cilia- and flagella-associated protein 54-like

Overview
Namecilia- and flagella-associated protein 54-like
Smed IDSMED30019449
Length (bp)9485
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cilia- and flagella-associated protein 54-like (SMED30019449) t-SNE clustered cells

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 54-like (SMED30019449) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cilia- and flagella-associated protein 54-like (SMED30019449) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 54-like (SMED30019449) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019449

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30019449SMESG000072637.1 SmedASXL_016552SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30019449SMESG000072637.1 dd_Smed_v4_9860_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019449SMESG000072637.1 dd_Smed_v4_9860_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30019449SMESG000072637.1 dd_Smed_v6_9860_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
oocyteSMED30019449SMESG000072637.1 Contig33572newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30019449SMESG000072637.1 Contig33572uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30019449SMESG000072637.1 Contig33572newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30019449SMESG000072637.1 Contig33572uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30019449SMESG000072637.1 dd_Smed_v4_9860_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30019449SMESG000072637.1 dd_Smed_v4_9860_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30019449SMESG000072637.1 dd_Smed_v4_9860_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Human
Match: CFAP54 (cilia and flagella associated protein 54 [Source:HGNC Symbol;Acc:HGNC:26456])

HSP 1 Score: 236.113 bits (601), Expect = 4.667e-61
Identity = 178/617 (28.85%), Postives = 287/617 (46.52%), Query Frame = 1
Query:  199 LYEFLIKYENNLPQEFFYKHTMELGDVLLRHGYSLIARNQCYERYLVNVH-NLDVFHIEXXXXXXXXXXEQIHQTESIVS--AIFGLCLAEFRCMEILDKRFQANFHQRKCHCLLTIYRRLMEIILKQERFCWLIYNGSVCIYWISEALIRSGLSMMVVEPLVWASCCLETSIPLLTIFNLKWRAVIYTATCQALFNIQYDSDAEAFARRALVKINELHELYEISSDARSTENAIIFSEAVIKMGVMIFKRNAFETRRRPKTYLRPKTKVNFKEILQNNWPRTGTERILAEMFDSPSQQILAIMEAVKQPSRTIGKIEAPASENEWEMLDVYSELFYAAIAIITGRSTSVIGKSDKALVKEYRIVDVDENTDQLALSVLNGSAITIKATFELVCWAFSYGNWEFLDTILDPLLAAIKDSKSLSHKLPLENTLKLIRLMRKCFHSSVFVEKKVVKLSEQPIEDDRKQGDTQMNFRAPQXXXXXXXXXXXXXXXXXDNPPADEEEKKGKQSQDPLCQLSELLKEIIAT---DFNPGNYFQEILVEAGLILWNKCKPIFQTTQDGSLSNEPSKPIPSIGKWIRILDTAYRILSVTEYSTINPISYSEISIRLSVLLEQLS 2031
            L+    KY   LP +++ +  +++GD L +     +A  QCY RYL   + N D   +++    +    +      + ++  A+ G  +  ++ +   D+  +      +C  +L+  R +M++ L QE  CW+I+NG++ IY I   L+  G S   +E L+WAS C+E+ +PLL++  L WRA +YTA CQ  ++       EAFARRAL KI+EL +L  +SS     E+   F EA +KM VMIFKR  FE+RR+ K   RPK ++N +E+   +WPRT TER+L EMFDS + Q LA++EA+   +R I +   P   +E E+ DV SELF A   ++   +    G  D               T  L L +     I++ A  + +  AF+Y  W   ++    L+  ++       K   E  L L+  M         +  K  K    P+E+ ++   TQ+  +                         D   K    S+D +  L+  L   + T   D  P    +EI+V+  + LW KCK   Q                S  KWI +L     ++   +   I+ +  +E+++RLS +LE L 
Sbjct:  110 LFNIWTKYAPRLPADYYNEKLLKVGDSLCQMKEYKLALLQCYGRYLQQFNTNFDENKVDVTQFKATFFPKGFKDKTAGLTFHALSGKNMCNYQLVCDSDENLKNKESVVQCLHILSSLRLIMQVALPQEHLCWIIFNGTIYIYTICRKLMVIGQSSKALEYLLWASMCMESLVPLLSLRYLTWRATLYTAVCQCCYDCHAGIHGEAFARRALAKIDELRQLELMSSSKSQEESRRYFREATMKMAVMIFKRGVFESRRKNKAVFRPKIRINLREVQTLSWPRTVTERLLDEMFDSTASQFLAVLEALSDSNRRILQT-GPIVTDEVEIHDVVSELFMAGKELLIMSNIGADGMLDFP------------KTSLLELMIGRKDVISVDAAVKFIKLAFTYEEWSLFESSAVHLIYFLQRQDDPESK-KAEKDLTLLIAMEP------LINVKRNKGLIFPLENYKEGQSTQIYLKKIAVH--------------------DTCLKTCGYSED-IFHLAATLYVCVCTAPQDVQPD---KEIVVDTIMFLWQKCKLGIQRLNISRNDYAKFTQKISTNKWIYLLWQINEVIHCYKMEDIDIVVVAEVTLRLSEILESLG 682          

HSP 2 Score: 227.254 bits (578), Expect = 2.698e-58
Identity = 326/1498 (21.76%), Postives = 626/1498 (41.79%), Query Frame = 1
Query: 2593 PAPIIERKGSNYIIVKVDENVPSELKSKIGWIRLYGRAVDSPNAEVRLTDDKLPGTGVETSCLS-TKFTIYDLTVNEQYILAFSINDKFGSPIGRGIGKSTKYILAIDTINPVTAISIITQILYEMGQKEEVIWYENLLWPQFVEA-IPDCVETYQRSVLPRSSFHK--EYKIKVDVLNNSSPMLLRKFCVSVLSAIDCECRILNITNDINVKSHSQM-GDQINRLKMVDKLLALFSISKKLKDSLLTMEIFTTVACLLAPIMNQNQFFKPYFSVLSTCVNVLVGLPQTTWIKIPAALKTYIHHLSACIGFYLLKCLNNFPSYGDFSETIRQSVTLLLQMSGNAPFTVTEQEDTSGTASQIEIKSEKSQINPQKKVIV-KVNKGENSAANFSVQQVAFESFKFTLAKQGLVDHQLSGNEEPDILMAYITLLPSRHAYKEVLKFSRKNRYLQFIVEILHKAVVEGNLENSLNYYREIKEWLKKRNEAILGRSLIQLQ---SQMNRETIQTKSQNPAVISDNNLFSRSVRTDEDVEDXXXXXXXXXXXXXXLQSDKAINVLPSMSETQK-QIQEQAELKALDVLSTTFVSMYKQNLRRRRFRQLSEYERVSRIKMNCSMAMGYLAISHAKVDSLTQILNGGFRFSEVPEIEDITKFMLESTGKILPLDETPIPD---QISTVLKMTKQQTSRQTDTPR------TYRSDVNVSEKRLFVEAPKLLSQLSDAMNKAA------------LLLKRAIVLAARSKVWVLLFKACSLSWYTLSSFINTTNRLTKFLNAAKKDFPEVDWSQIQSFSMNNLFKLYSSVFFFGSQSILDMIEVLGKSNLHKISKD---------------------------------FDENFTENFILKSVHLLFETGSYEKSIHVILRFTSITNYLFVNVTHPILIESQQQLCQKAKDNQARNPDWTLQQCEQYVTDCQSKMKVDHLDSSNYQQFLNKILSGYFGRKKLYQSKSKVLRKVQQSEHEDLYVNNLLNILKSEASSNLIFSVPV------RPEVSHKEWVTYQNVRSIK--REWMELYYKRNYFDYLHSSDCITVGNNHKMNLQELLTSYKEFXXXXXXXXXXXHYSFALNAMGDLYISHLHKPSLALSAWNGSLDCLLNQK---QSVKNISQIIGIIDKDFVKCQFQ--MEKLLSKFGGIKCLVIGGLLTKVSR-LDDLTCDERLNICLNAAMFYKAIYSGSFAHPEDDMNYLVHSLYLDAANSIPLVPKXXXXXXXXXXXXEDVESQLYFLITHLVKAGYYQFSICLLSLYEHIVYTISRSSVKSIEAQMIKLEICIRLRRFSTASRLLFQLFTGDKVPQLADSRPAATVTKTPANVYDDQKQLTDEKNLIVLDKIISRRIVPSLAQRLGPTIASKISLLQALFLIELSSCVPVSPEMLDPSRYSSPLQAPVLSKKPTTKKSEPIGIQTEEESHSILDSLASNLQYSTWKD-ISLPILKGLMLHAA 6849
            P PI+  +    + +K     P   + K+ W  + G   +    +VRL ++ LP +G        + F +  L  NE+Y+ A +     G  +G  IG++TK IL    ++ +TA   +TQ+ Y++G  E      + +W  FV + + D     ++SV+  S+     + ++  D+L  +S +LL  F  ++    D + +  N+  D N+K +      QI RL   +++L    +S  L DS   ++  T    LLAPI+  N    P   +L  C+ VL GLP     K   A    I H+ AC  FY+ K L ++  Y D +  I      +L ++           +      +   K       PQ+ ++  K+N+          Q    E+    L KQ  V  +LSG E+P  L   +     + A KEV+KF +K R+L+F  +++ K + E      +     + ++LK+RNE++LG  LI+++   S +N++  ++     AV+       RS    + +       K K+  +  +  + AI+ + +    ++  +++ A+   +D L+   +S  K    R+RF +LS  E   R +MN  +A  +  +   K+   T++  G           D   F L ++G +LP  +  + +    +  +L   K++ +  +D         +  SD N+S+ +   ++       +   ++ A            L  +RA+VLA R   W LL   C   W       N T  L   L  A      VD  +    S +         F+ G++ ++DM+  L  ++  K  +D                                  D  +  +F+LKS+ +L++   +E  + + ++F ++++  +     P+L+ +Q+QL  + +  + + PD T Q C +Y  +   K+          + F+ K L       +   + + +L+ +  SE+               + +  +  VPV      R      E   Y N RSI+  R+ + L+  +       + D +   N   + +Q                        AL+++G L I    K   A   W  +LD +  +     + K     +  +        F+   E+ LS+ G   CL    +  K+++ +  L  +++ + C+ +A+ ++ +   +  HP+ +  Y  + +         L+P + +FS+     +  V + LY++I  L         + LL+LY++ V  I +   +++EA+++K+E+ I LR FS A   + Q+F G  +P    +   AT        +D  K LT ++N+  +D++ ++ +   L     P + +K + ++A F + +++ +   PE    +++          K   T KS+P  +   EE +S  D  +S    +  KD I+L +LK ++L  A
Sbjct:  908 PPPILLSRTHCSVTLK---PAPFTSEVKVSWYCILGCKAEGSYGKVRLNNNHLPNSGEAIPADGKSVFEVKGLETNEKYVFAVAAYSNNGKLVGGAIGETTKPILVYPPLSTITARMFLTQVAYQVGNYELAKKVFSPVWDYFVASPLQD-----EQSVICLSNIITITQRRLHSDILAETSSILLYLFLRNIFVTSDIKIKEENLFCD-NIKGNEIFPSQQIARLIECERVLVALELSNFLNDSSYALQAVTQCYGLLAPIIYHNIVLVPVVQILIKCIVVLQGLPSIVCSKKHTASFESIQHMIACCIFYITKILRSWREY-DLAVMIINYGKKMLDITPGCKSLFDGSNEQEEMPEEDSSKKSLKTKKPQQILLPEKINE----------QLALLETHLLKLTKQ-YVTSELSGGEDPIFLYPVVLNWSVKGAVKEVMKFKQKPRFLEFFTQVMLKCMNEEKFHLMVEVTTPVHDFLKRRNESLLG--LIKVKYKDSALNKKANKSLKFKAAVME----IGRSAEMQQRIRS-----KKKETLRDFIFKNPAISEMVAHERNRRTSVRKAAQRYLMDYLNPLILSYVK----RKRFHRLSLEEMPWRAQMNLYLAGAHFNLVLQKLWECTKMKFGTSHMMVSFRSCDPNMFSLYNSGTVLPTRKLTVENYKAMLDFLLTAKKRKANLPSDAEEFSTFINSIMSDENMSKTQTVYDSDSQSGSSAKEKDRGANLCVMDHFMKIFLYCRRAMVLAHRGGYWTLLQNCCRALW-------NFTQELQILLKQA------VDLDKTFPISQDGFLCTSVLPFYLGAELLIDMLIQLQNTSSIKPIEDKGEFSVPSCYGNIKNDNGGSSLTFEHPLDDVNVVDLKWIHDFVLKSLEVLYQVEKWETLVSLAIQFNTVSHERYTEQVTPLLVYAQRQLLLRIQ--KFKGPDITQQPCARYEAEYGEKITC--------RNFIGKQLKINSSTIEATSNCTDLLKMLISSEY---------------SRAKALVCVPVDVTDTLRCFRETLEKSKYHN-RSIRHSRKLLSLFLAQ-------TQDVLQASNQRSLKVQ------------------------ALHSLGSLLI-FAEKKRAAFKCWCQALDDIFRKPDVLHTWKEFGPSLTNVTNSHSPPGFKDYSEEFLSRVGIWGCLQGAVISAKIAQFIKSLNVEKKTDCCILSALLFQGLLRTTLPHPKAERCYAQYEI-------TQLLPGIELFSDRYRADICSVIASLYYIIRELHFVRQNLIVLPLLALYQYFVSGICQDITRNLEARILKIEVLIDLRFFSEAFYEISQIFYGKNMPCPIPAGYKATGKMKIFQSFDSGKLLTSKENIQAIDELRNKGLPAVLVTIGQPHLLNKFNFVKAYFFLSVAATINCVPE----NKF----------KTVITNKSKP-NLPNLEEIYS-KDDGSSFYNLTKLKDEITLSMLKSMLLMEA 2275          

HSP 3 Score: 55.4546 bits (132), Expect = 2.377e-6
Identity = 104/515 (20.19%), Postives = 217/515 (42.14%), Query Frame = 1
Query: 7609 IANVYDGKLNYLCKIKLLFGIIFMEKSRFATEKQELR--MKALAVLNVGLDICRSLSRRVPWIETEYFLTIGRIQRLLISSGKVSHLSTINTFLEGLRLCVLSTGHLGLKKQFFLELAITFMISSHLVGDSVEKDGEIVESTKLLFNTHQAQMLQNHKISKNEALTFKRLSWLAIKCASSVSDSIQHLNYC---KSDTSKLLSEDAQDNFPISALFDL---YGRFKLGSKRITFKNEIEEELSRMPEYKLLKDNENLDDQLDKIKPYTSRTSLSQV--LAYHEVLMKLTNNTFLTKSES----FELRVKPLTRCIFNDDQFFEKEEEINKFLFQHIPEYRGKCITLIPKDF------SNLSPTNTSEGIEELIIGNVNEEIWNTRIVEGESIETPQCLRLFTEYPKGILLSIEIPERIPLEK-SEVNETEIFMNFYESPFEF-HMESESRTMMLYAESKK------VPKSVNKSESILSGWLLISSKDIFPVYQDFRESAQLLEI-LANNPESTT 9066
            + N+Y   +  L KIK+  G    ++  +  ++++    + AL + +V L +CR+ +     +E E     G+I+R ++   K      + +  E ++L + +  + GL +  +LE+A+ +    HL    ++  G  +     L  +   +     + S N+   +  L+W+AI+ A+ VS+++  +N     K+     +++ A  N P  A  DL   Y  + L + ++ F+               L  N+++ D  D  K   ++  ++ +  L Y+  L ++ N + L  S +      L    L   ++N +    +++E++ FL + +  Y   CI   PK+         LS  +  E   +L   +  + I + + V G S     C+ +                  P+E  ++ +  E+   +Y  P +    E+E   ++LYA + K      V  S   S  + S W+ ++   +  +++     AQ+ E+ L   PE T+
Sbjct: 2543 LKNIYLPHVMLLAKIKMRIGHTVAKQVYYKNKRKDPSKWLPALHLFDVALKLCRTTAVEEHEVEAEILFQKGKIERQILMEEKSPSFQ-LESLYEAIQLSLKNDQNSGLIRDSYLEMALLYF---HLKKPKIKISGSPLTLKPPLRRSSSVK-----ETSANKFEMYSSLAWIAIRAAAQVSEAVLAINLLIGKKNTRMHKVNQVALPNIPEFAALDLLSSYTDYLLDNYQVLFQTSC----------TFLYQNDDVCDSADGRKKTQTKVDITWILLLRYYIHLQRINNLSKLLASATPVSGISLPDDTLLTSLYNSELIL-RQKEVHFFLKKFLQLYSSSCIDEFPKELLCQLENPPLSEKDLRESSAKLYRDSSVQSILSFKPVSGSS-----CVDI-----------------TPIEMVTQASNKELCFQWYIPPLDRPPKETEPMVLLLYAYNLKPLKISDVRHSTYNSTCVGSLWIPLNR--VIAIHEKLSNLAQIAELSLPAAPEITS 3013          
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Human
Match: CFAP54 (cilia and flagella associated protein 54 [Source:HGNC Symbol;Acc:HGNC:26456])

