           +  ST P +   THWKQ +F L    D  +PV+  + I G   LK N    R + V  D 
Sbjct:   67 DEYFADYGSLKIHLEMLKDKPRTESYRMAIEQGAGYFKDKVVLDVGCGTGILSLFCAREGKASKVYAVEASEIAKLTEEIIKQNNLDDKITVIQGKIEEVELPE---KVDIIVSEWMGTFLVFEFMLESVLTARDIWLKPNGLVWPSEAKLFLVPCCTKTAYDEVIHIWRDQYGFDYSPAISKAKQEFLSRPIYNHVFNYEDCISTPQPIIKLDTLKTARHDLEHSAHGFEFVIEQDSMLYGFCSWFDVLFGNIPHGEDKRNSAVVLSTGP-QCDLTHWKQDLFLL----DMPLPVQENDLIKGSICLKRNPDFRRHLSVVFDF 382          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Nematostella
Match: EDO28377 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6M8])

HSP 1 Score: 82.4185 bits (202), Expect = 3.771e-19
Identity = 45/139 (32.37%), Postives = 77/139 (55.40%), Query Frame = 1
Query:  649 GFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLK-PITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPN---ARAIDVSIDL 1053
            GF MSC++K  + E  ++ V+ D ++S  C +K I++     +DL F + F   + + D+   +V+YF+I F    K  + FST+P     THWKQ++FY      + +PV +G+ + G  S   N    R++DV I++
Sbjct:    4 GFKMSCMKKTVSKEAAIETVDVDALISTHCTIKSIDINSCKKEDLNFISSFRFEIKKPDFFTGIVSYFDIFFEHEAKEKVVFSTSPA-HTPTHWKQAIFYF----QNPIPVTQGQILTGHISCYKNLKEPRSLDVRIEV 137          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Nematostella
Match: EDO38718 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBZ7])

HSP 1 Score: 70.4774 bits (171), Expect = 3.871e-13
Identity = 75/301 (24.92%), Postives = 135/301 (44.85%), Query Frame = 1
Query:  169 HEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNII-DYAKEIVKANKMDTKITLIKGKVEEVELPADVL-KVDVIISEWMGYCLLYESMLNTVLFA----------------------RDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIV----SDICLVKEINMYD-----ITVDDLTFSTPFTLSMLRNDYV----------HAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVF 942
            H  ML D  R ++Y+ A+ +      D +VLD+G G+GIL MFAV+AGAK+V   + S  + + +K+++  N+M++ I +I  K  ++ +  D+  +V ++ +E +   LL E +L T+  A                      R   ++P  +++P  A L+   IE  + + +      NV GF++  ++     +   +  + DQ      +  CL      Y        + +  F+ P TL   R   V           A+  +F++    +    T STAP K  +  W+Q+VF
Sbjct:  137 HFRMLNDRQRNLAYKKAISNAVSNGCD-IVLDIGSGSGILSMFAVQAGAKKVYACEMSKTMYELSKDVLLGNQMESFIEVIHKKSTDLLIGKDLPGRVSLVCTETLDCGLLGEGILKTISHAWEALLQEKKSITSTEQQIDGVVRTSGISP--MVIPRGAKLYGQVIESSDIRHQSY-CRPNVAGFNVRIVKVIGGEQLEQENTHLDQEAIEPYTTECLDSLQGGYKPLTEPFVITEYDFTKPSTLCSERKPQVIVPVSQPGNMDAIAVWFDLHLDET---TTISTAPGK-GSLCWEQAVF 429          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Medaka
Match: prmt1 (protein arginine methyltransferase 1 [Source:NCBI gene;Acc:101173551])

