Asparagine rich antigen

Overview
NameAsparagine rich antigen
Smed IDSMED30019453
Length (bp)2475
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Asparagine rich antigen (SMED30019453) t-SNE clustered cells

Violin plots show distribution of expression levels for Asparagine rich antigen (SMED30019453) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Asparagine rich antigen (SMED30019453) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Asparagine rich antigen (SMED30019453) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019453

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30019453SMESG000022424.1 dd_Smed_v4_10530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019453SMESG000022424.1 dd_Smed_v4_10530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019453SMESG000022424.1 dd_Smed_v4_10530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019453SMESG000022424.1 dd_Smed_v4_10530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019453SMESG000022424.1 Contig51140newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019453SMESG000022424.1 Contig51140uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30019453SMESG000022424.1 dd_Smed_v6_10530_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30019453SMESG000022424.1 OX_Smed_1.0.10666ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30019453SMESG000022424.1 dd_Smed_v4_10530_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Asparagine rich antigen vs. TrEMBL
Match: A0A068WT79 (Asparagine rich antigen OS=Echinococcus granulosus OX=6210 GN=EgrG_000524800 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.536e-13
Identity = 69/181 (38.12%), Postives = 97/181 (53.59%), Query Frame = 1
Query:  190 SRVAAQIRRNKESQTLILLQNALPICLP-----------SPNQM-LEKSIVIRIAGQTLFLLKSLDQVLGMTDWLTVPLIS------SNFLAFFTDNIGQIVYASPNIQNVLEQHHWSNLIGISIFDIMDFKSRWPT-TGDVVKLKLLANPNPTCEFKSNKPQVSSMSFSPSVLYQNCSRS 675
            SR+AA++RRN+ES  L  L  ALP+ LP           +P+++ LEKS VIR+AGQTLFL  SL QVLG      VP IS         L   TD+   +VYA+P +   +    W NLIG+ +  + D + + PT  G+ V L++L         ++N P  SS+   PS L ++ S S
Sbjct:  190 SRLAAKLRRNQESNILFCLLRALPVSLPDTAVSEGSIKTTPSKLNLEKSGVIRMAGQTLFLYNSLSQVLGTK---AVPFISLLSKSLHGLLVHPTDST--VVYATPPLAEAI-NWPWINLIGVKLESLTD-EGKMPTRAGETVNLRVLE--------QTNSPAKSSVHNRPSTLLRSPSHS 355          