HSP 1 Score: 215.312 bits (547), Expect = 1.093e-57
Identity = 132/414 (31.88%), Postives = 204/414 (49.28%), Query Frame = 1
Query:  172 QLQKLLPNKLYEFLIKYENNLPQEFFYKHTMELGDVLLRHGY-SLIARNQCYERYLVNVHNLDVFHIEXXXXXXXXXXEQIHQTESIVSAIFGLCLAEFRCMEILDKRFQANFHQRKCHCLLTIYRRLMEIILKQERFCWLIYNGSVCIYWISEALIRSGLSMMVVEPLVWASCCLETSIPLLTIFNLKWRAVIYTATCQALFNIQYDSDAEAFARRALVKINELHELYEISSDARSTENAIIFSEAVIKMGVMIFKRNAFETRRRPKTYLRPKTKVNFKEILQNNWPRTGTERILAEMFDSPSQQILAIMEAVKQPSRTIGKIEAPASENEWEMLDVYSELFYAAIAIITGRSTSVIGKSDKALVKEYRIVDVDENTDQLALSVLNGSAITIKATFELVCWAFSYGNWEFLDT 1410
            + ++     L+    KY   LP +++ +  +++GD L +  + +L  +N C  + + +                  S E +   ES+V           +C+ IL                    R +M++ L QE  CW+I+NG++ IY I   L+  G S   +E L+WAS C+E+ +PLL++  L WRA +YTA CQ  ++       EAFARRAL KI+EL +L  +SS     E+   F EA +KM VMIFKR  FE+RR+ K   RPK ++N +E+   +WPRT TER+L EMFDS + Q LA++EA+   +R I +   P   +E E+ DV SELF A   ++   +    G  D               T  L L +     I++ A  + +  AF+Y  W   ++
Sbjct:  101 EFRRRCATSLFNIWTKYAPRLPADYYNEKLLKVGDSLCQMKFHALSGKNMCNYQLVCD------------------SDENLKNKESVV-----------QCLHILSS-----------------LRLIMQVALPQEHLCWIIFNGTIYIYTICRKLMVIGQSSKALEYLLWASMCMESLVPLLSLRYLTWRATLYTAVCQCCYDCHAGIHGEAFARRALAKIDELRQLELMSSSKSQEESRRYFREATMKMAVMIFKRGVFESRRKNKAVFRPKIRINLREVQTLSWPRTVTERLLDEMFDSTASQFLAVLEALSDSNRRILQT-GPIVTDEVEIHDVVSELFMAGKELLIMSNIGADGMLDFP------------KTSLLELMIGRKDVISVDAAVKFIKLAFTYEEWSLFES 455          
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Human
Match: CFAP54 (cilia and flagella associated protein 54 [Source:HGNC Symbol;Acc:HGNC:26456])

HSP 1 Score: 178.333 bits (451), Expect = 1.210e-43
Identity = 275/1315 (20.91%), Postives = 537/1315 (40.84%), Query Frame = 1
Query: 3241 QINRLKMVDKLLALFSISKKLKDSLLTMEIFTTVACLLAPIMNQNQFFKPYFSVLSTCVNVLVGLPQTTWIKIPAALKTYIHHLSACIGFYLLKCLNNFPSYGDFSETIRQSVTLLLQMSGNAPFTVTEQEDTSGTASQIEIKSEKSQINPQKKVIV-KVNKGENSAANFSVQQVAFESFKFTLAKQGLVDHQLSGNEEPDILMAYITLLPSRHAYKEVLKFSRKNRYLQFIVEILHKAVVEGNLENSLNYYREIKEWLKKRNEAILGRSLIQLQ---SQMNRETIQTKSQNPAVISDNNLFSRSVRTDEDVEDXXXXXXXXXXXXXXLQSDKAINVLPSMSETQK-QIQEQAELKALDVLSTTFVSMYKQNLRRRRFRQLSEYERVSRIKMNCSMAMGYLAISHAKVDSLTQILNGGFRFSEVPEIEDITKFMLESTGKILPLDETPIPD---QISTVLKMTKQQTSRQTDTPR------TYRSDVNVSEKRLFVEAPKLLSQLSDAMNKAA------------LLLKRAIVLAARSKVWVLLFKACSLSWYTLSSFINTTNRLTKFLNAAKKDFPEVDWSQIQSFSMNNLFKLYSSVFFFGSQSILDMIEVLGKSNLHKISKD---------------------------------FDENFTENFILKSVHLLFETGSYEKSIHVILRFTSITNYLFVNVTHPILIESQQQLCQKAKDNQARNPDWTLQQCEQYVTDCQSKMKVDHL-------------DSSNYQQFLNKILSGYFGRKK----LYQSKSKVLRKVQQSEHEDLYVN-------NLLNILKSE----------------------ASSNLIFSVPVRPEVSHKEWVTYQNVRSIKREWMELYYKRNYFDYLHSSDCITVGNNHKMNLQELLTSYKEFXXXXXXXXXXXHYSFALNAMGDLYISHLHKPSLALSAWNGSLDCLLNQK---QSVKNISQIIGIIDKDFVKCQFQ--MEKLLSKFGGIKCLVIGGLLTKVSR-LDDLTCDERLNICLNAAMFYKAIYSGSFAHPEDDMNYLVHSLYLDAANSIPLVPKXXXXXXXXXXXXEDVESQLYFLITHLVKAGYYQFSICLLSLYEHIVYTISRSSVKSIEAQMIKLEICIRLRRFSTASRLLFQLFTGDKVPQLADSRPAATVTKTPANVYDDQKQLTDEKNLIVLDKIISRRIVPSLAQRLGPTIASKISLLQALFLIELSSCVPVSPEMLDPSRYSSPLQAPVLSKKPTTKKSEPIGIQTEEESHSILDSLASNLQYSTWKD-ISLPILKGLMLHAA 6849
            QI RL   +++L    +S  L DS   ++  T    LLAPI+  N    P   +L  C+ VL GLP     K   A    I H+ AC  FY+ K L ++  Y D +  I      +L ++           +      +   K       PQ+ ++  K+N+          Q    E+    L KQ  V  +LSG E+P  L   +     + A KEV+KF +K R+L+F  +++ K + E      +     + ++LK+RNE++LG  LI+++   S +N++  ++     AV+       RS    + +       K K+  +  +  + AI+ + +    ++  +++ A+   +D L+   +S  K    R+RF +LS  E   R +MN  +A  +  +   K+   T++  G           D   F L ++G +LP  +  + +    +  +L   K++ +  +D         +  SD N+S+ +   ++       +   ++ A            L  +RA+VLA R   W LL   C   W       N T  L   L  A      VD  +    S +         F+ G++ ++DM+  L  ++  K  +D                                  D  +  +F+LKS+ +L++   +E  + + ++F ++++  +     P+L+ +Q+QL  + +  + + PD T Q C +Y  +   K+   +               +SN    L  ++S  + R K    +    +  LR  +++  +  Y N        LL++  ++                       +  +  S+P  P++S + +  + +V   K  + +L    +   Y  + D +   N   + +Q                        AL+++G L I    K   A   W  +LD +  +     + K     +  +        F+   E+ LS+ G   CL    +  K+++ +  L  +++ + C+ +A+ ++ +   +  HP+ +  Y  + +         L+P + +FS+     +  V + LY++I  L         + LL+LY++ V  I +   +++EA+++K+E+ I LR FS A   + Q+F G  +P    +   AT        +D  K LT ++N+  +D++ ++ +   L     P + +K + ++A F + +++ +   PE    +++          K   T KS+P  +   EE +S  D  +S    +  KD I+L +LK ++L  A
Sbjct:   26 QIARLIECERVLVALELSNFLNDSSYALQAVTQCYGLLAPIIYHNIVLVPVVQILIKCIVVLQGLPSIVCSKKHTASFESIQHMIACCIFYITKILRSWREY-DLAVMIINYGKKMLDITPGCKSLFDGSNEQEEMPEEDSSKKSLKTKKPQQILLPEKINE----------QLALLETHLLKLTKQ-YVTSELSGGEDPIFLYPVVLNWSVKGAVKEVMKFKQKPRFLEFFTQVMLKCMNEEKFHLMVEVTTPVHDFLKRRNESLLG--LIKVKYKDSALNKKANKSLKFKAAVME----IGRSAEMQQRIRS-----KKKETLRDFIFKNPAISEMVAHERNRRTSVRKAAQRYLMDYLNPLILSYVK----RKRFHRLSLEEMPWRAQMNLYLAGAHFNLVLQKLWECTKMKFGTSHMMVSFRSCDPNMFSLYNSGTVLPTRKLTVENYKAMLDFLLTAKKRKANLPSDAEEFSTFINSIMSDENMSKTQTVYDSDSQSGSSAKEKDRGANLCVMDHFMKIFLYCRRAMVLAHRGGYWTLLQNCCRALW-------NFTQELQILLKQA------VDLDKTFPISQDGFLCTSVLPFYLGAELLIDMLIQLQNTSSIKPIEDKGEFSVPSCYGNIKNDNGGSSLTFEHPLDDVNVVDLKWIHDFVLKSLEVLYQVEKWETLVSLAIQFNTVSHERYTEQVTPLLVYAQRQLLLRIQ--KFKGPDITQQPCARYEAEYGEKITCRNFIGKQLKINSSTIEATSNCTDLLKMLISSEYSRAKALVCVPVDVTDTLRCFRETLEKSKYHNRSIRHSRKLLSLFLAQTQGEKGEINDSKCTSGKVEFCLGTEEMHMSIP--PDLSQEHFRVFSSVEKSKLPYSQLGLVIS--SYHQTIDVLQASNQRSLKVQ------------------------ALHSLGSLLI-FAEKKRAAFKCWCQALDDIFRKPDVLHTWKEFGPSLTNVTNSHSPPGFKDYSEEFLSRVGIWGCLQGAVISAKIAQFIKSLNVEKKTDCCILSALLFQGLLRTTLPHPKAERCYAQYEI-------TQLLPGIELFSDRYRADICSVIASLYYIIRELHFVRQNLIVLPLLALYQYFVSGICQDITRNLEARILKIEVLIDLRFFSEAFYEISQIFYGKNMPCPIPAGYKATGKMKIFQSFDSGKLLTSKENIQAIDELRNKGLPAVLVTIGQPHLLNKFNFVKAYFFLSVAATINCVPE----NKF----------KTVITNKSKP-NLPNLEEIYS-KDDGSSFYNLTKLKDEITLSMLKSMLLMEA 1246          

HSP 2 Score: 55.0694 bits (131), Expect = 3.419e-6
Identity = 104/515 (20.19%), Postives = 217/515 (42.14%), Query Frame = 1
Query: 7609 IANVYDGKLNYLCKIKLLFGIIFMEKSRFATEKQELR--MKALAVLNVGLDICRSLSRRVPWIETEYFLTIGRIQRLLISSGKVSHLSTINTFLEGLRLCVLSTGHLGLKKQFFLELAITFMISSHLVGDSVEKDGEIVESTKLLFNTHQAQMLQNHKISKNEALTFKRLSWLAIKCASSVSDSIQHLNYC---KSDTSKLLSEDAQDNFPISALFDL---YGRFKLGSKRITFKNEIEEELSRMPEYKLLKDNENLDDQLDKIKPYTSRTSLSQV--LAYHEVLMKLTNNTFLTKSES----FELRVKPLTRCIFNDDQFFEKEEEINKFLFQHIPEYRGKCITLIPKDF------SNLSPTNTSEGIEELIIGNVNEEIWNTRIVEGESIETPQCLRLFTEYPKGILLSIEIPERIPLEK-SEVNETEIFMNFYESPFEF-HMESESRTMMLYAESKK------VPKSVNKSESILSGWLLISSKDIFPVYQDFRESAQLLEI-LANNPESTT 9066
            + N+Y   +  L KIK+  G    ++  +  ++++    + AL + +V L +CR+ +     +E E     G+I+R ++   K      + +  E ++L + +  + GL +  +LE+A+ +    HL    ++  G  +     L  +   +     + S N+   +  L+W+AI+ A+ VS+++  +N     K+     +++ A  N P  A  DL   Y  + L + ++ F+               L  N+++ D  D  K   ++  ++ +  L Y+  L ++ N + L  S +      L    L   ++N +    +++E++ FL + +  Y   CI   PK+         LS  +  E   +L   +  + I + + V G S     C+ +                  P+E  ++ +  E+   +Y  P +    E+E   ++LYA + K      V  S   S  + S W+ ++   +  +++     AQ+ E+ L   PE T+
Sbjct: 1514 LKNIYLPHVMLLAKIKMRIGHTVAKQVYYKNKRKDPSKWLPALHLFDVALKLCRTTAVEEHEVEAEILFQKGKIERQILMEEKSPSFQ-LESLYEAIQLSLKNDQNSGLIRDSYLEMALLYF---HLKKPKIKISGSPLTLKPPLRRSSSVK-----ETSANKFEMYSSLAWIAIRAAAQVSEAVLAINLLIGKKNTRMHKVNQVALPNIPEFAALDLLSSYTDYLLDNYQVLFQTSC----------TFLYQNDDVCDSADGRKKTQTKVDITWILLLRYYIHLQRINNLSKLLASATPVSGISLPDDTLLTSLYNSELIL-RQKEVHFFLKKFLQLYSSSCIDEFPKELLCQLENPPLSEKDLRESSAKLYRDSSVQSILSFKPVSGSS-----CVDI-----------------TPIEMVTQASNKELCFQWYIPPLDRPPKETEPMVLLLYAYNLKPLKISDVRHSTYNSTCVGSLWIPLNR--VIAIHEKLSNLAQIAELSLPAAPEITS 1984          
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Human
Match: CFAP54 (cilia and flagella associated protein 54 [Source:HGNC Symbol;Acc:HGNC:26456])

HSP 1 Score: 54.299 bits (129), Expect = 1.549e-6
Identity = 61/245 (24.90%), Postives = 117/245 (47.76%), Query Frame = 1
Query: 3754 QQVAFESFKFTLAKQGLVDHQLSGNEEPDILMAYITLLPSRHAYKEVLKFSRKNRYLQFIVEILHKAVVEGNLENSLNYYREIKEWLKKRNEAILGRSLIQLQ---SQMNRETIQTKSQNPAVISDNNLFSRSVRTDEDVEDXXXXXXXXXXXXXXLQSDKAINVLPSMSETQK-QIQEQAELKALDVLSTTFVSMYKQNLRRRRFRQLSEYERVSRIKMNCSMAMGYLAISHAKVDSLTQILNG 4476
            Q    E+    L KQ  V  +LSG E+P  L   +     + A KEV+KF +K R+L+F  +++ K + E      +     + ++LK+RNE++LG  LI+++   S +N++  ++     AV+       RS    + +       K K+  +  +  + AI+ + +    ++  +++ A+   +D L+   +S  K    R+RF +LS  E   R +MN  +A  +  +   K+   T++  G
Sbjct:   28 QLALLETHLLKLTKQ-YVTSELSGGEDPIFLYPVVLNWSVKGAVKEVMKFKQKPRFLEFFTQVMLKCMNEEKFHLMVEVTTPVHDFLKRRNESLLG--LIKVKYKDSALNKKANKSLKFKAAVME----IGRSAEMQQRIRS-----KKKETLRDFIFKNPAISEMVAHERNRRTSVRKAAQRYLMDYLNPLILSYVK----RKRFHRLSLEEMPWRAQMNLYLAGAHFNLVLQKLWECTKMKFG 256          
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Xenopus
Match: ppm1e (protein phosphatase, Mg2+/Mn2+ dependent 1E [Source:Xenbase;Acc:XB-GENE-877220])

HSP 1 Score: 238.81 bits (608), Expect = 2.341e-68
Identity = 130/347 (37.46%), Postives = 200/347 (57.64%), Query Frame = 1
Query:  193 NKLYEFLIKYENNLPQEFFYKHTMELGDVLLRHGYSLIARNQCYERYLVNVHNLDVFHIEXXXXXXXXXXEQIHQTES---IVSAIFGLCLAEFRCMEILDKRFQANFHQRKCHCLLTIYRRLMEIILKQERFCWLIYNGSVCIYWISEALIRSGLSMMVVEPLVWASCCLETSIPLLTIFNLKWRAVIYTATCQALFNIQYDSDAEAFARRALVKINELHELYEISSDARSTENAIIFSEAVIKMGVMIFKRNAFETRRRPKTYLRPKTKVNFKEILQNNWPRTGTERILAEMFDSPSQQILAIMEAVKQPSRTIGKIEAPASENEWEMLDVYSELFYAAIAIITG 1224
              L+   +KY+  LP  ++ +  + +GD L+      +A  QCY RYL    + ++  I                 ++      A+ G C+  ++ +++ D   Q     +KC  +L+  + +M+++L QE+ CWLI+NGS+ IY I   L+  G S   +E L+WAS C+E+S+PLL+I  L WRA +YTA CQ  ++ Q     E FARRAL KINEL +L  IS+ + S E   +F+EA  K+ VMIFKR  FE+RR+PK  LRPK K N K++    WPRT TE++L EMF++ + Q LAI+EA+   +R + +   P   +E E+ DV +ELF+A   +++G
Sbjct:   52 GTLFRIWVKYKPRLPTWYYQEKLLNVGDSLVLMKQYKLALFQCYGRYLEQFCSEEIDEITDVTQFKSTFFPDGTDNKNASLTFHALQGRCICLYQLVKMSDVNLQNPESLKKCVSILSFLQLIMQVVLPQEQLCWLIFNGSIHIYTICRHLMVLGYSSKALEYLLWASVCMESSVPLLSIHYLSWRATLYTAVCQCYYDCQAGVHGEVFARRALSKINELSQLENISNSSGSEEAKKVFTEATAKIAVMIFKRAVFESRRKPKGMLRPKQKSNLKDL---PWPRTNTEKLLVEMFNNGAVQFLAIIEALSDSNRRVLQ-GGPPVPDEPEIHDVIAELFFAGTDLVSG 394          
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Mouse
Match: Cfap54 (cilia and flagella associated protein 54 [Source:MGI Symbol;Acc:MGI:1922208])