HSP 1 Score: 458.373 bits (1178), Expect = 9.482e-162
Identity = 216/333 (64.86%), Postives = 272/333 (81.68%), Query Frame = 1
Query:  118 DMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            DMT+KDYYFDSYAHFGIHEEMLKDE+RT++YRN++++N+HL KDKVVLDVG GTGILCMFA +AGAK+VIGI+CS+I DYA +IVKAN MD  +T+IKGKVEEVELP D  KVD+IISEWMGYCL YESMLNTV++ARDKWL P G+I PD+ATL++ AIEDR+YKD KI+WW+NVYGFDMSCI++ A  EPLVDVV+P Q+VS+ CL++E+++Y +  +DLTF++PF L + RNDY+HA+VTYFNIEFT   K I FST+P +   THWKQ+VFYL    +D + VK GEEI G  S+KPN    R +D ++D+ F G+L T+ K   Y M+
Sbjct:   23 DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFYNKHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAVKIVKANNMDDVVTIIKGKVEEVELPVD--KVDIIISEWMGYCLFYESMLNTVIYARDKWLKPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKEVAIKEPLVDVVDPKQLVSNSCLIREVDIYTVKAEDLTFTSPFCLQVKRNDYIHALVTYFNIEFTRCHKRIGFSTSP-ESPYTHWKQTVFYL----EDYLTVKSGEEIFGTISMKPNVKNNRDLDFTVDVDFTGQLCTMTKSLEYRMR 348          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Medaka
Match: ENSORLT00000020054.2 (protein arginine N-methyltransferase 8-B [Source:NCBI gene;Acc:101162208])

HSP 1 Score: 442.965 bits (1138), Expect = 9.911e-155
Identity = 203/337 (60.24%), Postives = 271/337 (80.42%), Query Frame = 1
Query:  106 MDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            +   +MT++DYYFDSYAHFGIHEEMLKDE+RT++YRN++YHN+H+ KDK+VLDVG GTGIL MFA +AGAK V GI+CS+I +Y+++I+K+N +D+ IT+ KGKVEEVELP +  KVD+IISEWMGYCL YESMLNTV+FARDKWL PGG++ PD+A+L+++AIEDR++KD KI+WW+NVYGFDM+CIR  A  EPLVDVV+P Q+V++ CLVKE+++Y +  +DLTFS+ F L + RNDY+HA+VTYF++EFT   K   FSTAP     THWKQ+VFYL    +D + V+RGEEI+G  S+KPN    R +D +++L FKG+L      ++Y M+
Sbjct:   81 LTPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSMFAAKAGAKHVYGIECSSISEYSEKIIKSNHLDSVITIFKGKVEEVELPVE--KVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRASLYVLAIEDRQFKDFKIHWWENVYGFDMTCIRNVAMKEPLVDVVDPKQVVTNSCLVKEVDIYTVKPEDLTFSSTFCLQIQRNDYIHALVTYFSVEFTKCHKKTGFSTAPDA-AYTHWKQTVFYL----EDYLTVRRGEEISGSISMKPNEKNIRDLDFTVELDFKGQLCEAAIAHDYKMR 410          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Medaka
Match: prmt8b (protein arginine N-methyltransferase 8-B [Source:NCBI gene;Acc:101155736])

HSP 1 Score: 434.106 bits (1115), Expect = 2.333e-151
Identity = 203/337 (60.24%), Postives = 265/337 (78.64%), Query Frame = 1
Query:  106 MDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKP---NARAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            +   +MT++DYYFDSYAHFGIHEEMLKDE+RT++YRNA+YHN+H+ KDK+VLDVG GTGIL MFA  AGAK V GI+CS+I +Y+++I+K+N M   IT+ KGKVEEVELP +  KVD+IISEWMGYCL YESMLNTV+FARDKWL PGG++ PD+A L++VAIEDR+YKD KI+WW+NVYGFDMSCIR  A  EPLVDVV+  Q+V++ CL+KE+++Y +  +DL+F++ F L + RN YVHA+VTYFNIEFT   K   FSTAP    +THWKQ+VFYL    +D + VK+GEEI G  S++P   N R ++ +++L FKG+L      ++Y M+
Sbjct:   76 ISPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNAMYHNKHVFKDKIVLDVGSGTGILSMFAANAGAKHVYGIECSSISEYSEKIIKSNHMHNAITIFKGKVEEVELPVE--KVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMSCIRNIAIKEPLVDVVDHKQVVTNSCLLKEVDIYTVKPEDLSFTSAFCLQIQRNHYVHALVTYFNIEFTKCHKKTGFSTAPDA-PSTHWKQTVFYL----EDYLTVKKGEEIFGSLSVRPNEKNVRDLEFTLELDFKGQLCEAAISHDYKMR 405          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Medaka
Match: ENSORLT00000018691.2 (protein arginine N-methyltransferase 8-B [Source:NCBI gene;Acc:101162208])