BLAST of Asparagine rich antigen vs. TrEMBL
Match: W6UIA7 (Asparagine-rich antigen OS=Echinococcus granulosus OX=6210 GN=EGR_03885 PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.725e-13
Identity = 69/181 (38.12%), Postives = 97/181 (53.59%), Query Frame = 1
Query:  190 SRVAAQIRRNKESQTLILLQNALPICLP-----------SPNQM-LEKSIVIRIAGQTLFLLKSLDQVLGMTDWLTVPLIS------SNFLAFFTDNIGQIVYASPNIQNVLEQHHWSNLIGISIFDIMDFKSRWPT-TGDVVKLKLLANPNPTCEFKSNKPQVSSMSFSPSVLYQNCSRS 675
            SR+AA++RRN+ES  L  L  ALP+ LP           +P+++ LEKS VIR+AGQTLFL  SL QVLG      VP IS         L   TD+   +VYA+P +   +    W NLIG+ +  + D + + PT  G+ V L++L         ++N P  SS+   PS L ++ S S
Sbjct:   73 SRLAAKLRRNQESNILFCLLRALPVSLPDTAVSEGSIKTTPSKLNLEKSGVIRMAGQTLFLYNSLSQVLGTK---AVPFISLLSKSLHGLLVHPTDST--VVYATPPLAEAI-NWPWINLIGVKLESLTD-EGKMPTRAGETVNLRVLE--------QTNSPAKSSVHNRPSTLLRSPSHS 238          
BLAST of Asparagine rich antigen vs. TrEMBL
Match: A0A3P7ESY6 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS2223 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 3.342e-13
Identity = 59/159 (37.11%), Postives = 84/159 (52.83%), Query Frame = 1
Query:  190 SRVAAQIRRNKESQTLILLQNALPICLP-----------SPNQM-LEKSIVIRIAGQTLFLLKSLDQVLGMTDWLTVPLISSNFLAFF---TDNIGQIVYASPNIQNVLEQHHWSNLIGISIFDIMDFKSRWPTTGDVVKLKLLANPN-PTCEFKSNKP 618
            SR+AA++RRN+ES  L  L  ALP+ LP           +P+ + LEKS VIR+AGQTLFL  SL +VLG      + L+S +        TD+   +VYA+P +   +    W NLIG+ +  + D        G+ V L++L   N PT     N+P
Sbjct:   15 SRLAAKMRRNQESNILFCLLRALPVSLPDTAGSEGSIKTAPSGLNLEKSGVIRMAGQTLFLYNSLSRVLGTKAVPFISLLSKSLYGLLVHPTDST--VVYATPPLAEAI-NWPWINLIGVKLESLTDEGKLPERAGETVNLRVLEQTNSPTKSSVHNRP 170          
BLAST of Asparagine rich antigen vs. TrEMBL
Match: A0A0R3WN98 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 3.604e-13
Identity = 59/159 (37.11%), Postives = 84/159 (52.83%), Query Frame = 1
Query:  190 SRVAAQIRRNKESQTLILLQNALPICLP-----------SPNQM-LEKSIVIRIAGQTLFLLKSLDQVLGMTDWLTVPLISSNFLAFF---TDNIGQIVYASPNIQNVLEQHHWSNLIGISIFDIMDFKSRWPTTGDVVKLKLLANPN-PTCEFKSNKP 618
            SR+AA++RRN+ES  L  L  ALP+ LP           +P+ + LEKS VIR+AGQTLFL  SL +VLG      + L+S +        TD+   +VYA+P +   +    W NLIG+ +  + D        G+ V L++L   N PT     N+P