HSP 1 Score: 229.18 bits (583), Expect = 3.039e-61
Identity = 146/416 (35.10%), Postives = 214/416 (51.44%), Query Frame = 1
Query:  199 LYEFLIKYENNLPQEFFYKHTMELGDVLLRHGYSLIARNQCYERYL------VNVHNLDVFHIEXXXXXXXXXXEQIHQTESIVSAIFGLCLAEFRCMEILDKRFQANFHQRKCHCLLTIYRRLMEIILKQERFCWLIYNGSVCIYWISEALIRSGLSMMVVEPLVWASCCLETSIPLLTIFNLKWRAVIYTATCQALFNIQYDSDAEAFARRALVKINELHELYEISSDARSTENAIIFSEAVIKMGVMIFKRNAFETRRRPKTYLRPKTKVNFKEILQNNWPRTGTERILAEMFDSPSQQILAIMEAVKQPSRTIGKIEAPASENEWEMLDVYSELFYAAIAIITGRSTSVIGKSDKALVKEYRIVDVDENTDQLALSVLNGSAITIKATFELVCWAFSYGNWEFLDTILDPLL 1428
            L+    KY   LP  ++ +  +++GD L +     +A  QCY RYL       + H  DV H +          E    T   +S    +C  +  C    D   Q     R+C  +L+ +R +M++ L QE  CW+I+NG++ IY I   L+  G S   +E L+WAS C+E+S+PLL+I  L WRA +YTA CQ  ++ Q     EAFARRAL KI+EL +L  +SS +    +   + EA IKM VMIFKR  FE+RR+ K  LRPK ++N KE     WPRT TER+L E+ DS S + LA++EA+   +R I +   P   +E E+ DV SELF A   ++   +    GK D               T  L   V   +A+++ A+      AF+Y  W   +++   L+
Sbjct:  115 LFNIWTKYAPRLPSNYYNEKLLKVGDSLCQIKEYKLALLQCYGRYLQEFIADFDEHKEDVNHFKTVFFPKGFGDETARLTFHALSGK-NICNYQLVCES--DANLQNEESVRQCLHILSSFRLIMQVALPQEHLCWIIFNGTLYIYTICRKLMVIGQSSKALEFLLWASMCMESSVPLLSIRYLTWRATLYTAVCQCHYDCQDGIHGEAFARRALAKIDELRQLELMSSSSSLETSRKYYREATIKMAVMIFKRGVFESRRKNKNVLRPKLRLNLKEAQSLPWPRTVTERLLDELLDSTSSRFLAVLEALSDSNRRILQT-GPLVTDEMELRDVVSELFMAGKELLILSNVRSNGKLDFP------------QTSLLEHVVEKRNALSVGASVRFAKLAFTYEEWGLFESLAGQLI 514          
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Mouse
Match: Cfap54 (cilia and flagella associated protein 54 [Source:MGI Symbol;Acc:MGI:1922208])

HSP 1 Score: 230.72 bits (587), Expect = 1.726e-59
Identity = 146/416 (35.10%), Postives = 214/416 (51.44%), Query Frame = 1
Query:  199 LYEFLIKYENNLPQEFFYKHTMELGDVLLRHGYSLIARNQCYERYL------VNVHNLDVFHIEXXXXXXXXXXEQIHQTESIVSAIFGLCLAEFRCMEILDKRFQANFHQRKCHCLLTIYRRLMEIILKQERFCWLIYNGSVCIYWISEALIRSGLSMMVVEPLVWASCCLETSIPLLTIFNLKWRAVIYTATCQALFNIQYDSDAEAFARRALVKINELHELYEISSDARSTENAIIFSEAVIKMGVMIFKRNAFETRRRPKTYLRPKTKVNFKEILQNNWPRTGTERILAEMFDSPSQQILAIMEAVKQPSRTIGKIEAPASENEWEMLDVYSELFYAAIAIITGRSTSVIGKSDKALVKEYRIVDVDENTDQLALSVLNGSAITIKATFELVCWAFSYGNWEFLDTILDPLL 1428
            L+    KY   LP  ++ +  +++GD L +     +A  QCY RYL       + H  DV H +          E    T   +S    +C  +  C    D   Q     R+C  +L+ +R +M++ L QE  CW+I+NG++ IY I   L+  G S   +E L+WAS C+E+S+PLL+I  L WRA +YTA CQ  ++ Q     EAFARRAL KI+EL +L  +SS +    +   + EA IKM VMIFKR  FE+RR+ K  LRPK ++N KE     WPRT TER+L E+ DS S + LA++EA+   +R I +   P   +E E+ DV SELF A   ++   +    GK D               T  L   V   +A+++ A+      AF+Y  W   +++   L+
Sbjct:  115 LFNIWTKYAPRLPSNYYNEKLLKVGDSLCQIKEYKLALLQCYGRYLQEFIADFDEHKEDVNHFKTVFFPKGFGDETARLTFHALSGK-NICNYQLVCES--DANLQNEESVRQCLHILSSFRLIMQVALPQEHLCWIIFNGTLYIYTICRKLMVIGQSSKALEFLLWASMCMESSVPLLSIRYLTWRATLYTAVCQCHYDCQDGIHGEAFARRALAKIDELRQLELMSSSSSLETSRKYYREATIKMAVMIFKRGVFESRRKNKNVLRPKLRLNLKEAQSLPWPRTVTERLLDELLDSTSSRFLAVLEALSDSNRRILQT-GPLVTDEMELRDVVSELFMAGKELLILSNVRSNGKLDFP------------QTSLLEHVVEKRNALSVGASVRFAKLAFTYEEWGLFESLAGQLI 514          

HSP 2 Score: 146.362 bits (368), Expect = 5.110e-34
Identity = 170/689 (24.67%), Postives = 305/689 (44.27%), Query Frame = 1
Query: 2593 PAPIIERKGSNYIIVKVDENVPSELKSKIGWIRLYGRAVDSPNAEVRLTDDKLPGTGVETSCLSTKF-TIYDLTVNEQYILAFSINDKFGSPIGRGIGKSTKYILAIDTINPVTAISIITQILYEMGQKEEVIWYENLLWPQFVEA-IPDCVETYQRSVLPRSSFHK--EYKIKVDVLNNSSPMLLRKFCVSVLSAIDCECRILNITNDINVKSHSQM-GDQINRLKMVDKLLALFSISKKLKDSLLTMEIFTTVACLLAPIMNQNQFFKPYFSVLSTCVNVLVGLPQTTWIKIPAALKTYIHHLSACIGFYLLKCLNNFPSYGDFSETIRQSVTLLLQMSGNAPFTVTEQEDTS--GTASQIEIKSEKSQINPQKKVIVKVNKGENSAANFSVQQVAFESFKFTLAKQGLVDHQLSGNEEPDILMAYITLLPSRHAYKEVLKFSRKNRYLQFIVEILHKAVVEGNLENSLNYYREIKEWLKKRNEAILGRSLIQL-QSQMNRETIQTKSQNPAVISDNNLFSRSVRTDEDVEDXXXXXXXXXXXXXXLQSDKAINVLPSMSETQKQIQEQAELKALDVLSTTFVSMYKQNLRRRRFRQLSEYERVSRIKMNCSMAMGYLAISHAKVDSLTQILNGGFRFSEVPEIEDITKFMLESTGKILPLDETPIP--DQISTVLKMTKQQTSRQT 4629
            P PI+  +    + +K    + SE+K+   W  + G   D    +VRL ++ LP +G         F  I  L  N QY  A +     G  IG  IG++TK IL    ++ VTA   +TQ+ Y++G  E      + +W  FV + +PD     ++SV+  S+     + ++  ++L ++S +LL  F  ++    D + +  N+  D N+K +      Q+ RL   + +L    +S  L D+   ++  T    LLAPI+  N    P   +L  C+ VL G+P     K   +    I H+ AC  FY+ K L ++  Y      I     +L   SG       EQE+T+  G  S+   +++K Q   Q  +  K+N+          Q    E+      KQ +   +LSG+E+P  L   +     + A KEV+KF ++ R+L+F  +I+ K + +      +     + ++LK+RNE+++G   I+  ++ ++R  +++ S+  A++         +   +  + ++R  K KK  K     + +I     M+E  +  +      A   LS     +    +RR+RF Q+   E   R +MN  +A  +  +   K+   T+   G    S      D   F L  +G +LP  +  +   + +   L ++K++   QT
Sbjct:  912 PPPILLARTHCSVTLKPAPFI-SEVKA--SWYCILGCKADGSYGKVRLNNNHLPNSGEAIPADGRSFFEIKGLETNAQYCFAIAAYSSSGKLIGDAIGETTKPILIYPPLSAVTARMYLTQVAYQIGNYEMAKKVFSPVWDYFVASPLPD-----EQSVICLSNIMTITQKRLHSNILADTSSILLYLFLRNIFVMSDIKIKEENLFCD-NIKGNEIFPAQQVARLVECENVLVALELSNFLNDANFALQAVTQCYGLLAPIIYHNIVLVPVIQILIKCIVVLQGIPSIIHSKKNISSFESIQHMIACCIFYMTKILRSWKEYDLAIMLINYGKKMLDITSGCRSLFGIEQEETAEEGVCSKKTSRTKKPQ---QVLLPEKINE----------QLALLETHLLKTTKQ-INSAELSGSEDPIFLYPIVLNWTVKGAMKEVMKFKQRPRFLEFFTQIMLKCMNDEKFHLMVEISAPVYDFLKRRNESLIGVKRIKYKETVISRRALKSPSKFKAIV---------IEIGKSSDLTRRRRKKKKTLKDFFYKNPSIF---DMAELDRNKRTDVRKMAYRSLSDNLNPLILTYVRRKRFHQILLEELPWRAQMNLYLANAHFHLFLQKLTERTKERLGSSYSSVSFRSCDPNLFSLFHSGTVLPTAKLTVDSYNAMMDALTVSKKKKHNQT 1565          

HSP 3 Score: 97.0561 bits (240), Expect = 4.278e-19
Identity = 84/306 (27.45%), Postives = 150/306 (49.02%), Query Frame = 1
Query: 5905 EKLLSKFGGIKCLVIGGLLTKVSR-LDDLTCDERLNICLNAAMFYKAIYSGSFAHPEDDMNYLVHSLYLDAANSIPLVPKXXXXXXXXXXXXEDVESQLYFLITHLVKAGYYQFSICLLSLYEHIVYTISRSSVKSIEAQMIKLEICIRLRRFSTASRLLFQLFTGDKVPQLADSRPAATVTKTPANVYDDQKQLTDEKNLIVLDKIISRRIVPSLAQRLG-PTIASKISLLQALFLIELSSCVPVSPEMLDPSRYSSPLQAPVLSKKPTTKKSEPIGIQTEEESHSILDSLASNLQYSTWKDISL 6816
            E+ LSKFG   CL    +  K+++ +      +R+N C+ +A+ ++++   +  HP+ + NY  + +         L+P + +FS+     +  V + LY++I  L  A Y    + LL+LY++ V  I +  V+++EA+++K+EI I L  FS A   LFQ++ G  +P    +   AT+       +D  K LT + N+  L+++I+R + P +   LG   + +K +  ++ F I L++ +   P   DPS      Q      KPT     P  ++  E SH     L  +   +T K I L
Sbjct: 2055 EEFLSKFGIWGCLQAAMITAKIAQFIKTANVKKRINCCILSALLFQSLLRTTLPHPKAERNYAQYEI-------TQLLPGIELFSDKFRADICSVIASLYYVIRELHYAKYNLIVLPLLALYQYFVSVICQDIVRNLEARILKIEILIDLGFFSEAFYELFQIYHGKNMPCAIPAGYKATMKVKITQSFDSGKPLTHKDNMQALEELINRGL-PHILVNLGYQHLLNKFNFAKSHFFISLAATINCIP---DPSPKIMYYQFITERSKPT-----PQNLKDNENSHGQFLRLRDDYNLNTIKSILL 2344          
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Mouse
Match: Cfap54 (cilia and flagella associated protein 54 [Source:MGI Symbol;Acc:MGI:1922208])

HSP 1 Score: 230.335 bits (586), Expect = 2.291e-59
Identity = 146/416 (35.10%), Postives = 214/416 (51.44%), Query Frame = 1
Query:  199 LYEFLIKYENNLPQEFFYKHTMELGDVLLRHGYSLIARNQCYERYL------VNVHNLDVFHIEXXXXXXXXXXEQIHQTESIVSAIFGLCLAEFRCMEILDKRFQANFHQRKCHCLLTIYRRLMEIILKQERFCWLIYNGSVCIYWISEALIRSGLSMMVVEPLVWASCCLETSIPLLTIFNLKWRAVIYTATCQALFNIQYDSDAEAFARRALVKINELHELYEISSDARSTENAIIFSEAVIKMGVMIFKRNAFETRRRPKTYLRPKTKVNFKEILQNNWPRTGTERILAEMFDSPSQQILAIMEAVKQPSRTIGKIEAPASENEWEMLDVYSELFYAAIAIITGRSTSVIGKSDKALVKEYRIVDVDENTDQLALSVLNGSAITIKATFELVCWAFSYGNWEFLDTILDPLL 1428
            L+    KY   LP  ++ +  +++GD L +     +A  QCY RYL       + H  DV H +          E    T   +S    +C  +  C    D   Q     R+C  +L+ +R +M++ L QE  CW+I+NG++ IY I   L+  G S   +E L+WAS C+E+S+PLL+I  L WRA +YTA CQ  ++ Q     EAFARRAL KI+EL +L  +SS +    +   + EA IKM VMIFKR  FE+RR+ K  LRPK ++N KE     WPRT TER+L E+ DS S + LA++EA+   +R I +   P   +E E+ DV SELF A   ++   +    GK D               T  L   V   +A+++ A+      AF+Y  W   +++   L+
Sbjct:  115 LFNIWTKYAPRLPSNYYNEKLLKVGDSLCQIKEYKLALLQCYGRYLQEFIADFDEHKEDVNHFKTVFFPKGFGDETARLTFHALSGK-NICNYQLVCES--DANLQNEESVRQCLHILSSFRLIMQVALPQEHLCWIIFNGTLYIYTICRKLMVIGQSSKALEFLLWASMCMESSVPLLSIRYLTWRATLYTAVCQCHYDCQDGIHGEAFARRALAKIDELRQLELMSSSSSLETSRKYYREATIKMAVMIFKRGVFESRRKNKNVLRPKLRLNLKEAQSLPWPRTVTERLLDELLDSTSSRFLAVLEALSDSNRRILQT-GPLVTDEMELRDVVSELFMAGKELLILSNVRSNGKLDFP------------QTSLLEHVVEKRNALSVGASVRFAKLAFTYEEWGLFESLAGQLI 514          

HSP 2 Score: 146.362 bits (368), Expect = 5.527e-34
Identity = 170/689 (24.67%), Postives = 305/689 (44.27%), Query Frame = 1
Query: 2593 PAPIIERKGSNYIIVKVDENVPSELKSKIGWIRLYGRAVDSPNAEVRLTDDKLPGTGVETSCLSTKF-TIYDLTVNEQYILAFSINDKFGSPIGRGIGKSTKYILAIDTINPVTAISIITQILYEMGQKEEVIWYENLLWPQFVEA-IPDCVETYQRSVLPRSSFHK--EYKIKVDVLNNSSPMLLRKFCVSVLSAIDCECRILNITNDINVKSHSQM-GDQINRLKMVDKLLALFSISKKLKDSLLTMEIFTTVACLLAPIMNQNQFFKPYFSVLSTCVNVLVGLPQTTWIKIPAALKTYIHHLSACIGFYLLKCLNNFPSYGDFSETIRQSVTLLLQMSGNAPFTVTEQEDTS--GTASQIEIKSEKSQINPQKKVIVKVNKGENSAANFSVQQVAFESFKFTLAKQGLVDHQLSGNEEPDILMAYITLLPSRHAYKEVLKFSRKNRYLQFIVEILHKAVVEGNLENSLNYYREIKEWLKKRNEAILGRSLIQL-QSQMNRETIQTKSQNPAVISDNNLFSRSVRTDEDVEDXXXXXXXXXXXXXXLQSDKAINVLPSMSETQKQIQEQAELKALDVLSTTFVSMYKQNLRRRRFRQLSEYERVSRIKMNCSMAMGYLAISHAKVDSLTQILNGGFRFSEVPEIEDITKFMLESTGKILPLDETPIP--DQISTVLKMTKQQTSRQT 4629
            P PI+  +    + +K    + SE+K+   W  + G   D    +VRL ++ LP +G         F  I  L  N QY  A +     G  IG  IG++TK IL    ++ VTA   +TQ+ Y++G  E      + +W  FV + +PD     ++SV+  S+     + ++  ++L ++S +LL  F  ++    D + +  N+  D N+K +      Q+ RL   + +L    +S  L D+   ++  T    LLAPI+  N    P   +L  C+ VL G+P     K   +    I H+ AC  FY+ K L ++  Y      I     +L   SG       EQE+T+  G  S+   +++K Q   Q  +  K+N+          Q    E+      KQ +   +LSG+E+P  L   +     + A KEV+KF ++ R+L+F  +I+ K + +      +     + ++LK+RNE+++G   I+  ++ ++R  +++ S+  A++         +   +  + ++R  K KK  K     + +I     M+E  +  +      A   LS     +    +RR+RF Q+   E   R +MN  +A  +  +   K+   T+   G    S      D   F L  +G +LP  +  +   + +   L ++K++   QT
Sbjct:  912 PPPILLARTHCSVTLKPAPFI-SEVKA--SWYCILGCKADGSYGKVRLNNNHLPNSGEAIPADGRSFFEIKGLETNAQYCFAIAAYSSSGKLIGDAIGETTKPILIYPPLSAVTARMYLTQVAYQIGNYEMAKKVFSPVWDYFVASPLPD-----EQSVICLSNIMTITQKRLHSNILADTSSILLYLFLRNIFVMSDIKIKEENLFCD-NIKGNEIFPAQQVARLVECENVLVALELSNFLNDANFALQAVTQCYGLLAPIIYHNIVLVPVIQILIKCIVVLQGIPSIIHSKKNISSFESIQHMIACCIFYMTKILRSWKEYDLAIMLINYGKKMLDITSGCRSLFGIEQEETAEEGVCSKKTSRTKKPQ---QVLLPEKINE----------QLALLETHLLKTTKQ-INSAELSGSEDPIFLYPIVLNWTVKGAMKEVMKFKQRPRFLEFFTQIMLKCMNDEKFHLMVEISAPVYDFLKRRNESLIGVKRIKYKETVISRRALKSPSKFKAIV---------IEIGKSSDLTRRRRKKKKTLKDFFYKNPSIF---DMAELDRNKRTDVRKMAYRSLSDNLNPLILTYVRRKRFHQILLEELPWRAQMNLYLANAHFHLFLQKLTERTKERLGSSYSSVSFRSCDPNLFSLFHSGTVLPTAKLTVDSYNAMMDALTVSKKKKHNQT 1565          