HSP 1 Score: 389.423 bits (999), Expect = 3.751e-134
Identity = 187/337 (55.49%), Postives = 253/337 (75.07%), Query Frame = 1
Query:  106 MDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            +   +MT++DYYFDSYAHFGIHEEMLKDE+RT++YRN++YHN+H+ KDK+VLDVG GTGIL MFA +AGAK V GI+CS+I +Y+++I+K+N +D+ IT+ KGKVEEVELP +  KVD+IISEWMGYCL YESMLNTV+FARDKWL     ++P +    ++ +   +     +  W+NVYGFDM+CIR  A  EPLVDVV+P Q+V++ CLVKE+++Y +  +DLTFS+ F L + RNDY+HA+VTYF++EFT   K   FSTAP     THWKQ+VFYL    +D + V+RGEEI+G  S+KPN    R +D +++L FKG+L      ++Y M+
Sbjct:   55 LTPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSMFAAKAGAKHVYGIECSSISEYSEKIIKSNHLDSVITIFKGKVEEVELPVE--KVDIIISEWMGYCLFYESMLNTVIFARDKWL-----MLPLEEVEKVLKVCVNKVTPLFLAGWENVYGFDMTCIRNVAMKEPLVDVVDPKQVVTNSCLVKEVDIYTVKPEDLTFSSTFCLQIQRNDYIHALVTYFSVEFTKCHKKTGFSTAPDAAY-THWKQTVFYL----EDYLTVRRGEEISGSISMKPNEKNIRDLDFTVELDFKGQLCEAAIAHDYKMR 379          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Medaka
Match: prmt3 (protein arginine methyltransferase 3 [Source:NCBI gene;Acc:101174166])

HSP 1 Score: 286.189 bits (731), Expect = 4.702e-92
Identity = 146/327 (44.65%), Postives = 221/327 (67.58%), Query Frame = 1
Query:  139 YFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSL-KPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPN---ARAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            YF SY H+GIHEEMLKD++RT SYR+ +Y N  + +DKVVLDVGCGTGIL MFA RAGA +VIG+D S+I+  A +I+++N+++ KITLIKG++E+++LP  V KVD+IISEWMGY LL+ESML++V++ARD +L+ GG + PD   + + A+ D+    +++ +W +VYGF+MSC++K A  E LV+VV  D ++S+  +++ I+   + + +L F+T F L M +     A+V YF+I F       + FST P   + THWKQ+VF L    +  + V+ G+E+ G   ++ N    RA+ V+IDL+        D+   YS++
Sbjct:  202 YFSSYGHYGIHEEMLKDKVRTESYRDFMYRNPDVFRDKVVLDVGCGTGILSMFAARAGATQVIGVDQSDIVYQAMDIIRSNQLEDKITLIKGRIEDIKLP--VAKVDIIISEWMGYFLLFESMLDSVVYARDLYLSDGGSVYPDLCNISLAAVGDKHKHHDRVAFWDDVYGFNMSCMKKAALPEALVEVVKMDTVISEPTVIQTIDCNRVCLSELEFTTDFCLRMTKTTVCTAIVGYFDIFFDKDCNNKVMFSTGPQVTK-THWKQTVFLL----ERPISVQAGDELQGKILVRKNKKDPRALWVTIDLR--------DRKQTYSLQ 513          
BLAST of protein arginine methyltransferase 1-like protein vs. Planmine SMEST
Match: SMESG000038790.1 (SMESG000038790.1)

HSP 1 Score: 707.212 bits (1824), Expect = 0.000e+0
Identity = 341/341 (100.00%), Postives = 341/341 (100.00%), Query Frame = 1
Query:   85 MDHNSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNARAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            MDHNSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNARAIDVSIDLKFKGELKTVDKVYNYSMK
Sbjct:    1 MDHNSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNARAIDVSIDLKFKGELKTVDKVYNYSMK 341          
BLAST of protein arginine methyltransferase 1-like protein vs. Planmine SMEST
Match: SMESG000038790.1 (SMESG000038790.1)

HSP 1 Score: 701.049 bits (1808), Expect = 0.000e+0
Identity = 341/344 (99.13%), Postives = 341/344 (99.13%), Query Frame = 1
Query:   85 MDHNSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            MDHNSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA   RAIDVSIDLKFKGELKTVDKVYNYSMK
Sbjct:    1 MDHNSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNAVNNRAIDVSIDLKFKGELKTVDKVYNYSMK 344          
BLAST of protein arginine methyltransferase 1-like protein vs. Planmine SMEST
Match: SMESG000038790.1 (SMESG000038790.1)