Sbjct:   15 SRLAAKMRRNQESNILFCLLRALPVSLPDTAGSEGSIKTAPSGLNLEKSGVIRMAGQTLFLYNSLSRVLGTKAVPFISLLSKSLYGLLVHPTDST--VVYATPPLAEAI-NWPWINLIGVKLESLTDEGKLPERAGETVNLRVLEQTNSPTKSSVHNRP 170          
BLAST of Asparagine rich antigen vs. TrEMBL
Match: A0A068XZV3 (Asparagine rich antigen OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000524800 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 6.694e-12
Identity = 65/173 (37.57%), Postives = 92/173 (53.18%), Query Frame = 1
Query:  190 SRVAAQIRRNKESQTLILLQNALPICLP-----------SPNQM-LEKSIVIRIAGQTLFLLKSLDQVLGMTDWLTVPLIS------SNFLAFFTDNIGQIVYASPNIQNVLEQHHWSNLIGISIFDIMDFKSRWPT-TGDVVKLKLLANPNPTCEFKSNKPQVSSMSFSPSV 651
            SR+AA++RRN+ES  L  L  ALP+ LP           +P+++ LEKS VIR+AGQTLFL  SL +VLG      VP IS         L   TD+   +VYA+P +   +    W NLIG+ +  + D + + PT  G+ V L++L         ++N P  SS+   PS 
Sbjct:  190 SRLAAKLRRNQESNILFCLLRALPVSLPDTAVSEGSIKTTPSKLNLEKSGVIRMAGQTLFLYNSLSRVLGTR---AVPFISLLSKSLHGLLVHPTDST--VVYATPPLAEAI-NWPWINLIGVKLESLTD-EGKMPTRAGETVNLRVLE--------QTNSPAKSSIHNHPST 347          
BLAST of Asparagine rich antigen vs. Planmine SMEST
Match: SMESG000022424.1 (SMESG000022424.1)

HSP 1 Score: 1233.39 bits (3190), Expect = 0.000e+0
Identity = 650/654 (99.39%), Postives = 653/654 (99.85%), Query Frame = 1
Query:   82 MQPKKPDAHNCMKSRFNGMNXXXXXXXXXXXXXXXXSRVAAQIRRNKESQTLILLQNALPICLPSPNQMLEKSIVIRIAGQTLFLLKSLDQVLGMTDWLTVPLISSNFLAFFTDNIGQIVYASPNIQNVLEQHHWSNLIGISIFDIMDFKSRWPTTGDVVKLKLLANPNPTCEFKSNKPQVSSMSFSPSVLYQNCSRSNIVSKINVRSNLSMINQFIPPCSIYTVWCSTNISHTNSKLKLLLLRQIQTQXXXXXXXXXXXXXXXXXXXXXXXXXTNHLVVPSSEGLPFDRSLSWPLILNQMKSEHNDPDAQFNQSKGIQKGFLVSVHDRKYQFEAVSSEFCRVVGETENDLTEQNLLDIIHIEDVIRVKSYLDSIIEKRDNNVWTPIYRILCSNERYCMVKSLAKQFSTSCSQSIILHHKIIRTDLTNEYTTKFCAYEFKKKSLPSKIFISATSSPKRKIQSVPKSTPFISSQNSSQTIFQKRKSTDQSFDSEKFSHIAENKSAFQKFFPGSNSESEKYLEKLLKPHILMTNKDLNINNSILDKDPFLPTCFERLIYKSKTDSYKTNRPKSIHINQLKLNSKSLWKDKFENESNCSASHSLESCVLTSPSPDSVGISIDDQFLWDFPDSLCELTQSNHWFDEQYQNDLELILPI 2043
            MQPKKPDAHNCMKSRFNGMNIKIAIKEKKADKRKEKSRVAAQIRRNKESQTLILLQNALPICLPSPNQMLEKSIVIRIAGQTLFLLKSLDQVLGMTDWLTVPLISSNFLAFFTDNIGQIVYASPNIQNVLEQHHWSNLIGISIFDIMDFKSRWPTTGDVVKLKLLANPNPTCEFKSNKPQVSSMSFSPSVLYQNCSRSNIVSKINV SNLSMINQFIPPCSIYTVWCSTNISHTNSKLKLLLLRQIQTQSSSVSSSSSMPSPSSSLSTSNYSESTNHLVVPSSEGLPFDRSLSWPLILNQMKSEHNDPDAQFNQSKGIQKGFLVSVHDRKYQFEAVSSEFCRVVGETENDLTEQNLLDIIHIEDVIRVKSYLDSIIEKRDNN+WTPIYRILCSNERYCMVKSLAKQFSTSCSQSIILHHKIIRTDLTNEYTTKFCAYEFKKKSLPSKIFISATSSPKRKIQSVPKSTPFISSQNSSQTIFQKRKSTDQSFDSEKFSHIAENKSAFQKFFPGSNSESEKYLEKLLKPHILMTNKDLNINNSILDKDPFLPTCFERLIYKSKTDSYKT+RPKSIHINQ+KLNSKSLWKDKFENESNCSASHSLESCVLTSPSPDSVGISIDDQFLWDFPDSLCELTQSNHWFDEQYQNDLELILPI