HSP 3 Score: 97.0561 bits (240), Expect = 4.676e-19
Identity = 84/306 (27.45%), Postives = 150/306 (49.02%), Query Frame = 1
Query: 5905 EKLLSKFGGIKCLVIGGLLTKVSR-LDDLTCDERLNICLNAAMFYKAIYSGSFAHPEDDMNYLVHSLYLDAANSIPLVPKXXXXXXXXXXXXEDVESQLYFLITHLVKAGYYQFSICLLSLYEHIVYTISRSSVKSIEAQMIKLEICIRLRRFSTASRLLFQLFTGDKVPQLADSRPAATVTKTPANVYDDQKQLTDEKNLIVLDKIISRRIVPSLAQRLG-PTIASKISLLQALFLIELSSCVPVSPEMLDPSRYSSPLQAPVLSKKPTTKKSEPIGIQTEEESHSILDSLASNLQYSTWKDISL 6816
            E+ LSKFG   CL    +  K+++ +      +R+N C+ +A+ ++++   +  HP+ + NY  + +         L+P + +FS+     +  V + LY++I  L  A Y    + LL+LY++ V  I +  V+++EA+++K+EI I L  FS A   LFQ++ G  +P    +   AT+       +D  K LT + N+  L+++I+R + P +   LG   + +K +  ++ F I L++ +   P   DPS      Q      KPT     P  ++  E SH     L  +   +T K I L
Sbjct: 1990 EEFLSKFGIWGCLQAAMITAKIAQFIKTANVKKRINCCILSALLFQSLLRTTLPHPKAERNYAQYEI-------TQLLPGIELFSDKFRADICSVIASLYYVIRELHYAKYNLIVLPLLALYQYFVSVICQDIVRNLEARILKIEILIDLGFFSEAFYELFQIYHGKNMPCAIPAGYKATMKVKITQSFDSGKPLTHKDNMQALEELINRGL-PHILVNLGYQHLLNKFNFAKSHFFISLAATINCIP---DPSPKIMYYQFITERSKPT-----PQNLKDNENSHGQFLRLRDDYNLNTIKSILL 2279          
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Mouse
Match: Cfap54 (cilia and flagella associated protein 54 [Source:MGI Symbol;Acc:MGI:1922208])

HSP 1 Score: 211.075 bits (536), Expect = 6.610e-57
Identity = 122/315 (38.73%), Postives = 176/315 (55.87%), Query Frame = 1
Query:  484 DKRFQANFHQRKCHCLLTIYRRLMEIILKQERFCWLIYNGSVCIYWISEALIRSGLSMMVVEPLVWASCCLETSIPLLTIFNLKWRAVIYTATCQALFNIQYDSDAEAFARRALVKINELHELYEISSDARSTENAIIFSEAVIKMGVMIFKRNAFETRRRPKTYLRPKTKVNFKEILQNNWPRTGTERILAEMFDSPSQQILAIMEAVKQPSRTIGKIEAPASENEWEMLDVYSELFYAAIAIITGRSTSVIGKSDKALVKEYRIVDVDENTDQLALSVLNGSAITIKATFELVCWAFSYGNWEFLDTILDPLL 1428
            D   Q     R+C  +L+ +R +M++ L QE  CW+I+NG++ IY I   L+  G S   +E L+WAS C+E+S+PLL+I  L WRA +YTA CQ  ++ Q     EAFARRAL KI+EL +L  +SS +    +   + EA IKM VMIFKR  FE+RR+ K  LRPK ++N KE     WPRT TER+L E+ DS S + LA++EA+   +R I +   P   +E E+ DV SELF A   ++   +    GK D               T  L   V   +A+++ A+      AF+Y  W   +++   L+
Sbjct:  165 DANLQNEESVRQCLHILSSFRLIMQVALPQEHLCWIIFNGTLYIYTICRKLMVIGQSSKALEFLLWASMCMESSVPLLSIRYLTWRATLYTAVCQCHYDCQDGIHGEAFARRALAKIDELRQLELMSSSSSLETSRKYYREATIKMAVMIFKRGVFESRRKNKNVLRPKLRLNLKEAQSLPWPRTVTERLLDELLDSTSSRFLAVLEALSDSNRRILQT-GPLVTDEMELRDVVSELFMAGKELLILSNVRSNGKLDFP------------QTSLLEHVVEKRNALSVGASVRFAKLAFTYEEWGLFESLAGQLI 466          
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Mouse
Match: Cfap54 (cilia and flagella associated protein 54 [Source:MGI Symbol;Acc:MGI:1922208])

HSP 1 Score: 73.9442 bits (180), Expect = 5.262e-13
Identity = 50/170 (29.41%), Postives = 93/170 (54.71%), Query Frame = 1
Query: 5905 EKLLSKFGGIKCLVIGGLLTKVSR-LDDLTCDERLNICLNAAMFYKAIYSGSFAHPEDDMNYLVHSLYLDAANSIPLVPKXXXXXXXXXXXXEDVESQLYFLITHLVKAGYYQFSICLLSLYEHIVYTISRSSVKSIEAQMIKLEICIRLRRFSTASRLLFQLFTGDKVP 6411
            E+ LSKFG   CL    +  K+++ +      +R+N C+ +A+ ++++   +  HP+ + NY  + +         L+P + +FS+     +  V + LY++I  L  A Y    + LL+LY++ V  I +  V+++EA+++K+EI I L  FS A   LFQ++ G  +P
Sbjct:  127 EEFLSKFGIWGCLQAAMITAKIAQFIKTANVKKRINCCILSALLFQSLLRTTLPHPKAERNYAQYEI-------TQLLPGIELFSDKFRADICSVIASLYYVIRELHYAKYNLIVLPLLALYQYFVSVICQDIVRNLEARILKIEILIDLGFFSEAFYELFQIYHGKNMP 289          
BLAST of cilia- and flagella-associated protein 54-like vs. UniProt/SwissProt
Match: sp|Q96N23|CFA54_HUMAN (Cilia- and flagella-associated protein 54 OS=Homo sapiens OX=9606 GN=CFAP54 PE=2 SV=3)

HSP 1 Score: 236.113 bits (601), Expect = 2.241e-60
Identity = 178/617 (28.85%), Postives = 287/617 (46.52%), Query Frame = 1
Query:  199 LYEFLIKYENNLPQEFFYKHTMELGDVLLRHGYSLIARNQCYERYLVNVH-NLDVFHIEXXXXXXXXXXEQIHQTESIVS--AIFGLCLAEFRCMEILDKRFQANFHQRKCHCLLTIYRRLMEIILKQERFCWLIYNGSVCIYWISEALIRSGLSMMVVEPLVWASCCLETSIPLLTIFNLKWRAVIYTATCQALFNIQYDSDAEAFARRALVKINELHELYEISSDARSTENAIIFSEAVIKMGVMIFKRNAFETRRRPKTYLRPKTKVNFKEILQNNWPRTGTERILAEMFDSPSQQILAIMEAVKQPSRTIGKIEAPASENEWEMLDVYSELFYAAIAIITGRSTSVIGKSDKALVKEYRIVDVDENTDQLALSVLNGSAITIKATFELVCWAFSYGNWEFLDTILDPLLAAIKDSKSLSHKLPLENTLKLIRLMRKCFHSSVFVEKKVVKLSEQPIEDDRKQGDTQMNFRAPQXXXXXXXXXXXXXXXXXDNPPADEEEKKGKQSQDPLCQLSELLKEIIAT---DFNPGNYFQEILVEAGLILWNKCKPIFQTTQDGSLSNEPSKPIPSIGKWIRILDTAYRILSVTEYSTINPISYSEISIRLSVLLEQLS 2031
            L+    KY   LP +++ +  +++GD L +     +A  QCY RYL   + N D   +++    +    +      + ++  A+ G  +  ++ +   D+  +      +C  +L+  R +M++ L QE  CW+I+NG++ IY I   L+  G S   +E L+WAS C+E+ +PLL++  L WRA +YTA CQ  ++       EAFARRAL KI+EL +L  +SS     E+   F EA +KM VMIFKR  FE+RR+ K   RPK ++N +E+   +WPRT TER+L EMFDS + Q LA++EA+   +R I +   P   +E E+ DV SELF A   ++   +    G  D               T  L L +     I++ A  + +  AF+Y  W   ++    L+  ++       K   E  L L+  M         +  K  K    P+E+ ++   TQ+  +                         D   K    S+D +  L+  L   + T   D  P    +EI+V+  + LW KCK   Q                S  KWI +L     ++   +   I+ +  +E+++RLS +LE L 
Sbjct:  110 LFNIWTKYAPRLPADYYNEKLLKVGDSLCQMKEYKLALLQCYGRYLQQFNTNFDENKVDVTQFKATFFPKGFKDKTAGLTFHALSGKNMCNYQLVCDSDENLKNKESVVQCLHILSSLRLIMQVALPQEHLCWIIFNGTIYIYTICRKLMVIGQSSKALEYLLWASMCMESLVPLLSLRYLTWRATLYTAVCQCCYDCHAGIHGEAFARRALAKIDELRQLELMSSSKSQEESRRYFREATMKMAVMIFKRGVFESRRKNKAVFRPKIRINLREVQTLSWPRTVTERLLDEMFDSTASQFLAVLEALSDSNRRILQT-GPIVTDEVEIHDVVSELFMAGKELLIMSNIGADGMLDFP------------KTSLLELMIGRKDVISVDAAVKFIKLAFTYEEWSLFESSAVHLIYFLQRQDDPESK-KAEKDLTLLIAMEP------LINVKRNKGLIFPLENYKEGQSTQIYLKKIAVH--------------------DTCLKTCGYSED-IFHLAATLYVCVCTAPQDVQPD---KEIVVDTIMFLWQKCKLGIQRLNISRNDYAKFTQKISTNKWIYLLWQINEVIHCYKMEDIDIVVVAEVTLRLSEILESLG 682          

HSP 2 Score: 227.254 bits (578), Expect = 1.296e-57
Identity = 326/1498 (21.76%), Postives = 626/1498 (41.79%), Query Frame = 1
Query: 2593 PAPIIERKGSNYIIVKVDENVPSELKSKIGWIRLYGRAVDSPNAEVRLTDDKLPGTGVETSCLS-TKFTIYDLTVNEQYILAFSINDKFGSPIGRGIGKSTKYILAIDTINPVTAISIITQILYEMGQKEEVIWYENLLWPQFVEA-IPDCVETYQRSVLPRSSFHK--EYKIKVDVLNNSSPMLLRKFCVSVLSAIDCECRILNITNDINVKSHSQM-GDQINRLKMVDKLLALFSISKKLKDSLLTMEIFTTVACLLAPIMNQNQFFKPYFSVLSTCVNVLVGLPQTTWIKIPAALKTYIHHLSACIGFYLLKCLNNFPSYGDFSETIRQSVTLLLQMSGNAPFTVTEQEDTSGTASQIEIKSEKSQINPQKKVIV-KVNKGENSAANFSVQQVAFESFKFTLAKQGLVDHQLSGNEEPDILMAYITLLPSRHAYKEVLKFSRKNRYLQFIVEILHKAVVEGNLENSLNYYREIKEWLKKRNEAILGRSLIQLQ---SQMNRETIQTKSQNPAVISDNNLFSRSVRTDEDVEDXXXXXXXXXXXXXXLQSDKAINVLPSMSETQK-QIQEQAELKALDVLSTTFVSMYKQNLRRRRFRQLSEYERVSRIKMNCSMAMGYLAISHAKVDSLTQILNGGFRFSEVPEIEDITKFMLESTGKILPLDETPIPD---QISTVLKMTKQQTSRQTDTPR------TYRSDVNVSEKRLFVEAPKLLSQLSDAMNKAA------------LLLKRAIVLAARSKVWVLLFKACSLSWYTLSSFINTTNRLTKFLNAAKKDFPEVDWSQIQSFSMNNLFKLYSSVFFFGSQSILDMIEVLGKSNLHKISKD---------------------------------FDENFTENFILKSVHLLFETGSYEKSIHVILRFTSITNYLFVNVTHPILIESQQQLCQKAKDNQARNPDWTLQQCEQYVTDCQSKMKVDHLDSSNYQQFLNKILSGYFGRKKLYQSKSKVLRKVQQSEHEDLYVNNLLNILKSEASSNLIFSVPV------RPEVSHKEWVTYQNVRSIK--REWMELYYKRNYFDYLHSSDCITVGNNHKMNLQELLTSYKEFXXXXXXXXXXXHYSFALNAMGDLYISHLHKPSLALSAWNGSLDCLLNQK---QSVKNISQIIGIIDKDFVKCQFQ--MEKLLSKFGGIKCLVIGGLLTKVSR-LDDLTCDERLNICLNAAMFYKAIYSGSFAHPEDDMNYLVHSLYLDAANSIPLVPKXXXXXXXXXXXXEDVESQLYFLITHLVKAGYYQFSICLLSLYEHIVYTISRSSVKSIEAQMIKLEICIRLRRFSTASRLLFQLFTGDKVPQLADSRPAATVTKTPANVYDDQKQLTDEKNLIVLDKIISRRIVPSLAQRLGPTIASKISLLQALFLIELSSCVPVSPEMLDPSRYSSPLQAPVLSKKPTTKKSEPIGIQTEEESHSILDSLASNLQYSTWKD-ISLPILKGLMLHAA 6849
            P PI+  +    + +K     P   + K+ W  + G   +    +VRL ++ LP +G        + F +  L  NE+Y+ A +     G  +G  IG++TK IL    ++ +TA   +TQ+ Y++G  E      + +W  FV + + D     ++SV+  S+     + ++  D+L  +S +LL  F  ++    D + +  N+  D N+K +      QI RL   +++L    +S  L DS   ++  T    LLAPI+  N    P   +L  C+ VL GLP     K   A    I H+ AC  FY+ K L ++  Y D +  I      +L ++           +      +   K       PQ+ ++  K+N+          Q    E+    L KQ  V  +LSG E+P  L   +     + A KEV+KF +K R+L+F  +++ K + E      +     + ++LK+RNE++LG  LI+++   S +N++  ++     AV+       RS    + +       K K+  +  +  + AI+ + +    ++  +++ A+   +D L+   +S  K    R+RF +LS  E   R +MN  +A  +  +   K+   T++  G           D   F L ++G +LP  +  + +    +  +L   K++ +  +D         +  SD N+S+ +   ++       +   ++ A            L  +RA+VLA R   W LL   C   W       N T  L   L  A      VD  +    S +         F+ G++ ++DM+  L  ++  K  +D                                  D  +  +F+LKS+ +L++   +E  + + ++F ++++  +     P+L+ +Q+QL  + +  + + PD T Q C +Y  +   K+          + F+ K L       +   + + +L+ +  SE+               + +  +  VPV      R      E   Y N RSI+  R+ + L+  +       + D +   N   + +Q                        AL+++G L I    K   A   W  +LD +  +     + K     +  +        F+   E+ LS+ G   CL    +  K+++ +  L  +++ + C+ +A+ ++ +   +  HP+ +  Y  + +         L+P + +FS+     +  V + LY++I  L         + LL+LY++ V  I +   +++EA+++K+E+ I LR FS A   + Q+F G  +P    +   AT        +D  K LT ++N+  +D++ ++ +   L     P + +K + ++A F + +++ +   PE    +++          K   T KS+P  +   EE +S  D  +S    +  KD I+L +LK ++L  A
Sbjct:  908 PPPILLSRTHCSVTLK---PAPFTSEVKVSWYCILGCKAEGSYGKVRLNNNHLPNSGEAIPADGKSVFEVKGLETNEKYVFAVAAYSNNGKLVGGAIGETTKPILVYPPLSTITARMFLTQVAYQVGNYELAKKVFSPVWDYFVASPLQD-----EQSVICLSNIITITQRRLHSDILAETSSILLYLFLRNIFVTSDIKIKEENLFCD-NIKGNEIFPSQQIARLIECERVLVALELSNFLNDSSYALQAVTQCYGLLAPIIYHNIVLVPVVQILIKCIVVLQGLPSIVCSKKHTASFESIQHMIACCIFYITKILRSWREY-DLAVMIINYGKKMLDITPGCKSLFDGSNEQEEMPEEDSSKKSLKTKKPQQILLPEKINE----------QLALLETHLLKLTKQ-YVTSELSGGEDPIFLYPVVLNWSVKGAVKEVMKFKQKPRFLEFFTQVMLKCMNEEKFHLMVEVTTPVHDFLKRRNESLLG--LIKVKYKDSALNKKANKSLKFKAAVME----IGRSAEMQQRIRS-----KKKETLRDFIFKNPAISEMVAHERNRRTSVRKAAQRYLMDYLNPLILSYVK----RKRFHRLSLEEMPWRAQMNLYLAGAHFNLVLQKLWECTKMKFGTSHMMVSFRSCDPNMFSLYNSGTVLPTRKLTVENYKAMLDFLLTAKKRKANLPSDAEEFSTFINSIMSDENMSKTQTVYDSDSQSGSSAKEKDRGANLCVMDHFMKIFLYCRRAMVLAHRGGYWTLLQNCCRALW-------NFTQELQILLKQA------VDLDKTFPISQDGFLCTSVLPFYLGAELLIDMLIQLQNTSSIKPIEDKGEFSVPSCYGNIKNDNGGSSLTFEHPLDDVNVVDLKWIHDFVLKSLEVLYQVEKWETLVSLAIQFNTVSHERYTEQVTPLLVYAQRQLLLRIQ--KFKGPDITQQPCARYEAEYGEKITC--------RNFIGKQLKINSSTIEATSNCTDLLKMLISSEY---------------SRAKALVCVPVDVTDTLRCFRETLEKSKYHN-RSIRHSRKLLSLFLAQ-------TQDVLQASNQRSLKVQ------------------------ALHSLGSLLI-FAEKKRAAFKCWCQALDDIFRKPDVLHTWKEFGPSLTNVTNSHSPPGFKDYSEEFLSRVGIWGCLQGAVISAKIAQFIKSLNVEKKTDCCILSALLFQGLLRTTLPHPKAERCYAQYEI-------TQLLPGIELFSDRYRADICSVIASLYYIIRELHFVRQNLIVLPLLALYQYFVSGICQDITRNLEARILKIEVLIDLRFFSEAFYEISQIFYGKNMPCPIPAGYKATGKMKIFQSFDSGKLLTSKENIQAIDELRNKGLPAVLVTIGQPHLLNKFNFVKAYFFLSVAATINCVPE----NKF----------KTVITNKSKP-NLPNLEEIYS-KDDGSSFYNLTKLKDEITLSMLKSMLLMEA 2275          
BLAST of cilia- and flagella-associated protein 54-like vs. UniProt/SwissProt
Match: sp|Q8C6S9|CFA54_MOUSE (Cilia- and flagella-associated protein 54 OS=Mus musculus OX=10090 GN=Cfap54 PE=2 SV=4)