HSP 1 Score: 690.649 bits (1781), Expect = 0.000e+0
Identity = 334/334 (100.00%), Postives = 334/334 (100.00%), Query Frame = 1
Query:  106 MDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNARAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            MDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNARAIDVSIDLKFKGELKTVDKVYNYSMK
Sbjct:    1 MDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNARAIDVSIDLKFKGELKTVDKVYNYSMK 334          
BLAST of protein arginine methyltransferase 1-like protein vs. Planmine SMEST
Match: SMESG000038790.1 (SMESG000038790.1)

HSP 1 Score: 685.641 bits (1768), Expect = 0.000e+0
Identity = 334/337 (99.11%), Postives = 334/337 (99.11%), Query Frame = 1
Query:  106 MDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA---RAIDVSIDLKFKGELKTVDKVYNYSMK 1107
            MDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNA   RAIDVSIDLKFKGELKTVDKVYNYSMK
Sbjct:    1 MDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNAVNNRAIDVSIDLKFKGELKTVDKVYNYSMK 337          
BLAST of protein arginine methyltransferase 1-like protein vs. Planmine SMEST
Match: SMESG000038804.1 (SMESG000038804.1)

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 256/347 (73.78%), Postives = 311/347 (89.63%), Query Frame = 1
Query:   85 MDH---NSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNARA---IDVSIDLKFKGELKTVDKVYNYSMK 1107
            M+H   N +A++ +DMT+KDYYFDSYAHFGIHEEMLKDE+RT++YRNALYHN+HLVKDKVVLDVGCGTGILCMFAV+AGA++VIGIDCSNIIDYAKEI+KANKM+ KITLIKGKVEEVELP DVLKVD+IISEWMGYCL YESMLNTVLFARDKWL  GGIIMPDKATLH+ AIEDR+YKDEKINWW+NVYGFDMSCIRK A SEPLVDVVNP+QIVS+ C+VKE+NMY+I V+DL+F++PFTL++ +NDY+HA+V +FNI+FTSS K I FST P+ RR THWKQ+VFYLDDG +D++ V  GEEI G+FSLKPNAR    +D++I++KF+G++  +++ ++Y M+
Sbjct:    1 MEHASINGDAIEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHLVKDKVVLDVGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 347          
The following BLAST results are available for this feature:
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRMT12.113e-16163.64protein arginine methyltransferase 1 [Source:HGNC ... [more]
PRMT12.576e-16163.64protein arginine methyltransferase 1 [Source:HGNC ... [more]
PRMT11.902e-16064.76protein arginine methyltransferase 1 [Source:HGNC ... [more]
PRMT87.467e-15861.47protein arginine methyltransferase 8 [Source:HGNC ... [more]
PRMT88.826e-15861.47protein arginine methyltransferase 8 [Source:HGNC ... [more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
prmt-13.114e-13354.05Protein arginine N-methyltransferase 1 [Source:Un... [more]
prmt-13.114e-13354.05Protein arginine N-methyltransferase 1 [Source:Un... [more]
prmt-76.955e-829.31Protein arginine N-methyltransferase 7 [Source:Un... [more]
prmt-97.836e-627.10PRotein arginine MethylTransferase [Source:UniPro... [more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Art13.796e-15459.82gene:FBgn0037834 transcript:FBtr0082304[more]
Art21.710e-8941.12gene:FBgn0031592 transcript:FBtr0077476[more]
Art21.710e-8941.12gene:FBgn0031592 transcript:FBtr0345748[more]
Art61.429e-8138.04gene:FBgn0038189 transcript:FBtr0082878[more]
Art32.690e-7640.19gene:FBgn0038306 transcript:FBtr0083135[more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prmt11.073e-16264.86protein arginine methyltransferase 1 [Source:ZFIN;... [more]
prmt8b1.654e-15459.94protein arginine methyltransferase 8b [Source:NCBI... [more]
prmt8b2.038e-15359.94protein arginine methyltransferase 8b [Source:NCBI... [more]
prmt8b2.109e-15359.94protein arginine methyltransferase 8b [Source:NCBI... [more]
PRMT81.450e-15259.64protein arginine N-methyltransferase 8-B-like [Sou... [more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
il1rap1.672e-16162.90interleukin 1 receptor accessory protein [Source:X... [more]
il1rap1.894e-16162.90interleukin 1 receptor accessory protein [Source:X... [more]
il1rap2.002e-16162.90interleukin 1 receptor accessory protein [Source:X... [more]
il1rap2.079e-16162.90interleukin 1 receptor accessory protein [Source:X... [more]
il1rap2.762e-16162.90interleukin 1 receptor accessory protein [Source:X... [more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prmt14.776e-16163.64protein arginine N-methyltransferase 1 [Source:MGI... [more]
Prmt17.164e-16163.64protein arginine N-methyltransferase 1 [Source:MGI... [more]
Prmt84.801e-15861.47protein arginine N-methyltransferase 8 [Source:MGI... [more]
Prmt14.672e-14563.06protein arginine N-methyltransferase 1 [Source:MGI... [more]