Sbjct:    1 MQPKKPDAHNCMKSRFNGMNIKIAIKEKKADKRKEKSRVAAQIRRNKESQTLILLQNALPICLPSPNQMLEKSIVIRIAGQTLFLLKSLDQVLGMTDWLTVPLISSNFLAFFTDNIGQIVYASPNIQNVLEQHHWSNLIGISIFDIMDFKSRWPTTGDVVKLKLLANPNPTCEFKSNKPQVSSMSFSPSVLYQNCSRSNIVSKINVLSNLSMINQFIPPCSIYTVWCSTNISHTNSKLKLLLLRQIQTQSSSVSSSSSMPSPSSSLSTSNYSESTNHLVVPSSEGLPFDRSLSWPLILNQMKSEHNDPDAQFNQSKGIQKGFLVSVHDRKYQFEAVSSEFCRVVGETENDLTEQNLLDIIHIEDVIRVKSYLDSIIEKRDNNIWTPIYRILCSNERYCMVKSLAKQFSTSCSQSIILHHKIIRTDLTNEYTTKFCAYEFKKKSLPSKIFISATSSPKRKIQSVPKSTPFISSQNSSQTIFQKRKSTDQSFDSEKFSHIAENKSAFQKFFPGSNSESEKYLEKLLKPHILMTNKDLNINNSILDKDPFLPTCFERLIYKSKTDSYKTHRPKSIHINQMKLNSKSLWKDKFENESNCSASHSLESCVLTSPSPDSVGISIDDQFLWDFPDSLCELTQSNHWFDEQYQNDLELILPI 654          
BLAST of Asparagine rich antigen vs. Planmine SMEST
Match: SMESG000022424.1 (SMESG000022424.1)

HSP 1 Score: 1208.36 bits (3125), Expect = 0.000e+0
Identity = 639/643 (99.38%), Postives = 642/643 (99.84%), Query Frame = 1
Query:  115 MKSRFNGMNXXXXXXXXXXXXXXXXSRVAAQIRRNKESQTLILLQNALPICLPSPNQMLEKSIVIRIAGQTLFLLKSLDQVLGMTDWLTVPLISSNFLAFFTDNIGQIVYASPNIQNVLEQHHWSNLIGISIFDIMDFKSRWPTTGDVVKLKLLANPNPTCEFKSNKPQVSSMSFSPSVLYQNCSRSNIVSKINVRSNLSMINQFIPPCSIYTVWCSTNISHTNSKLKLLLLRQIQTQXXXXXXXXXXXXXXXXXXXXXXXXXTNHLVVPSSEGLPFDRSLSWPLILNQMKSEHNDPDAQFNQSKGIQKGFLVSVHDRKYQFEAVSSEFCRVVGETENDLTEQNLLDIIHIEDVIRVKSYLDSIIEKRDNNVWTPIYRILCSNERYCMVKSLAKQFSTSCSQSIILHHKIIRTDLTNEYTTKFCAYEFKKKSLPSKIFISATSSPKRKIQSVPKSTPFISSQNSSQTIFQKRKSTDQSFDSEKFSHIAENKSAFQKFFPGSNSESEKYLEKLLKPHILMTNKDLNINNSILDKDPFLPTCFERLIYKSKTDSYKTNRPKSIHINQLKLNSKSLWKDKFENESNCSASHSLESCVLTSPSPDSVGISIDDQFLWDFPDSLCELTQSNHWFDEQYQNDLELILPI 2043
            MKSRFNGMNIKIAIKEKKADKRKEKSRVAAQIRRNKESQTLILLQNALPICLPSPNQMLEKSIVIRIAGQTLFLLKSLDQVLGMTDWLTVPLISSNFLAFFTDNIGQIVYASPNIQNVLEQHHWSNLIGISIFDIMDFKSRWPTTGDVVKLKLLANPNPTCEFKSNKPQVSSMSFSPSVLYQNCSRSNIVSKINV SNLSMINQFIPPCSIYTVWCSTNISHTNSKLKLLLLRQIQTQSSSVSSSSSMPSPSSSLSTSNYSESTNHLVVPSSEGLPFDRSLSWPLILNQMKSEHNDPDAQFNQSKGIQKGFLVSVHDRKYQFEAVSSEFCRVVGETENDLTEQNLLDIIHIEDVIRVKSYLDSIIEKRDNN+WTPIYRILCSNERYCMVKSLAKQFSTSCSQSIILHHKIIRTDLTNEYTTKFCAYEFKKKSLPSKIFISATSSPKRKIQSVPKSTPFISSQNSSQTIFQKRKSTDQSFDSEKFSHIAENKSAFQKFFPGSNSESEKYLEKLLKPHILMTNKDLNINNSILDKDPFLPTCFERLIYKSKTDSYKT+RPKSIHINQ+KLNSKSLWKDKFENESNCSASHSLESCVLTSPSPDSVGISIDDQFLWDFPDSLCELTQSNHWFDEQYQNDLELILPI