HSP 1 Score: 230.335 bits (586), Expect = 1.603e-58
Identity = 146/416 (35.10%), Postives = 214/416 (51.44%), Query Frame = 1
Query:  199 LYEFLIKYENNLPQEFFYKHTMELGDVLLRHGYSLIARNQCYERYL------VNVHNLDVFHIEXXXXXXXXXXEQIHQTESIVSAIFGLCLAEFRCMEILDKRFQANFHQRKCHCLLTIYRRLMEIILKQERFCWLIYNGSVCIYWISEALIRSGLSMMVVEPLVWASCCLETSIPLLTIFNLKWRAVIYTATCQALFNIQYDSDAEAFARRALVKINELHELYEISSDARSTENAIIFSEAVIKMGVMIFKRNAFETRRRPKTYLRPKTKVNFKEILQNNWPRTGTERILAEMFDSPSQQILAIMEAVKQPSRTIGKIEAPASENEWEMLDVYSELFYAAIAIITGRSTSVIGKSDKALVKEYRIVDVDENTDQLALSVLNGSAITIKATFELVCWAFSYGNWEFLDTILDPLL 1428
            L+    KY   LP  ++ +  +++GD L +     +A  QCY RYL       + H  DV H +          E    T   +S    +C  +  C    D   Q     R+C  +L+ +R +M++ L QE  CW+I+NG++ IY I   L+  G S   +E L+WAS C+E+S+PLL+I  L WRA +YTA CQ  ++ Q     EAFARRAL KI+EL +L  +SS +    +   + EA IKM VMIFKR  FE+RR+ K  LRPK ++N KE     WPRT TER+L E+ DS S + LA++EA+   +R I +   P   +E E+ DV SELF A   ++   +    GK D               T  L   V   +A+++ A+      AF+Y  W   +++   L+
Sbjct:  115 LFNIWTKYAPRLPSNYYNEKLLKVGDSLCQIKEYKLALLQCYGRYLQEFIADFDEHKEDVNHFKTVFFPKGFGDETARLTFHALSGK-NICNYQLVCES--DANLQNEESVRQCLHILSSFRLIMQVALPQEHLCWIIFNGTLYIYTICRKLMVIGQSSKALEFLLWASMCMESSVPLLSIRYLTWRATLYTAVCQCHYDCQDGIHGEAFARRALAKIDELRQLELMSSSSSLETSRKYYREATIKMAVMIFKRGVFESRRKNKNVLRPKLRLNLKEAQSLPWPRTVTERLLDELLDSTSSRFLAVLEALSDSNRRILQT-GPLVTDEMELRDVVSELFMAGKELLILSNVRSNGKLDFP------------QTSLLEHVVEKRNALSVGASVRFAKLAFTYEEWGLFESLAGQLI 514          

HSP 2 Score: 146.362 bits (368), Expect = 3.866e-33
Identity = 170/689 (24.67%), Postives = 305/689 (44.27%), Query Frame = 1
Query: 2593 PAPIIERKGSNYIIVKVDENVPSELKSKIGWIRLYGRAVDSPNAEVRLTDDKLPGTGVETSCLSTKF-TIYDLTVNEQYILAFSINDKFGSPIGRGIGKSTKYILAIDTINPVTAISIITQILYEMGQKEEVIWYENLLWPQFVEA-IPDCVETYQRSVLPRSSFHK--EYKIKVDVLNNSSPMLLRKFCVSVLSAIDCECRILNITNDINVKSHSQM-GDQINRLKMVDKLLALFSISKKLKDSLLTMEIFTTVACLLAPIMNQNQFFKPYFSVLSTCVNVLVGLPQTTWIKIPAALKTYIHHLSACIGFYLLKCLNNFPSYGDFSETIRQSVTLLLQMSGNAPFTVTEQEDTS--GTASQIEIKSEKSQINPQKKVIVKVNKGENSAANFSVQQVAFESFKFTLAKQGLVDHQLSGNEEPDILMAYITLLPSRHAYKEVLKFSRKNRYLQFIVEILHKAVVEGNLENSLNYYREIKEWLKKRNEAILGRSLIQL-QSQMNRETIQTKSQNPAVISDNNLFSRSVRTDEDVEDXXXXXXXXXXXXXXLQSDKAINVLPSMSETQKQIQEQAELKALDVLSTTFVSMYKQNLRRRRFRQLSEYERVSRIKMNCSMAMGYLAISHAKVDSLTQILNGGFRFSEVPEIEDITKFMLESTGKILPLDETPIP--DQISTVLKMTKQQTSRQT 4629
            P PI+  +    + +K    + SE+K+   W  + G   D    +VRL ++ LP +G         F  I  L  N QY  A +     G  IG  IG++TK IL    ++ VTA   +TQ+ Y++G  E      + +W  FV + +PD     ++SV+  S+     + ++  ++L ++S +LL  F  ++    D + +  N+  D N+K +      Q+ RL   + +L    +S  L D+   ++  T    LLAPI+  N    P   +L  C+ VL G+P     K   +    I H+ AC  FY+ K L ++  Y      I     +L   SG       EQE+T+  G  S+   +++K Q   Q  +  K+N+          Q    E+      KQ +   +LSG+E+P  L   +     + A KEV+KF ++ R+L+F  +I+ K + +      +     + ++LK+RNE+++G   I+  ++ ++R  +++ S+  A++         +   +  + ++R  K KK  K     + +I     M+E  +  +      A   LS     +    +RR+RF Q+   E   R +MN  +A  +  +   K+   T+   G    S      D   F L  +G +LP  +  +   + +   L ++K++   QT
Sbjct:  912 PPPILLARTHCSVTLKPAPFI-SEVKA--SWYCILGCKADGSYGKVRLNNNHLPNSGEAIPADGRSFFEIKGLETNAQYCFAIAAYSSSGKLIGDAIGETTKPILIYPPLSAVTARMYLTQVAYQIGNYEMAKKVFSPVWDYFVASPLPD-----EQSVICLSNIMTITQKRLHSNILADTSSILLYLFLRNIFVMSDIKIKEENLFCD-NIKGNEIFPAQQVARLVECENVLVALELSNFLNDANFALQAVTQCYGLLAPIIYHNIVLVPVIQILIKCIVVLQGIPSIIHSKKNISSFESIQHMIACCIFYMTKILRSWKEYDLAIMLINYGKKMLDITSGCRSLFGIEQEETAEEGVCSKKTSRTKKPQ---QVLLPEKINE----------QLALLETHLLKTTKQ-INSAELSGSEDPIFLYPIVLNWTVKGAMKEVMKFKQRPRFLEFFTQIMLKCMNDEKFHLMVEISAPVYDFLKRRNESLIGVKRIKYKETVISRRALKSPSKFKAIV---------IEIGKSSDLTRRRRKKKKTLKDFFYKNPSIF---DMAELDRNKRTDVRKMAYRSLSDNLNPLILTYVRRKRFHQILLEELPWRAQMNLYLANAHFHLFLQKLTERTKERLGSSYSSVSFRSCDPNLFSLFHSGTVLPTAKLTVDSYNAMMDALTVSKKKKHNQT 1565          

HSP 3 Score: 97.0561 bits (240), Expect = 3.271e-18
Identity = 84/306 (27.45%), Postives = 150/306 (49.02%), Query Frame = 1
Query: 5905 EKLLSKFGGIKCLVIGGLLTKVSR-LDDLTCDERLNICLNAAMFYKAIYSGSFAHPEDDMNYLVHSLYLDAANSIPLVPKXXXXXXXXXXXXEDVESQLYFLITHLVKAGYYQFSICLLSLYEHIVYTISRSSVKSIEAQMIKLEICIRLRRFSTASRLLFQLFTGDKVPQLADSRPAATVTKTPANVYDDQKQLTDEKNLIVLDKIISRRIVPSLAQRLG-PTIASKISLLQALFLIELSSCVPVSPEMLDPSRYSSPLQAPVLSKKPTTKKSEPIGIQTEEESHSILDSLASNLQYSTWKDISL 6816
            E+ LSKFG   CL    +  K+++ +      +R+N C+ +A+ ++++   +  HP+ + NY  + +         L+P + +FS+     +  V + LY++I  L  A Y    + LL+LY++ V  I +  V+++EA+++K+EI I L  FS A   LFQ++ G  +P    +   AT+       +D  K LT + N+  L+++I+R + P +   LG   + +K +  ++ F I L++ +   P   DPS      Q      KPT     P  ++  E SH     L  +   +T K I L
Sbjct: 1990 EEFLSKFGIWGCLQAAMITAKIAQFIKTANVKKRINCCILSALLFQSLLRTTLPHPKAERNYAQYEI-------TQLLPGIELFSDKFRADICSVIASLYYVIRELHYAKYNLIVLPLLALYQYFVSVICQDIVRNLEARILKIEILIDLGFFSEAFYELFQIYHGKNMPCAIPAGYKATMKVKITQSFDSGKPLTHKDNMQALEELINRGL-PHILVNLGYQHLLNKFNFAKSHFFISLAATINCIP---DPSPKIMYYQFITERSKPT-----PQNLKDNENSHGQFLRLRDDYNLNTIKSILL 2279          
BLAST of cilia- and flagella-associated protein 54-like vs. TrEMBL
Match: R7VDR0 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_224115 PE=4 SV=1)

HSP 1 Score: 498.049 bits (1281), Expect = 2.103e-140
Identity = 405/1467 (27.61%), Postives = 676/1467 (46.08%), Query Frame = 1
Query:   28 MSSNLFNKALKNIKTKDNLNKINCSE---DEINENLKKSFEFELKNITKTIQLQKLLPNK-----------LYEFLIKYENNLPQEFFYKHTMELGDVLLRHGYSLIARNQCYERYLVNVH--NLD-VFHIEXXXXXXXXXXEQIHQTESIVSAIFGLCLAEFRCMEILDKRFQANFHQRKCHCLLTIYRRLM-EIILKQERFCWLIYNGSVCIYWISEALIRSGLSMMVVEPLVWASCCLETSIPLLTIFNLKWRAVIYTATCQALFNIQYDSDAEAFARRALVKINELHELYEISSDARSTENAIIFSEAVIKMGVMIFKRNAFETRRRPKTYLRPKTKVNFKEILQNNWPRTGTERILAEMFDSPSQQILAIMEAVKQPSRTIGKIEAPASENEWEMLDVYSELFYAAIAIITGRSTSVIGKSDKALVKEY---------RIVDVDENTDQLALSVLNGSAITIKATFELVCWAFSYGNWEFLDTILDPLLAAIKDSKSLSHKLPLENTLKLIRLMRKCFHSSVFVEKKVVKLSEQPIEDDRKQGDTQMNFRAPQXXXXXXXXXXXXXXXXXDNPPADEEEKKGKQSQDPLCQLSELLKEIIATDFNPGNYFQEILVEAGLILWNKCKPIFQTTQDGSLSNEPS-KPIPSIGKWIRILDTAYRILSVTEYSTINPISYSEISIRLSVLLEQ---LSINNWFSTNTSEDDNCQELSLESFISQLKTEGTSK--------------------SMKCIAAAKKIMRTSLSQLNKARNL--QNLDKAS-----------------------NQD---------DKV---------------KLIGNNLDDLYLELNSIHLRTCAREIVIHLFIIGEEI---------------KKMNEIRQSKFYQEAIQ--FCN---KNLLFLA-ILQAHLGNLLRNNLCLEDRIELVNHIKSLIEKSENN--LSDVKLNQKPNSDKM-PAPIIERKGSNYIIVKVDENVPSELKSKIGWIRLYGRAVDSPNAEVRLTDDKLPGTGVETSCLSTKFTIYDLTVNEQYILAFSINDKFGSPIGRGIGKSTKYILAIDTINPVTAISIITQILYEMGQKEEVIWYENLLWPQFVEAIPDCVETYQRSVLPRSSFHKEYKIKVDVLNN-----SSPMLLRKFCVSVLSAIDCECRILNITNDINVKSHSQMGDQINRLKMVDKLLALFSISKKLKDSLLTMEIFTTVACLLAPIMNQNQFFKPYFSVLSTCVNVLVGLPQTTWIKIPAALKTYIHHLSACIGFYLLKCLNNFPSYGDFSETIRQSVTLLLQMSGNAPFTVTEQEDTSGTASQIEIKSEKSQINPQKKVIVKVNKGENSAANFSVQQVAFESFKFTLAKQGLVDHQLSGNEEPDILMAYITLLPSRHAYKEVLKFSRKNRYLQFIVEILHKAVVEGNLENSLNYYREIKEWLKKRNEAILG 4041
            M+S L N A+K++      NK   S    D+ N  +  + E E+K+    ++ +   P             L++   KYE  LP++ F    +E+G  L       +A  QCYERY+ +    NLD  F ++        +      TE    A+ G     +  ++++D + Q N H      ++  + RLM ++IL  E+ CWL+YNG++ IY IS  L+  G S  V+E L+WAS C+ETS+PLL +  LKWR  +Y + CQ  ++ +    AEAFARRA+ KINEL +L  +SS+  S E    F +A IKM +MI+KR  +ETRR+PK  LRPKT+ N K+ +Q  WPRT +ER+L+EMF+  S Q+L ++E +   +R       PA+ENE E+LDV++ELF AA  +I G      G S   L   Y         R   V +    + L+      + +    ++V  A+ Y  W+  DT+L   L+ IK+  S ++    ++ LK + L++         +K V +  ++ +  + ++ +  ++  AP                       D+ ++     QD L + +E+L  +I        +  +++V+A L LW+KCK IFQ  Q GS  N    + + + GKW+ +LD  ++ LS +  S+I+P   +E+ +RLS++ E    L +     +  +      E    + IS +K  GT++                    S + I +A  + +  L QL +AR++    LD  S                       N D         D+V                 + N + DL++EL  ++ R C +  +I+L   G++                +++     ++ Y++ ++   CN   K LL +   ++ H+ +  R     E+ +    HI   +E  E    L + K +Q  +  K+ P+PI+                    ++++ W R++ R     N +VR++D   PGTG +T   + +F I  LT  EQY+ A +     G  IG+GIG ST  ILA   +  + A + ++Q+ Y++G  E       +LW  FV   P       + +   +S  K++K+ +  LN      +SP+LLR F  S+   +D   R   +              QI RLK  + +L    ++  + ++ L ++       LLAP+++          VL  C  VL+ +P    +K  A +   +HH++AC+ F + K +  +      S        LL Q S  A   +T +   + T +     +   +   +K  +V   +   S  N  ++  A E+    L+KQ   +H+LSGNE+P IL AYI  LP R A+KEV+KF R+ RYL+F  + + K + EG  + +L +  E  +WL KRNE I+G
Sbjct:    1 MASMLRNAAVKSV------NKGQPSAFYPDDKNNPVFMALEQEIKSFVNIMKKRASSPTASKESLSRFADLLFDLWNKYEEKLPKKVFNSKLLEVGHFLFEIKEYNLALWQCYERYIKSFGDVNLDETFDVKSFKKTFFPNGFHAEDTEHTFQALIGRSACSYERIKLMDPKLQ-NSHSVDHSVIILKFLRLMTQVILPTEKLCWLVYNGTIRIYQISRHLMTKGHSSKVLEFLLWASMCMETSLPLLGVHYLKWRVTLYASVCQCYYDCKAGVHAEAFARRAVSKINELSQLESLSSNPESKEVEEAFRQATIKMAIMIYKRTVYETRRKPKGLLRPKTRANLKDAVQLPWPRTQSERLLSEMFEGGSAQMLCLLETITDSNRRTLLSNPPAAENEVELLDVFAELFLAAQELIAGG-----GGSQSQLSGSYYLPLSVNIPRFGGVCKEIPMMQLATQGEDGVPLSVVVKVVKLAYCYEQWDVFDTLLPNTLSVIKEINSPTY----DSDLKALELLQA-------YDKVVPRAKQRCLFGNDEEEEEGLSTEAPAH---------------------DKGQRSNNGMQDDLIEFAEVLLSVINGPLTQDQFDNDMMVDATLFLWSKCKAIFQKFQTGSTDNPKYLQKMDNPGKWVYLLDIVHQALSWSGLSSIDPALTAEVVLRLSLVFEASSLLEMKGIVKSGANSPSKGPEDEETTIISTVKDAGTAQGTARELSTSQSELSTSHCGGSQQSIFSATALSQGVLEQLQQARSILESGLDNVSLARTVVALTDGKSITDVIWVKEFNTDLFAPVIPTEDEVLTDSEAEECLEAVDGTAVWNTVRDLHMELLFMYHRICLK--LINLGSRGKDKGCQSKNLASSPHASQRRLGNKTPTESYEDLMKNARCNGLSKALLLMQRAMEVHMTS--RGAGSQEEILREAIHILRRVEAEEKRLYLDNFKDDQSRSPSKLPPSPIL------------------LCRTEVAWYRIFARNAAGSNVKVRMSDYTFPGTGEQTPSFNCEFEIRGLTPGEQYMFAVAAYTADGQLIGKGIGDSTLPILASHPMPVLMAWAFLSQLSYQVGCVEICESACRVLWAHFVAEPPP-----SQGITYTTSTRKDFKLTLHKLNQRVVTKTSPVLLRLFLTSIFIRVDIAVRRGQLFCTKLCDEGPLHQAQIARLKQCEIMLVAMQLAGWMNENNLALQAAVQCYGLLAPLLHYKIPCVAITQVLERCCAVLLEVPSHIRVKRTAVISEGLHHMTACLTFNMAKVMRGWGQRSLASHLNDCGRRLLAQDSSAAREAMTTEGGDAITETGSLTLAALKKRKGKKGGLVSGKEECFSTGNEELK--ALEAHMLRLSKQAQGEHELSGNEDPSILHAYIAYLPGRIAFKEVVKFKRRARYLEFFTQCVQKTLSEGTYDLALEWCEETTQWLIKRNENIIG 1394          
BLAST of cilia- and flagella-associated protein 54-like vs. TrEMBL
Match: A0A2T7NTX3 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_15114 PE=4 SV=1)