Prmt32.610e-9348.99protein arginine N-methyltransferase 3 [Source:MGI... [more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6VRB0|ANM1B_XENLA6.447e-16164.58Protein arginine N-methyltransferase 1-B OS=Xenopu... [more]
sp|Q28F07|ANM1_XENTR1.102e-16062.90Protein arginine N-methyltransferase 1 OS=Xenopus ... [more]
sp|Q99873|ANM1_HUMAN1.237e-16063.64Protein arginine N-methyltransferase 1 OS=Homo sap... [more]
sp|Q63009|ANM1_RAT3.341e-16063.64Protein arginine N-methyltransferase 1 OS=Rattus n... [more]
sp|Q9JIF0|ANM1_MOUSE5.011e-16063.64Protein arginine N-methyltransferase 1 OS=Mus musc... [more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2ESE00.000e+099.42Protein arginine methyltransferase 1-like protein ... [more]
A0A4Y5WRE50.000e+074.93Protein arginine methyltransferase 1 OS=Dugesia ja... [more]
H2ESD90.000e+073.62Protein arginine methyltransferase 1-like protein ... [more]
C7TY980.000e+069.91Arginine methyltransferase 1 OS=Schistosoma japoni... [more]
A0A504Z1W60.000e+070.75Arginine methyltransferase 1 OS=Fasciola gigantica... [more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prmt12.815e-16262.43protein arginine methyltransferase 1 [Source:NCBI ... [more]
prmt8b6.276e-15259.35protein arginine N-methyltransferase 8-B [Source:N... [more]
prmt11.377e-14662.26protein arginine methyltransferase 1 [Source:NCBI ... [more]
prmt61.122e-7538.18protein arginine methyltransferase 6 [Source:NCBI ... [more]
prmt31.356e-7350.00protein arginine methyltransferase 3 [Source:ZFIN;... [more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
prmt12.461e-16264.12protein arginine methyltransferase 1 [Source:ZFIN;... [more]
prmt25.725e-5533.86protein arginine methyltransferase 2 [Source:ZFIN;... [more]
carm11.246e-5135.50coactivator-associated arginine methyltransferase ... [more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
HMT11.606e-10347.52Nuclear SAM-dependent mono- and asymmetric methylt... [more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO476118.511e-14961.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499615.688e-10050.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391464.894e-5737.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283773.771e-1932.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387183.871e-1324.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prmt19.482e-16264.86protein arginine methyltransferase 1 [Source:NCBI ... [more]
ENSORLT00000020054.29.911e-15560.24protein arginine N-methyltransferase 8-B [Source:N... [more]
prmt8b2.333e-15160.24protein arginine N-methyltransferase 8-B [Source:N... [more]
ENSORLT00000018691.23.751e-13455.49protein arginine N-methyltransferase 8-B [Source:N... [more]
prmt34.702e-9244.65protein arginine methyltransferase 3 [Source:NCBI ... [more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038790.10.000e+0100.00SMESG000038790.1[more]
SMESG000038790.10.000e+099.13SMESG000038790.1[more]
SMESG000038790.10.000e+0100.00SMESG000038790.1[more]
SMESG000038790.10.000e+099.11SMESG000038790.1[more]
SMESG000038804.10.000e+073.78SMESG000038804.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30019468
GenBankAEX33824.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019468 ID=SMED30019468|Name=protein arginine methyltransferase 1-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1155bp
TTTATTTAGATGAAGACAAATACACTTTAATGTTTTAATTTAATTTTAAT
AAAGCATTTTTAAAAAATAATTATAAATTTAACAATGGACCACAATAGCA
ATGCAATGGATACAAATGATATGACTGCAAAGGATTACTATTTTGATTCC
TATGCCCATTTCGGTATTCATGAAGAAATGTTGAAGGATGAAATTCGAAC
CATTAGTTATCGAAATGCATTATACCATAACGAGCATTTAGTTAAAGATA
AAGTTGTTCTCGACGTTGGGTGTGGAACAGGAATCCTTTGCATGTTCGCA
GTTCGAGCTGGGGCAAAAAGAGTCATTGGGATTGACTGCTCAAATATTAT
TGATTATGCCAAAGAAATCGTCAAAGCAAATAAGATGGATACCAAAATCA
CCTTAATAAAGGGCAAGGTTGAAGAAGTAGAATTGCCTGCTGATGTTTTG
AAGGTTGATGTAATTATCAGTGAATGGATGGGTTATTGCTTGCTGTATGA
ATCCATGTTAAATACTGTTTTATTCGCTAGGGATAAATGGCTGGCACCCG
GCGGAATCATTATGCCGGATAAAGCTACCCTACACATGGTCGCGATTGAG
GACAGAGAGTACAAGGACGAGAAAATAAATTGGTGGCAAAATGTTTATGG
ATTCGATATGAGTTGTATCAGGAAGTTCGCAACATCTGAACCGTTAGTCG
ATGTCGTCAATCCAGATCAGATTGTATCAGATATTTGTCTAGTTAAAGAA
ATCAACATGTATGACATTACAGTTGATGATTTGACGTTTTCCACGCCATT
TACTTTATCAATGTTGAGAAATGATTACGTGCATGCTATGGTTACGTATT
TTAATATCGAATTTACATCATCACTCAAACCAATCACCTTTTCAACTGCA
CCAACGAAACGCCGGGCAACTCATTGGAAACAATCGGTTTTCTATTTGGA
TGATGGAAAAGATGATACAGTCCCTGTTAAAAGAGGTGAAGAAATTAATG
GAGTTTTTTCATTGAAACCGAATGCTAGAGCAATTGATGTCAGTATTGAT
CTGAAGTTTAAGGGAGAATTGAAAACTGTGGATAAGGTTTATAATTATTC
AATGAAATAAAATTGCCTTTGATGGAATTTCATATAAATAGAATTTATAA
TTTGT
back to top