Sbjct:    1 MKSRFNGMNIKIAIKEKKADKRKEKSRVAAQIRRNKESQTLILLQNALPICLPSPNQMLEKSIVIRIAGQTLFLLKSLDQVLGMTDWLTVPLISSNFLAFFTDNIGQIVYASPNIQNVLEQHHWSNLIGISIFDIMDFKSRWPTTGDVVKLKLLANPNPTCEFKSNKPQVSSMSFSPSVLYQNCSRSNIVSKINVLSNLSMINQFIPPCSIYTVWCSTNISHTNSKLKLLLLRQIQTQSSSVSSSSSMPSPSSSLSTSNYSESTNHLVVPSSEGLPFDRSLSWPLILNQMKSEHNDPDAQFNQSKGIQKGFLVSVHDRKYQFEAVSSEFCRVVGETENDLTEQNLLDIIHIEDVIRVKSYLDSIIEKRDNNIWTPIYRILCSNERYCMVKSLAKQFSTSCSQSIILHHKIIRTDLTNEYTTKFCAYEFKKKSLPSKIFISATSSPKRKIQSVPKSTPFISSQNSSQTIFQKRKSTDQSFDSEKFSHIAENKSAFQKFFPGSNSESEKYLEKLLKPHILMTNKDLNINNSILDKDPFLPTCFERLIYKSKTDSYKTHRPKSIHINQMKLNSKSLWKDKFENESNCSASHSLESCVLTSPSPDSVGISIDDQFLWDFPDSLCELTQSNHWFDEQYQNDLELILPI 643          
The following BLAST results are available for this feature:
BLAST of Asparagine rich antigen vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Asparagine rich antigen vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Asparagine rich antigen vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Asparagine rich antigen vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Asparagine rich antigen vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Asparagine rich antigen vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Asparagine rich antigen vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Asparagine rich antigen vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068WT791.536e-1338.12Asparagine rich antigen OS=Echinococcus granulosus... [more]
W6UIA71.725e-1338.12Asparagine-rich antigen OS=Echinococcus granulosus... [more]
A0A3P7ESY63.342e-1337.11Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A0R3WN983.604e-1337.11Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A068XZV36.694e-1237.57Asparagine rich antigen OS=Echinococcus multilocul... [more]
back to top