HSP 1 Score: 475.322 bits (1222), Expect = 1.534e-130
Identity = 429/1601 (26.80%), Postives = 702/1601 (43.85%), Query Frame = 1
Query:  199 LYEFLIKYENNLPQEFFYKHTMELGDVLLRHGYSLIARNQCYERYLVNVHNLDVFHIEXXXXXXXXXXEQIHQTESIV---SAIFGLCLAEFRCMEILDKRFQANFHQRKCHCLLTIYRRLMEIILKQERFCWLIYNGSVCIYWISEALIRSGLSMMVVEPLVWASCCLETSIPLLTIFNLKWRAVIYTATCQALFNIQYDSDAEAFARRALVKINELHELYEISSDARSTENAIIFSEAVIKMGVMIFKRNAFETRRRPKTYLRPKTKVNFKEIL---QNN------------------------WPRTGTERILAEMFDSPSQQILAIMEAVKQPSRTIGKIEAPASENEWEMLDVYSELFYAAIAIITGRSTS-VIGKSDKALVKEYRIVDVDENTDQLALSVLNGSAITIKATFELVCWAFSYGNWEFLDTILDPLLAAIKDSKSLSHKLPLENTLKLIRLMRKCFHSSVFVEKKVVKLSEQPIEDDRKQGDTQMNFRAPQXXXXXXXXXXXXXXXXXDNPPADEEEKKGKQSQDPLCQLSELLKEIIATDFNPGNYFQEILVEAGLILWNKCKPIFQTTQDGSLSNEPS-KPIPSIGKWIRILDTAYRILSVTEYSTINPISYSEISIRLSVLLEQLSI-------NNWFSTNTSEDDNCQELSLESFI-SQLKTEGTSKSM-KCIAAAKKIMRTSLSQLNKARNLQNLDK----------------------------ASNQDDKVKLIG-----------------NNLDDLYLELNSIHLRTCAREIVIHLFIIGEEIKKMNEIRQSKF----------------YQEAIQFCNKNLLFLAILQAHLGNLLR-NNLCLEDRIELVNHIKSLIEKS---------ENNLSDVKLNQKPNSDKMPAPIIERKGSNYIIV----KVDENVPSELKSKIGWIRLYGRAVDSPNAEVRLTDDKLPGTGVE-TSCLS-TKFTIYDLTVNEQYILAFSINDKFGSPIGRGIGKSTKYILAIDTINPVTAISIITQILYEMGQKEEVIWYENLLWPQFVEAIPDCVETYQRSVLPRSSFHKEYKIKVDVLNNSSPMLLRKFCVSVLSAIDCECRILNITNDINVKSHSQMGDQINRLKMVDKLLALFSISKKLKDSLLTMEIFTTVACLLAPIMNQNQFFKPYFSVLSTCVNVLVGLPQTTWIKIPAALKTYIHHLSACIGFYLLKCLNNFPSYGDFSETIRQSVTLLLQMSGNAPFTVTEQEDTSGTASQIEIKSEKSQINPQKKVIVKVNKGENSA-------------------ANFSVQQVAFESFKFTLAKQGLVDHQLSGNEEPDILMAYITLLPSRHAYKEVLKFSRKNRYLQFIVEILHKAVVEGNLENSLNYYREIKEWLKKRNEAILGRSLIQLQSQMNRETIQTKSQNPAVISDNNLFSRS-------------VRTDEDVEDXXXXXXXXXXXXXXLQSDKAINVLPSMSETQKQIQEQAELKALDVLSTTFVSMYKQNLRRRRFRQLSEYERVSRIKMNCSMAMGYLAISHAKVDSLTQILNGGFRFSEVPEIEDITKFMLESTGKIL 4551
            L+E   KYE  LP+    +  +E+GD L   G   +A  QCYER L +   + V  I   DL   +      + E       A+ G  ++ ++ + + D + Q+      C  +L   R +M+++L +E  CWL++NG+V IY IS  L+  G S  V+E  +WA+ C+ETS+PL+T+  L WRA +YTA CQ  ++ +    AE FARRAL K+NEL +L  +S+   + +    F +A ++M VMIFKR+ FETRR+PK  LRPKT+ N K+ +   +NN                        WPRT TE++L +MF+  S Q LAI+E++   +R I     P  +NE E+LDV+ ELF AA  I+ G   +   G   +  +    +  V  +   + ++      + ++A   LV  A++Y  W+  D +LDPLL  IK+ K+ +     E +L+L++ M +    S  + K+   L+   IED  +                       +S S     P     + G   QD L  L+++L  I+   F   N   +++V+A L LW+K K +FQ  Q GS+ N      I ++ KW+++LD+ ++ L  T  S+++P   +E+++RL+++ E  +I            T  S+ DN +         S L +    ++M + +  A+ I+   L  +N AR   +L+                              S+  D++  +                  N + DL+LE+   + R   R   +  F    E  K    R+S                  +++ +  C  N L  A+L     ++L  +N+  + +  L+++ K LI+K+         EN   D   ++ P    +P P I    +N  +V            +  + + W RL+GR     N + R+ D+ LPGTG E TSC    +  +  LT +E Y+ A +     G+ IG  IG +T  ILA                         + +  NL  P     +    E  Q +VL R +           +  SSP+LLR+F  S+   ++   RI  +  D+          QI RLK  +K++    ++  L ++ L ++       LLAP++           VL  C  VL  +P     K    +   +HH++ACI ++L K L  +      +  I ++   LL M    P    E+   + TA      S K+   P KK I        S                     N + +  A E+    + +    +H+LSG E+P IL AYI  LPS+ AY+EV KF R++++L+F V    K + EG ++  +N+ REI EWL++RNE+I+G  +    S+    TI     +P   +   +  R              V +  DV+                   + I V PSMS+T +Q QEQAELKAL +LS     +Y  N+R+RR R++++ E   R +MN    + +      K++   ++L             D   F  E+ G ++
Sbjct:   68 LFELWNKYEPRLPKPHCKEKMLEMGDFLASIGEYKLALWQCYERCLQHYGPVSVEEICNVDLFQSIFFPGGFEAEDACFTFRALLGKSISMYQVVRLSDPKLQSKQSVDHCVHILHFLRLVMQVLLPRESLCWLLFNGTVHIYNISRHLMSLGHSTKVLEYFLWAAMCMETSVPLMTVKYLSWRATLYTAVCQCYYDCKAGQQAEVFARRALSKLNELSQLESLSNSVETPQREYAFRQATVRMAVMIFKRSVFETRRKPKGLLRPKTRSNLKDAVNESENNVKKGGKKEKGETQDDKQLPITDMPWPRTPTEKMLVDMFEGGSAQFLAILESLSDSNRRILLSSPPTQDNEPEILDVFVELFIAAQEILAGGGGNKATGNKTQMQLGAPPLSAVVLHHSLIDMATRGEDGVPLEAAIRLVKLAYNYELWDTFDALLDPLLEQIKE-KNDTELTWEEKSLELLQAMIQ-LTGSRRLNKRSGNLTN--IEDSEE-------------------VVEVTSTSAHAFTPFTGANQSGI-GQDDLTYLADVLISIVKGPFQQENIEIDMVVDATLYLWSKSKSVFQKFQTGSVDNPRYLHKIDNLQKWMKLLDSVHQALGWTGISSVDPCLTAEVALRLAMVYESFAILETSEDLKKESKTTVSDADNVEGGGEGVGGPSSLLSPSAKQAMVQYLCQARDILALGLENVNNARQAVSLNDGRSIADVSWIKELFPKVFQSDPSQEEEYGSDHPDELASLNSCTQVHSSTKGAAANVLNTVKDLHLEMIMTYHRITIR---LAAFTPQVESNKAQSQRKSNLSKVTSKNKDQGRCVETFEDLVARCRCNKLSKALLYMQRASMLGCDNVPSDQQKTLLDNAKKLIQKAQVEEQKTYKENTGID---DRSPVECSVPPPPILLCRTNRTMVFCPAPFQPVSGQKAHNTVAWYRLFGRNAAGSNIKARMNDNFLPGTGDEVTSCGGICELKVSGLTPDECYVFAVAAYAADGTLIGDSIGATTAPILA----------------------SHPLAYSHNLGLP-----VSGGREKSQWNVLNRQA-----------VCLSSPVLLRQFLTSIFINVESSIRINGLFCDVLCDQGPLYPRQIKRLKECEKMVVAIELAGWLNEANLALQAVVQCYGLLAPLLYYKIPAIAVIQVLQHCHGVLQEIPPGLLQKRHGHVTESLHHMTACITYHLAKVLRTW-GQKQLARNINETGRRLLAME---PEKDLEKGTAASTAGDDGTASTKTA--PIKKKISGQGGAGGSPNTAKGAGGGGGGVGGKKEETNLNEELKALEAHMLKVNRAAAGEHELSGTEDPTILHAYIAYLPSKLAYREVTKFKRRSQFLEFFVYAAQKGLSEGEVDEVINWCREIDEWLRRRNESIIGPRMY--MSKQADGTITLAGDDPKKFAAAMVEYRGMMQMFFSYELYYYVNSGFDVQTGHHCFL------------QPIGVTPSMSDTARQAQEQAELKALAILSIHIPDLYHNNIRKRRLRKITQEEMPWRCQMNMVQGLCHFGALLQKLEKREKLLGSSSSKMYKTGFLDPEWFTFETAGTLV 1580          

HSP 2 Score: 103.99 bits (258), Expect = 7.810e-18
Identity = 73/311 (23.47%), Postives = 148/311 (47.59%), Query Frame = 1
Query: 5731 ALNAMGDLYISHLHKPSLALSAWNGSLDCLLNQKQSVKNISQIIGIIDKDFVKCQFQMEKLLSKFGGIKCLVIGGLLTKVSR---LDDLTCDERLNICLNAAMFYKAIYSGSFAHPEDDMNYLVHSLYLDAANSIPLVPKXXXXXXXXXXXXEDVESQLYFLITHLVKAGYYQFSICLLSLYEHIVYTISRSSVKSIEAQMIKLEICIRLRRFSTASRLLFQLFTGDKVPQLADSRPAATVTKTPANVYDDQKQLTDEKNLIVLDKIISRRIVPSLAQRLGPTIASKISLLQALFLIELSSCVPVSPEMLD 6654
            AL  +G++Y  H +    A   W  SLD +L    +++       +  ++    Q   + LL + G   C+  G L + +++     DL    R+  C  +  F+KA++  S  HP  D +Y ++ +  +      LVP ++  S+    +   + + L ++   L +  +  F + LL+LY++ +  I R   ++++ +++K+ +   L  FS A  +L +L  G+++P   DS      ++     +     + D  NL VL++++ +R+  +LA   GP +   +SL+Q+   + L+  +PV P M D
Sbjct: 2061 ALQELGNIYY-HANDIRAAYRCWAESLDLVLGMTDAIR-------VWRQETQTAQDVSQLLLERCGLWGCVTGGVLASNIAQYILAADLGL--RMECCFLSGYFFKALFRASLPHPSSDRDYALYDVG-EGCEVTNLVPGIDFMSDHFRCNGRSLAAALRWVTEELARGRHNLFVLPLLTLYQYFMTFICRDLQRAVDGRILKVRVLTDLGLFSEALTVLLRLLHGERLPHTGDSSFRQVESRRSQMCFSTNLPINDISNLKVLEQVLDKRLPSNLATLFGPHLTCHLSLVQSHLFVALADTIPVLPAMAD 2360          

HSP 3 Score: 77.7962 bits (190), Expect = 6.845e-10
Identity = 107/473 (22.62%), Postives = 196/473 (41.44%), Query Frame = 1
Query: 7156 GEVSVENPLDVSETAISDVPPVKDVIISCIGECDGKGLLQHKAWFISALAQYSFISGYEVEKYKAILSESVEIFDNINWLSDHSENAFIVSQLRGINQLISSTDKPDLRRSI---------VDAEKALRKLHERLLNTIDGKYLQSVMWNVNEPDLSSVQIANVYDGKLNYLCKIKLLFGIIFME------KSR-FATEKQELRMKALAVLNVGLDICRSLSRRVPWIETEYFLTIGRIQRLLISSGKVSHLSTINTFLEGLRLCVLSTGHLGLKKQFFLELAITFMISSHLVGDSVEKDGEIVESTKLLFNTHQAQMLQNH-----------------KISKNEALTFKRLSWLAIKCASSVSDSIQHLNYCKSDTSKLLSEDAQDNFPISALFDLYGRFKLGSKRITFKNEIEEELSRMPEYKLLKDNENLDDQLDKIKPYTSRTSLSQVLAYHEVLMKLTNNTFLTKSES 8475
            G   V+ P +   T ++D    +   I  + E +  G ++ +A F+   A  + + G  +    + L  + E+   +  LS   ++  ++S        + +T KPDL   I         + A+K +    E L   I+         +++ P      + N+Y  ++  L ++KL  G           +SR   T         L VL+  L++ +  +RR    E E  LT+G++Q++L+    +       T LE + +   +   LGL +Q +LELA  F+ SS   G    K+G  +ES+    ++ +A+   +                  KI++ E      ++      A+    +   L    + TSK +   +  + P  A  DL   + LG K+  FK+EIEEEL+ + E +  K  E+ DDQ++K +      S   +L Y  +L +L     +  S +
Sbjct: 2540 GMGEVKGPENKVLTELADC---RHYCIEGLKEAEACGDVEVQAEFLIQEAILNIMEGRSLHNTISFLDNATELLQKVPCLSVTGKD--LLSTCIIFRTDLEATSKPDLPSDIPTQHSLQAYLHAQKIILAQMEELGERIEHHKPAGQRQHLSVP---VRPMENIYTVQVLRLAQLKLRIGHAMARTLAKDIRSRCMETSPIPQWTDCLVVLSAALELMKVSARREASTEAEILLTMGKVQKMLVYLDNLEPQVAATTLLEAISVSYANDHDLGLIRQAYLELAQIFLYSS---GTMTAKEGTFLESSLAADSSDEAKTASSSVTEKKNKTKMTEESSKAKITETEKHNAAWVAIRCAAAAAQALRARSLLIGNTTVTSKKVVTVSSHSMPDFACLDLMSAYVLGEKKKVFKSEIEEELAPLSEAE-AKAVESYDDQVNKTRVAAKDLSWLHLLGYQTILQRLVCTATIAASST 3000          
BLAST of cilia- and flagella-associated protein 54-like vs. TrEMBL
Match: A0A151LZ64 (Cilia-and flagella-associated protein 54 isoform B OS=Alligator mississippiensis OX=8496 GN=CFAP54 PE=4 SV=1)