protein sequence of SMED30019468-orf-1

>SMED30019468-orf-1 ID=SMED30019468-orf-1|Name=SMED30019468-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=342bp
MDHNSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNE
HLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANK
MDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARD
KWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFAT
SEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVH
AMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKR
GEEINGVFSLKPNARAIDVSIDLKFKGELKTVDKVYNYSMK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016274protein-arginine N-methyltransferase activity
GO:0008168methyltransferase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0018216peptidyl-arginine methylation
GO:0035246peptidyl-arginine N-methylation
GO:0006479protein methylation
GO:0032259methylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0000478pharynx musculature
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR041698Methyltransf_25
IPR029063SAM-dependent_MTases
IPR025799Arg_MeTrfase
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:2.70.160.11coord: 163..341
e-value: 3.9E-57
score: 194.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.150coord: 7..161
e-value: 1.7E-62
score: 211.8
NoneNo IPR availablePANTHERPTHR11006:SF47PROTEIN ARGININE N-METHYLTRANSFERASE 8coord: 9..339
NoneNo IPR availablePANTHERPTHR11006PROTEIN ARGININE N-METHYLTRANSFERASEcoord: 9..339
NoneNo IPR availableCDDcd02440AdoMet_MTasescoord: 58..160
e-value: 3.693E-14
score: 65.9142
IPR041698Methyltransferase domain 25PFAMPF13649Methyltransf_25coord: 58..157
e-value: 5.6E-11
score: 43.0
IPR025799Protein arginine N-methyltransferasePROSITEPS51678SAM_MT_PRMTcoord: 16..339
score: 93.268
IPR029063S-adenosyl-L-methionine-dependent methyltransferaseSUPERFAMILYSSF53335S-adenosyl-L-methionine-dependent methyltransferasescoord: 22..317