BLAST of Asparagine rich antigen vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Asparagine rich antigen vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Asparagine rich antigen vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Asparagine rich antigen vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Asparagine rich antigen vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Asparagine rich antigen vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000022424.10.000e+099.39SMESG000022424.1[more]
SMESG000022424.10.000e+099.38SMESG000022424.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019453 ID=SMED30019453|Name=Asparagine rich antigen|organism=Schmidtea mediterranea sexual|type=transcript|length=2475bp
GTTTTTTCAGTGAAGATAATCTGTTAAGAGCACTAGCTATTGTGATTGTT
TAAAACCCAAATGCAGTAGTGCTCAAACGCAATGCAGCCAAAAAAACCAG
ATGCGCATAACTGCATGAAGTCCCGTTTCAATGGAATGAATATCAAAATA
GCAATAAAAGAGAAAAAAGCTGACAAAAGAAAAGAAAAATCTCGAGTTGC
CGCCCAAATTCGTAGAAATAAAGAAAGTCAAACTCTAATTCTGTTGCAAA
ATGCGTTGCCCATTTGTTTACCAAGCCCAAATCAAATGTTGGAAAAATCT
ATTGTTATTCGTATCGCTGGCCAAACTTTATTTCTTTTGAAAAGTCTTGA
TCAAGTTCTTGGAATGACCGACTGGTTAACTGTGCCACTAATAAGTTCAA
ACTTCTTGGCTTTCTTTACAGACAATATTGGTCAAATTGTTTATGCTAGT
CCAAATATTCAAAATGTCCTAGAGCAGCATCACTGGAGCAACCTCATTGG
AATTTCAATATTCGACATCATGGATTTCAAGTCAAGGTGGCCAACGACTG
GTGATGTGGTCAAGTTGAAATTGTTGGCAAATCCCAACCCTACTTGTGAA
TTTAAGTCAAATAAACCCCAAGTTTCTTCAATGTCTTTCTCGCCATCAGT
GTTATACCAAAATTGTTCTCGATCAAATATTGTATCAAAGATAAATGTTC
GTAGCAATCTATCTATGATCAACCAATTTATCCCCCCTTGCTCAATTTAT
ACTGTTTGGTGTTCCACAAATATTAGTCATACCAACTCCAAATTGAAATT
ATTATTGCTAAGGCAAATCCAAACCCAGTCATCATCAGTATCATCATCCT
CATCAATGCCATCCCCTTCATCATCATTATCCACTAGCAATTATTCAGAA
TCAACAAATCATTTGGTCGTTCCGAGCTCTGAAGGTTTACCATTCGATAG
GAGTTTAAGTTGGCCTTTAATTTTGAATCAAATGAAATCGGAACACAATG
ATCCAGATGCTCAATTCAATCAATCCAAAGGTATTCAGAAAGGATTCCTT
GTATCTGTACATGACAGAAAATATCAATTCGAAGCTGTCAGCTCAGAATT
CTGCAGAGTGGTCGGGGAAACAGAAAACGATCTTACCGAACAGAATCTGT
TGGACATCATTCATATTGAGGATGTTATCAGGGTAAAGTCATATCTAGAT
TCAATCATAGAAAAAAGAGACAACAATGTATGGACTCCGATTTATCGTAT
TTTATGCTCGAATGAGCGCTATTGTATGGTCAAATCTTTGGCAAAGCAAT
TCTCTACCAGCTGCAGTCAATCGATAATTCTTCATCATAAAATTATTAGA
ACTGATCTTACTAATGAATATACTACAAAGTTTTGTGCATATGAATTCAA
AAAGAAGTCACTTCCGTCAAAAATTTTCATATCAGCAACAAGCTCCCCCA
AAAGAAAAATTCAGTCAGTCCCAAAATCTACTCCGTTTATCAGCTCACAG
AATTCCTCACAAACAATATTTCAAAAACGAAAATCAACGGATCAAAGTTT
TGACAGTGAAAAATTTTCTCACATAGCAGAAAATAAGAGTGCTTTTCAAA
AGTTTTTCCCCGGTAGTAATTCAGAATCTGAGAAATATCTAGAGAAATTA
TTGAAACCGCATATCTTAATGACAAACAAAGATCTGAACATAAACAATTC
AATATTGGACAAAGATCCCTTTCTACCAACATGTTTTGAAAGACTAATTT