HSP 1 Score: 467.618 bits (1202), Expect = 3.083e-128
Identity = 481/1849 (26.01%), Postives = 783/1849 (42.35%), Query Frame = 1
Query:  193 NKLYEFLIKYENNLPQEFFYKHTMELGDVLLRHGYSLIARNQCYERYL-----VNVHNL--DVFHIEXXXXXXXXXXEQIHQTESIVSAIFGLCLAEFRCMEILDKRFQANFHQRKCHCLLTIYRRLMEIILKQERFCWLIYNGSVCIYWISEALIRSGLSMMVVEPLVWASCCLETSIPLLTIFNLKWRAVIYTATCQALFNIQYDSDAEAFARRALVKINELHELYEISSDARSTENAIIFSEAVIKMGVMIFKRNAFETRRRPKTYLRPKTKVNFKEILQNNWPRTGTERILAEMFDSPSQQILAIMEAVKQPSRTIGKIEAPASENEWEMLDVYSELFYAAIAIITGRSTSVIGKSDKALVKEYRIVDVDENTDQLALSVLNGSAITIKATFELVCWAFSYGNWEFLDTILDPLLAAIKDSKSLSHKLPLENTLKLIRLMRKCFHSSVFVEKKVVKLSEQPIEDDRKQGDTQMNFRAPQXXXXXXXXXXXXXXXXXDNPPADEEEKKGKQSQDPLCQLSELLKEIIAT---DFNPGNYFQEILVEAGLILWNKCKPIFQTTQDGSLSNEPSKPIPSIGKWIRILDTAYRILSVTEYSTINPISYSEISIRLSVLLEQLSINNWFSTNTSEDDNCQELSLESFISQLKTEGTSKSMKCIAAAKKIMRTSLSQLNKAR---------------------NLQNLDKASNQDDKVKLIGNN-LDDLYLELNSIHLRTCAREIVIHLFIIGEEIK-KMNEIRQSKFYQEAIQF-----------CNKNLLFLAI-LQAHLGNLLRNNLCLEDRIELVNHIKSLIEK--SENNLSDVKLNQKPNSDK---MPAPIIERKGSNYIIVKVDENVPSELKSKIGWIRLYGRAVDSPNAEVRLTDDKLPGTGVETSCLSTK-FTIYDLTVNEQYILAFSINDKFGSPIGRGIGKSTKYILAIDTINPVTAISIITQILYEMGQKEEVIWYENLLWPQFVEAIPDCVETYQRSVLPRSSFHKEY-KIKVDVLNNSSPMLLRKFCVSVLSAIDCECRILNITNDINVKSHSQMGD-----------QINRLKMVDKLLALFSISKKLKDSLLTMEIFTTVACLLAPIMNQNQFFKPYFSVLSTCVNVLVGLPQTTWIKIPAALKTYIHHLSACIGFYLLKCLNNFPSYGDFSETIRQSVTLLLQMSGNAPFTVTEQEDTSGT--ASQIEIKSEKSQINPQKKVIVKVNKGENSAANFSVQQVAFESFKFTLAKQGLVDHQLSGNEEPDILMAYITLLPSRHAYKEVLKFSRKNRYLQFIVEILHKAVVEGNLENSLNYYREIKEWLKKRNEAILG--------RSLIQLQSQMNRET-----IQTKSQNPAVISDNNLFSRSVRTDEDVEDXXXXXXXXXXXXXXLQSDKAINVLPSMSETQKQIQEQAELKALDVLSTTFVSMYKQNLRRRRFRQLSEYERVSRIKMNCSMAMGYLAISHAKVDSLTQILNGGFRFSEVPEIEDITKFMLESTGKIL--------------PL---DETPIPDQISTVLKMTKQQTS-RQTDTPRTYRSDVNVS---EKRLFVEAPKLLSQLSDAMNKAALLLKRAIVLAARSKVWVLLFKACSLSWYTLSSFINTTNRLTKFLNAAKKDFPEVDWSQIQSFSMNNLFKLYSSVFFFGSQSILDMIEVLGKSNLHKISK---DF----------DENFTENF--------------------ILKSVHLLFETGSYEKSIHVILRFTSITNYLFVNVTHPILIESQQQLCQKAKDNQARNPDWTLQQCEQYVTDCQSKMKVDHLDSSNYQQFLNK 5343
            N L++  IKY+  LP   + +  +++GD+L++     +A  QCY RYL     +N+  +  DV   +     S    +    T   +     +C+ +  C    D+  Q     + C  LL+  R +M++ L QE  CWLIYNG++ IY I   L+  G S+ V+E L+WAS C+E+S+PLL++  L WR  +YTA CQ  ++ +     E FARR L KI+EL +L   SS  +++E   IF EA IKM VM+FKR  +E+RR+PK Y RPK +VN KE     WPRT TER+L EMFD  S Q LAI+EA+   +R +     P  E E E+ DV SELF+A + I++G  +S     D   +    +++      QL L+  NG  ++  A  + +  AFSY  W+  D+ +  + + ++D      K   E  L+L+  M+    +        V+ + + +   R  G      R                          E   K  +S D L  L+  +   I T   +F P    +EILV+  + LW KCK   Q  Q              + KWI I      ++  +     N +  +E+++RLS +LE ++     S   + + N  EL  E+ I  +         + +  A + +  +++ +N +R                     N QNL  A   D+     GNN + DL+LEL     R     I + LF + ++++      R +K +++ +               KN L  AI L      +    L    + +L+    +LI+K  +E N+    L Q  +++K    P PI+  +    +  K     P     ++ W R++G      N +VRL +  LP  G E          I  L  NE+YI A +     G  IG  IG++TK ILA   ++  TA + +TQI Y+ G         +  W  FV + P         +   ++F     ++ +D ++ +SP  L  F  ++            I NDI+VK  +   D           Q+ RL    ++L    +S  L D+   ++       LLAPI+       P   +L  C+ VL  LP +T  +  A     I H+ AC  FY  K L ++  Y + +  I      LL  S       T   D SG     ++ I ++    +  KK    V   E +  N +    A ES    L K G     L+G E+P +L   I+   +++AYKEVLKF +K R+L+F V++LH+ + E   +  L +   +++ LK+RN  +LG           + +     R T      Q KS+ P + +         R  + +                    K  ++     E Q+++QE+ +  A   L T    +   +L+R++F Q    E   R +MN  +A+    +   K++    I     +     ++ D   F L ++G I+              PL     + I   I+   K ++      + DTPRT  ++  +S     + F ++    S L +   K  L L+RA+VLA R   W LL  AC   W    ++      + +  N+    FP          +   L       F+  S +ILDM+  L   N  KI +   DF          DE    +F                    ILK++ LL++   +E  +H+ ++F  IT+  +     P+L+ +Q+QL ++ +  Q R+P+      E Y      K   D+LD  N + ++ K
Sbjct:    5 NMLFDIWIKYKPQLPDWIYNEKLLKVGDLLIQIKEYKLALLQCYGRYLQQFSCINIDEVIADVNQFKSIFFPSGFRDQNAALTFHALQE-RNICIYQMVCSS--DRNLQNQESLQTCFILLSSLRLIMQVALPQESLCWLIYNGTIYIYTICRHLMSIGQSVKVLEYLLWASVCMESSVPLLSVHYLTWRTTLYTAVCQCYYDCRASIHGEVFARRGLSKIDELKQLESASSSPQTSETKNIFREATIKMAVMVFKRLVYESRRKPKVYFRPKLRVNLKEAQHLPWPRTVTERLLTEMFDGTSAQFLAIIEALSDSNRQLLHTAPPLPE-EPEIRDVISELFFAGMEILSGGGSST-STQDSHYIDPSGVINASSTLLQLILTGKNG--VSGDAAVKFIKLAFSYEEWDAFDSTIGLVFSFLQDQDDPVWK-KAEMELRLLIAMQPVVSARRSKHGLSVQENIREVAMTRNSGRKTTALR--------------------------EGSLKPGESADDLVILATTVLSCICTSKQNFQPD---REILVDVIMFLWQKCKVGVQRIQTSGSDYLKYIHKYKVYKWIHIHWIINEVIQNSNMGDTNAM-LAEVTLRLSAILENVADCANKSGKKTGERNESELLTETQIFDIPEILKKSPAEQLHFAYESLEKAINGMNMSRLMTLSPDGKSIFDHCCTKMDPNSQNLCDALAHDNDKAATGNNFVMDLHLELIQAQHR-----IAVKLFKLTQDVQMDGKNFRATKSHEKDVNCFHLTETDVMNKVKKNKLSKAIFLMQKAAQMYPKELGSAPQKQLLEEALTLIQKVEAEQNILYFNLKQSTSTEKNRVPPPPILVSRSHCSMTFK---PAPFTSDVQVSWYRIFGCVAAGSNTKVRLNNHHLPNAGEEIPADGKSLLEIKGLNPNEKYIFAVAAYSSDGKLIGDAIGETTKPILAYPPLSATTARAYLTQIAYQTGSYTLAKKAFSPAWNYFVSS-PSLPSADSAVIFSSNNFTISLNRLFLDAVSQASPFFLHLFLRNIF-----------ILNDIHVKEGALFCDSIRFSEILYNEQVARLVECKRMLVAIELSNWLNDANYALQAVVQCYSLLAPIIYHKISSVPVVQILIKCLTVLQELPISTLQRKQAGCYESIQHMIACSSFYTAKVLRSWQEY-ELAIIIINYGKKLLDSSQ------TTSRDHSGVLDGEEMHIDTDAEDESACKKTSQAV-AVEKATENLT----ALESNLLKLTKPG-TGSDLTGQEDPFLLYPLISCWSTKNAYKEVLKFKKKPRFLEFFVQVLHQTLNEEKFQRVLEWAGYVQDSLKRRNHQLLGIKGTSGKEGDGLSVSEDTKRYTTAVVEFQKKSETPTLKNPRKEIVTPARRKDTLRQYYV---------------KRRSIRGKSPEAQRKMQEELQKVAFHTLVTLLNPVVSNHLKRKKFHQACLEEMPWRSQMNIYLAITQFCLFKKKLEDQHNIGVCSLQHLNSYDVLDPEIFSLNNSGIIVVRERQDVNLRAPSYPLLKKSHSEITKGITDHGKFSENSVKMNEVDTPRTQMTNSELSLPISTKEFDQSASSASLL-EHFTKTFLYLRRAVVLAHRGGHWTLLQNACRELW----NYTQEVEVIARHSNSLPLAFP---------ITRGILINTIWFPFYLASDTILDMMNELQTGNSLKIVEPEGDFCVPSCVGGIADEEGGSDFTLHSPLDDVNVIDLKWICHLILKTIELLYKMKKWEALVHIAMQFNIITHERYTEQVTPLLVYAQRQLLERIQ--QFRDPN----SPEPYFI----KNWTDNLDKINCRNYIAK 1743          

HSP 2 Score: 108.227 bits (269), Expect = 3.970e-19
Identity = 206/1004 (20.52%), Postives = 410/1004 (40.84%), Query Frame = 1
Query: 5731 ALNAMGDLYISHLHKPSLALSAWNGSLDCLLNQKQSVKNISQIIGIIDK----DFVKCQFQM--EKLLSKFGGIKCLVIGGLLTKVSR-LDDLTCDERLNICLNAAMFYKAIYSGSFAHPEDDMNYLVHSLYLDAANSIPLVPKXXXXXXXXXXXXEDVESQLYFLITHLVKAGYYQFSICLLSLYEHIVYTISRSSVKSIEAQMIKLEICIRLRRFSTASRLLFQLFTGDKVPQLADSRPAATVTKTPANVYDDQKQLTDEKNLIVLDKIISRRIVPSLAQRLGPTIASKISLLQALFLIELSSCVPVSPEMLDPSRYSSPLQAPVLSKKPTTKKSEPIGIQTEEESHSILDSLASNLQYSTWKD-ISLPILKGLMLHAATAIVHPIIEDFILAIQRE--DFMHLKLNLYEVDNVFFGLLVQARNCRLRLRNRSGARLAMFAGRLL------------KEYFDESISF-DTKSARVFEHLDIFSHMKWNQELVECLLGEVSVENPLDVSETAISDVPPVKDVIISCIGECDGKGLLQHKAWFISALAQYSFISGYEVEKYKAILSESVEIFDNINWLSDHSENAFIVSQLRGINQLISSTDKPDLRRSIVDAEKALRKLHERLLNTIDGKYLQSVMWNVNEPDLSS--VQIANVYDGKLNYLCKIKLLFGIIFMEKSRFATEKQELR--MKALAVLNVGLDICRSLSRRVPWIETEYFLTIGRIQRLLISSGKVSHLSTINTFLEGLRLCVLSTGHLGLKKQFFLELAITFMISSHLVGDSVEKDGEIVESTKLLFNTHQAQMLQNHKISKNEALTFKRLSWLAIKCASSVSDSI---QHLNYCKSDTSKLLSEDAQDNFPISALFDL---YGRFKLGSKRITFKNEIEEELSRMPEYKLLKDNENLDDQLDKIKPYTSRTS-----LSQVLAYHEVLMKLTNNTFLTKSESFELRVKPLTRCIFNDDQFFEKEEEINKFLFQHIPEYRGKCITLIPKDFSNL 8628
            AL+ +G+L++   +K + A   W  +LD  LN    + N  Q +G   K    +F    F+   +K +S+ G   CL    L  K+++ +       R   C+ +A+ +K +++ S  HP  D N+  + +         L+P V++FS+     V  V + LYFL+  L  +      + L +LY++ V  I R  VK IE +++K ++      F+ A   L  L  G++ P    +             +D  K L    NL VL+ I +  + P++       + +K++L +  F+I LS+ +   PE +  + Y   +      KKP       I +  E  S     ++ + +Q    KD +++ +LK  +L  A   ++ ++ +      R+   F  ++L +     +    + Q R+        + + + +F    +            ++Y+ +     D   AR  EHL+    +K    LV  ++ ++       +S+   +D+     +I   I E +  G +  +A  +             V   K  L + + +      +S  +    + S +   + L   T+      S  +    L  L  +L         +SV    ++  L+S  + + N++   +N L K+K+  G + +++    +++++    + AL  L   L++C +   R   +E E F   GR++R +I +G         T L  +++ + +  +  L ++ +LE+A+ +    HL     E   ++  ++K+   T   + L   KI     + +K  +W+AI+ A  VS++    Q L    +     + +  Q   P  A  DL   Y  F      + +KN +   + R  E  + ++ +  +++  +    T R S        ++ YH  L +L + +      S   R    T     D     +  E++ FL +H+P Y   C+   PK+   L
Sbjct: 1901 ALHELGNLHVYAGNKKA-AFKYWCQALDETLNVVDVLNNW-QKLGDFSKNVTGEFTDGSFRALSKKFISEAGVWGCLHAAVLSAKIAQYMLPSNLRMRTKCCIFSALLFKTLFNASLPHPTADCNFAQYEIN-------KLIPGVDLFSDRYRADVPSVVASLYFLMFELHCSKQNLMVLPLFTLYQYFVSEICRDPVKCIEGRILKFKVLTDSGFFTEALNELSLLNHGERTPWKLPTGCRPLGKNMVFQKFDPSKSLLSSVNLQVLEDIFNWNLPPAMISMCNKNLMNKLTLAKMHFIIRLSATINSIPEEVMKTTY---VIDNTSCKKPGRSTDSGIRVNAELNSRKQEQNITT-VQLVRCKDELNMAMLKCFLLTEAEKKLNHLVTNIQNEYDRKISQFSAVELEIVVEAKLEVAAISQQRHQAAFSAALAFSAIRLFQDANIFKKKMTHFQPGKQDYYGKDTQLPDGMVAR--EHLNAHLWLKCRMALVTAVMAQIR-----GISDVKANDMSQCVSLINEVIIEAEAFGDINTQAEMMMQAVILDLHERRPVADIKPRLQDIISLLQKETLISPQAALTLVRSMILLADILAVHTEDDKEYHSSTNEPLNLLILAHKLTVKQMFTLGESVEQQHDDTILTSPVLPLKNLFLPHINLLAKVKMRIGHVLVQEVACTSKREDPLQWLPALRHLEAALELCTTSVTRELDLEAEIFFQKGRVERQIIEAGSNKSPLAAKTLLHAIKVSLQNDQNFELIRKSYLEIALLYF---HLAKCKEEDSQKVNRTSKIKPLT--KEYLSTEKIPHIFEV-YKAQAWIAIRAAMQVSEATVASQLLIGRNTVKGHEVKDVVQQRIPEFASLDLLASYEDFLSDGYDVVYKNLLASSVKR--EENMQREKDQTENEATQCGASTGRQSKPIITWVHLVRYHNYLKQLNSTSPAFGPGSLPARDAFFTSVF--DTGIVLRLTEMHLFLKKHLPLYSTCCLDDFPKELRCL 2874          
BLAST of cilia- and flagella-associated protein 54-like vs. TrEMBL
Match: A0A1L8GY67 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=XELAEV_18017413mg PE=4 SV=1)