ACAAATCAAAAACTGACAGCTATAAAACCAACAGACCGAAATCTATCCAC
ATTAACCAACTCAAATTAAATTCGAAATCACTTTGGAAAGACAAATTTGA
AAATGAATCGAATTGTAGTGCTTCTCACTCTTTGGAAAGTTGTGTCCTCA
CTAGTCCCAGTCCAGATTCTGTTGGAATATCAATCGATGATCAATTTCTC
TGGGATTTTCCAGACAGCCTTTGTGAATTAACACAGTCAAATCACTGGTT
CGATGAACAATATCAAAACGATTTAGAACTTATACTTCCAATTTAGCTTA
TTTTTAAATGTTTGTAAATTAAATCCTAATATCTTTCAGTAGTGCTTATC
AACAATGTAACCGTGTGACATAAGATCTTCTGTTAATTTTTAAAACTGAT
TTAACGCTCATAGTTCACATGTTAATTTATTTTTGAAATATTTGTTAGTT
ATATTTAATTAAGAGATCTTATTTTACCTTGTTAAAATTTATTGGTTTGT
TATTTTTGTATTAGAATTTTTAAAAATCCTGATGTATATTTGTAATTTAA
TAAAACTAAATGCAATGCATGCAAAACATGTATTACTATATTGATTATTC
TGACTAATGCACATATGCAATAATTATGCACATGTCTAGCAATAAAAATT
ATCAATTTAATGTTGCTTTTGTAATTATTTGGAAATTGTAATGTAAACAT
GGATTATAAATAAATTATTAAGGCG
back to top

protein sequence of SMED30019453-orf-1

>SMED30019453-orf-1 ID=SMED30019453-orf-1|Name=SMED30019453-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=655bp
MQPKKPDAHNCMKSRFNGMNIKIAIKEKKADKRKEKSRVAAQIRRNKESQ
TLILLQNALPICLPSPNQMLEKSIVIRIAGQTLFLLKSLDQVLGMTDWLT
VPLISSNFLAFFTDNIGQIVYASPNIQNVLEQHHWSNLIGISIFDIMDFK
SRWPTTGDVVKLKLLANPNPTCEFKSNKPQVSSMSFSPSVLYQNCSRSNI
VSKINVRSNLSMINQFIPPCSIYTVWCSTNISHTNSKLKLLLLRQIQTQS
SSVSSSSSMPSPSSSLSTSNYSESTNHLVVPSSEGLPFDRSLSWPLILNQ
MKSEHNDPDAQFNQSKGIQKGFLVSVHDRKYQFEAVSSEFCRVVGETEND
LTEQNLLDIIHIEDVIRVKSYLDSIIEKRDNNVWTPIYRILCSNERYCMV
KSLAKQFSTSCSQSIILHHKIIRTDLTNEYTTKFCAYEFKKKSLPSKIFI
SATSSPKRKIQSVPKSTPFISSQNSSQTIFQKRKSTDQSFDSEKFSHIAE
NKSAFQKFFPGSNSESEKYLEKLLKPHILMTNKDLNINNSILDKDPFLPT
CFERLIYKSKTDSYKTNRPKSIHINQLKLNSKSLWKDKFENESNCSASHS
LESCVLTSPSPDSVGISIDDQFLWDFPDSLCELTQSNHWFDEQYQNDLEL
ILPI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035965PAS-like_dom_sf
IPR000014PAS
IPR013655PAS_fold_3
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000014PAS domainSMARTSM00091pas_2coord: 310..377
e-value: 2.9
score: 15.4
coord: 97..165
e-value: 6.7
score: 12.6
IPR000014PAS domainPROSITEPS50112PAScoord: 336..379
score: 8.719
IPR000014PAS domainCDDcd00130PAScoord: 324..418
e-value: 3.84186E-6
score: 43.7759
NoneNo IPR availableGENE3DG3DSA:3.30.450.20coord: 314..447
e-value: 7.5E-14
score: 53.4
IPR013655PAS fold-3PFAMPF08447PAS_3coord: 336..405
e-value: 1.6E-6
score: 28.3
IPR035965PAS domain superfamilySUPERFAMILYSSF55785PYP-like sensor domain (PAS domain)coord: 323..407