HSP 1 Score: 467.618 bits (1202), Expect = 3.458e-128
Identity = 463/1850 (25.03%), Postives = 818/1850 (44.22%), Query Frame = 1
Query:  199 LYEFLIKYENNLPQEFFYKHTMELGDVLLRHGYSLIARNQCYERYLVNV--HNLD-VFHIEXXXXXXXXXXEQIHQTESIVSAIFGLCLAEFRCMEILDKRFQANFHQRKCHCLLTIYRRLMEIILKQERFCWLIYNGSVCIYWISEALIRSGLSMMVVEPLVWASCCLETSIPLLTIFNLKWRAVIYTATCQALFNIQYDSDAEAFARRALVKINELHELYEISSDARSTENAIIFSEAVIKMGVMIFKRNAFETRRRPKTYLRPKTKVNFKEILQNNWPRTGTERILAEMFDSPSQQILAIMEAVKQPSRTIGKIEAPASENEWEMLDVYSELFYAAIAIITGRSTSVIGKSDKALVKEYRIVDVDENTDQLALSVLNGSAITIKATFELVCWAFSYGNWEFLDTILDPL---LAAIKDSKSLSHKLPLENTLKLIRLMRKCFHSSVFVEKKVVKLSEQPIEDDRKQGDTQMNFRAPQXXXXXXXXXXXXXXXXXDNPPADEEEKKGKQSQDPLCQLSELLKEIIATDFNPGNYFQEILVEAGLILWNKCKPIFQTTQDGSLSNEPSKPIPSIGKWIRILDTAYRILSVTEYSTINPISYSEISIRLSVLLEQLS----------------INNWFSTNTS--------EDDNCQELSLESFISQLKTEGTS--KSMKCIAAAKKIMRTSLSQLN-KARNLQNLDKASNQDDKVKLIGNN--LDDLYLELNSIHLRTCAREIVIHLF-----------------------IIGEEIKKMNEIRQSKFYQEAIQFCNKNLLFLAILQAHLGNLLRNNLCLEDRIELVNHIKSLIEKSENNLSDVKLNQKPNSDKM---PAPIIERKGSNYIIVKVDENVPSELKS--KIGWIRLYGRAVDSPNAEVRLTDDKLPGTGVETSCLSTK-FTIYDLTVNEQYILAFSINDKFGSPIGRGIGKSTKYILAIDTINPVTAISIITQILYEMGQKEEVIWYENLLWPQFVEAIPDCVETYQRSVLPRS-SFHKEYKIKVDVLNNSSPMLLRKFCVSVLSAIDCECRILNITNDINVKSHSQMGD-----------QINRLKMVDKLLALFSISKKLKDSLLTMEIFTTVACLLAPIMNQNQFFKPYFSVLSTCVNVLVGLPQTTWIKIPAALKTYIHHLSACIGFYLLKCLNNFPSYGDFSETIRQSVTLLLQMSGNAP-FTVTEQEDTSGTASQIEIKSEKSQINPQK-KVIVKVNKGENSAANFSVQQVAFESFKFTLAKQGLVDHQLSGNEEPDILMAYITLLPSRHAYKEVLKFSRKNRYLQFIVEILHKAVVEGNLENSLNYYREIKEWLKKRNEAILGRSLIQLQSQMNRETIQTKSQNPAVISDNNLFSRS----VRTDEDVEDXXXXXXXXXXXXXXLQSDKAINVLPS-------MSETQKQIQEQAELKALDVLSTTFVSMYKQNLRRRRFRQLSEYERVSRIKMNCSMAMGYLAISHAKVDSLTQILNGGFRFSEVPEIEDITKFMLESTGKILPLDETPI-------PDQISTVLKM-----TKQQTSR----------QTDTPRTYRSDVNVSEKRLFVE--APKLLSQ-LSDAMNKAALLLKRAIVLAARSKVWVLLFKACSLSWYTLSSFINTTNRLTKFLNAAKKDFPEVDWSQIQSFSMNNLFKLYSSV-------FFFGSQSILDMIEVLGKSNLHKISKDFDENFT----------------------------------ENFILKSVHLLFETGSYEKSIHVILRFTSITNYLFVNVTHPILIESQQQLCQKAKDNQAR---NPDWTLQQCEQYV 5274
            L+   +KY+  LP  ++ +  + +GD L++     +A  QCY RYL       +D +  ++                     A+ G C+  ++ +++ D   Q     +KC  +L+  + +M+++L QE+ CWL +NGS+ IY I   L+  G S   +E L+WAS C+E+S+PLL++  L WRA +YTA CQ  ++ Q     E FARRAL KINEL +L  IS+ + S E   +F+EA  KM VMIFKR  FE+RR+PK  LRPK K N K++ +  WPRT TER+L EMFD+ + Q LAI+EA+   +R + +   P   +E E+ DV +ELF+A   I+ G       K  +    +  ++   E    L L++    A++++A  +    AFSY  W+  DTI+  +   L A  ++K    K+ L                        + ++ +P+   +KQ   + + ++ +RS   + K    +     +   D  + +   +QD    L+E +   + +        +EI+V+  L LW KCK   Q  Q         K      KWI IL   Y ++ +      + +  +E +++L+ + E ++                +N+  +T           E +   +L+     ++   +G S  +S  C      ++      L  K ++L+N+  A  Q+   K + NN  + DL LEL     R   +  +++L                        ++  E   + +I+++K   +AI    K +LF       LG++  + L LED  +L+  +++  E++   LS VK ++   S+K    P P++  +  + ++ K     P+  KS  K+ W  L+GR V  P+ +VRL D  L GTG E    S     +  L  NE+YI A +     G  IG  +G+STK ILA   ++     + + Q  Y +G         ++LW  FV   P   +T+   V  R   +  + ++ +DV++ SSP++L+ F  S+            +  DIN+K      D           QI R+   +++L    +S  L D+   ++       L+API+       P   +L  C+ V+  +P +TW +  AA+   + H+ ACI +Y+ K L  +  Y + +  I +    +L +S N   F ++ Q       + +E +  K  ++ +K +++ K  K + S A    +Q++          +      L+G+E+P +L A +   P+  AYKEV+KF +++R+L+F V++L + V E   + +L++   + E LK+RNE +LG S             +T++   A+ SD+  F R     V   +D E         KK + +++ +K     P+       +S++ + + E  E +A   L    + +  + ++ ++       E   R ++N  +A  +  +  +K+D L    +G    S    + D   F L   G ++   ET +       P  +   LK+     TK   S           +TDTPRT  ++          E   P +LS  L D + K  + LKRA+VL+ R++ W L    C + W       N T  L   +               Q+   N  F L S +       F+  + SILDM+ +L  +   K+  D DE F+                                   + +LK++ LL+    +E  +H+ ++F  +T+  +     P+L+ +Q+ L  + ++  ++    P+  +  C +Y+
Sbjct:   56 LFRIWVKYKPRLPTWYYQEKLLNVGDSLVQIKQYKLALFQCYGRYLEQFCSEGIDEITDVKQFKSTFFPDGTDDKNASLTFHALQGRCICLYQLVKMSDLNLQNPESLKKCVNILSFLQLIMQVVLPQEQLCWLTFNGSIHIYTICRHLMVLGYSSKALEYLLWASVCMESSVPLLSVHYLTWRATLYTAVCQCYYDCQAGVHGEVFARRALSKINELSQLENISNSSGSEEAKKVFTEATAKMAVMIFKRAVFESRRKPKGMLRPKQKSNLKDVEKLPWPRTSTERLLVEMFDNGAVQFLAIIEALSDSNRRVLQ-GGPPVPDEPEIHDVIAELFFAGSDIVAGGG----NKGQRGSCGQTELLKWLEQASLLDLALEEKDAVSVEAVVKFAKLAFSYEQWDAFDTIVMQVYTFLQAQDNTKWKEEKMNLN-----------------------ILIAAEPLLSGKKQ---KRHLQSEERSMKILKKSISLAIVHLIDLHGDSTQDR---AQDDHMTLAETVFVSVCSSLQGIQPDREIIVDVILFLWQKCKFALQRIQAADGPKFIHK-CEVNSKWIYILCLIYEVMQLCSIIDTDSVIMAEAALKLAGIAEGIADCIIKYVKKPEKLTEKVNDESATQGPYAAKLIQLEKNPVTQLTFAYETAEKAIKGMSLARSRGCTPDELSVIDHYCVTLGVKRQHLKNM--AVEQNSPSKSLANNGMVMDLQLELIMTQHRVSVK--LLNLLQGRHEQIKSLKSPPTSQGNTDPSVLPTECNIIGKIKKNKL-SKAIFLMQKAVLF----NKGLGSISPSQL-LEDSEKLIRKLEA--EENAVYLSCVKQDRSFGSEKKSVPPPPLLISRTEDSMVFK-----PAPFKSDIKVSWYCLFGRCVTGPDLKVRLKDQHLYGTGEEIPAGSGNLLEVKGLEANEKYIFAVAAYSSEGVLIGDAVGESTKPILAFPALSVPMTWAYLAQSAYHVGNYNMAKKAVSVLWNYFVLQ-PVSPQTHMAVVFARDQDYVSQKRLCLDVISKSSPVMLQHFLTSIF-----------LLTDINIKEGGLFCDCLCNNGVLKKWQICRIAECERMLVALDVSTWLNDASYALQAVVQCYGLIAPIIYHRIPSVPVVQILIKCLAVIQEIPSSTWQRKQAAVTEGVLHMIACIVYYVAKVLRTWEEY-ELAIAIIEDGKKILDISENTSIFYLSSQPKL----NYLETEKAKDIVDKEKVQLMRKCQKKKPSIAEKVSEQLSALELHLQKLTKPSDGADLTGHEDPMLLHAVVACWPTVAAYKEVMKFKKRSRFLEFFVQLLQRVVYEEKFQRALDWANTVLEHLKRRNENVLGIS-------------RTEAAEDAIPSDS--FKRYTAALVEYHKDKEH-----PALKKERKQIKPEKHKESFPTQMRKNTKLSDSHRNLGEDLEKQAFATLRKLLLPVACRYIKHKKLNTFCTEEMPWRSQLNLLLAYIHFNMFRSKLDKLCSNESGWAHNST--RVLDPDLFALHHAGIVVMTTETTVLDEQIGSPGHLHPSLKLDLTSGTKLSDSNDFSEPSTKKTETDTPRTQMTNDTEDSSHTVTEQAQPNMLSVILFDHLGKIYIHLKRAVVLSHRAQHWTLFQNTCRVLW-------NLTLELQLLIK--------------QNEVTNGRFALNSVLNNEIWLPFYLAADSILDMLVILQSTGAVKVV-DCDEAFSVPSCMGGPAYEEGGSNLTFEYPLDDVNVIDMRWMHDLVLKAIELLYRVQRWEALVHLAVQFNLLTHERYTEQVTPLLVHAQRMLIARIQEINSKYVVGPEEKI-NCREYI 1791          
BLAST of cilia- and flagella-associated protein 54-like vs. TrEMBL
Match: A0A2B4RIE9 (Uncharacterized protein C12orf55-like OS=Stylophora pistillata OX=50429 GN=3 PE=4 SV=1)

HSP 1 Score: 445.662 bits (1145), Expect = 1.204e-121
Identity = 415/1635 (25.38%), Postives = 730/1635 (44.65%), Query Frame = 1
Query:  517 KCHCLLTIYRRLMEIILKQERFCWLIYNGSVCIYWISEALIRSGLSMMVVEPLVWASCCLETSIPLLTIFNLKWRAVIYTATCQALFNIQYDSDAEAFARRALVKINELHELYEISSDARSTENAIIFSEAVIKMGVMIFKRNAFETRRRPKTYLRPKTKVNFKEILQNNWPRTGTERILAEMFDSPSQQILAIMEAVKQPSRTIGKIEAPASENEWEMLDVYSELFYAAIAIITGRSTSVIGKSDKALVKEYRIVDVD----ENTDQLALSVLNGSAITIKATFELVCWAFSYGNWEFLDTILDPLLAAIKDSKSLSHKLPLENTLKLIRLMRKCFHSSVFVEKKVVKLSEQPIEDDRKQGDTQMNFRAPQXXXXXXXXXXXXXXXXXDNPPADEEEKKGKQSQDPLCQLSELLKEIIATDFNPGNYFQE--ILVEAGLILWNKCKPIFQTTQDGSLSNEPSKPIPS---IGKWIRILDTAYRILSVTEYSTINPISYSEISIRLSVLLE------------QLSINNWFSTNTSEDD--NCQELSLESFISQL-KTEGTSKSMKCIAAAK--------------------KIMRTSLSQLNKARNL-----------------QNLDKASNQDDKVKLIGNNLDDLYLELNSIHLRTCAREIVIHLFIIGEEI-------KKMNE--------IRQSKFYQEAIQFCNKNLLFLAILQAHLGNLL---RNNLCLEDRIELVNHIKSLIEK--------------SENNLSDVKLNQKPNSDKMPAPIIERKGSNYIIVKVDENVPSELKSKIGWIRLYGRAVDSPNAEVRLTDDKLPGTGVETSCLS-TKFTIYDLTVNEQYILAFSINDKFGSPIGRGIGKSTKYILAIDTINPVTAISIITQILYEMGQKEEVIWYENLLWPQFVEAIPDCVETYQRSVLPRSSFHKEYKIKVDVLNNSSPMLLRKFCVSVLSAIDCECRILNITNDINVKSHSQMGDQINRLKMVDKLLALFSISKKLKDSLLTMEIFTTVACLLAPIMNQNQFFKPYFSVLSTCVNVLVGLPQTTWIKIPAALKTYIHHLSACIGFYLLKCLNNFPSYGDFSETIRQSVTLL-LQMSGNAPFTVTEQEDTSGTASQI---EIKSEKSQINP------QKKVIVKVNKGENSAANFSV-----QQVAFESFKFTLAKQGL--VDHQLSGNEEPDILMAYITLLPSRHAYKEVLKFSRKNRYLQFIVEILHKAVVEGNLENSLNYYREIKEWLKKRNEAILG-RSLI--QLQSQMNRETIQTKSQNPAVISDNNLFSRSVRTDEDVEDXXXXXXXXXXXXXXLQSDKAINVLPSMSETQKQIQEQAELKALDVLSTTFVSMYKQNLRRRRFRQLSEYERVSRIKMNCSMAMGYLAISHAKVDSLTQILNGG------FRFSEVPEIEDITKFMLESTGKIL--------------PLD------ETPIPDQISTVLKMTKQQTSRQTD--TPRTYRSDVNVSEKRLFVEAPKLLSQLSDAMNKAALLLKRAIVLAARSKVWVLLFKACSLSWYTLSSFINTTNRLTKFLNAAKKDFPEVDWSQIQSFSMNNLFKLYSSVFFFGSQSILDMI 4995
            +C   L + R   +  L +E  CWL++NG+V IY I   L+  G S   +E L+WA  CLE+S+PLLT+  L WR+ +YTA CQ  F+++    AE+FA+R L K+NEL E+  +S+   + E+   F +A  KM +M+FKR  FETR+RPK  LRPKTK N K+   + WPRT TER++ ++    + + LAI+EA+ +  R     EAP  + E   +DV +ELF+A + II G      G   K  VK   ++       +NT  + L     + + + A  + V  AFSY +WE    +++P L  +++   ++  + ++ TL+L+ L  + F+++V   KK +  +E+        G+T ++                                K   + + L  L++++       F      ++  ++V+A L LW+KCKP FQ     SL N   K + +     +W+ IL   +  LS +  +  +PI  +E++++ ++LLE               I    +T  S +   N QE +      +L K  G+ +S+   A+ +                     I+   L  + KAR+                   ++ K   +DD  + + +NL +  +E   + L      I + L  +G+E        KK  E        ++ S    E +  CN+N L  A+L+ H+       ++++  E + +L+   + LI K              +E+  SD+     P+SD  PAP++  + S  ++ K     P +   K+ W RL+ R+    N +VRL D +LPGTG E    +  KF +  L  +E+Y+ A +  ++ G  IG  IG + + ILA   +  + A   + Q+ +  G         ++LW  FV+    C E+          +    ++  + L   SP+L R F  S+  ++D   R  ++  D    +    G Q+ RL+  ++LL    ++  L D+ L ++       LLAP+++Q    KP   VL  C  VL  +P  T  +   +    + H+ A + +Y+ K L  +   G  +  I     +L L+ + ++  T+T  +  +  A+      + S+ ++  P      +      + K E  AA F+      +  A E++   L++Q L   D +L+G+E+P +L + +  LP++ AYKEVLKF R+ R+L F V++L KA+ EG  E +L++  +   W+ +RNE +L  +S I  Q+ +    E  + K    ++I  +   +RS++     E        K++ +  +++ +     P  S+ +  +      KA++ L ++    ++ + RR++ R +S  E   R +M   +A     +   KV+S  ++ + G      +R    P   D   F   ++G ++              P+       +TP  +   T  +   ++ +R     T  T      VS+  +F     LLS L          L RAIVL  R K W +L  AC   W       N T  +   + A      E   ++  S  ++ L K     F+FG+  +LDM+
Sbjct:  154 QCVAALKVLRLTTQTSLHKEELCWLVFNGTVHIYSICRHLMACGHSSKALEFLLWACMCLESSVPLLTVKYLTWRSTLYTAVCQCYFDLKVPMHAESFAKRGLGKVNELQEIESMSTSEATPESEAAFRQAKTKMQIMVFKRVVFETRKRPKGLLRPKTKPNLKDFAHHAWPRTPTERLMTDL-QGTAAKFLAILEALSETHRRTLYCEAPTPDAEDTAIDVCAELFFAGMEIIAG------GGGIKQAVKHDGVIHPSVLELQNTSIMELVTKGENGVPLPALVKFVKHAFSYEHWEPFGQLIEPTLQLLQEQSDINSLVDIK-TLQLM-LALEPFYNTVKKTKKTLAQAEE--------GETGLHAHV-----------------------------KSGSALEELTHLADVIHSCSEEPFKSAILMKDNDMMVDAALFLWSKCKPHFQRILSPSLEN--CKQLLNDVFFNRWLYILTVVHTALSWSNAALFDPILSAEVTLKFALLLECKAGVTHNSRVGSTDIMETLATPVSSEQVANKQEKAEADLAEKLAKDPGSLRSLSTDASKQMIVAMGGVSVGVREVLIKVLGILDQGLRDITKARDTVIDTRKRNIADISWIKPPSVSKPRREDDGTEPLESNLLERMIEALHMELLFVRHRIAVKLINLGQEPTEPKRLPKKQKEKPNTSATSLKFSDAENELLSECNRNPLSKALLRMHMAGQAVTSQSHVGTERQTQLLKESQELIVKCQQQERKVSSWNRQAEDTSSDI-----PSSDVPPAPLLVYRSSAVLVFKPAPFEPQK-GEKVAWYRLFARSASGNNVKVRLNDYQLPGTGEEIPATTDVKFYVRGLKADEKYMAAVAAYNEHGKLIGGSIGLTCRPILAAHPLPTLMAWGYLAQLSFASGVLSVAKSAASVLWNHFVKEREICEESTNIKTASSDLWISLQRVDEERLQECSPVLARLFLQSIFISVDIRIREGHLFCDCLCDNGPLYGGQVARLEECERLLLAIQVAGWLNDTALCLQAVIQCYGLLAPLIHQKIPAKPVVQVLLRCHAVLQEVPSLTRHRKSLSTSDSLSHMIATMTYYIAKILQMWNEQGVAAAIIELGKKMLSLETAPDSAGTMTTMQAATAMATVTLGGPLPSKSTKKKPGATKKPKVGGGKGLGKLEKEAAAFTADAQNEELKALEAYILKLSQQALNRDDEELTGSEDPSVLHSVVANLPAQQAYKEVLKFKRRTRFLGFYVQVLAKALQEGLTEAALDWSNDTMTWIVRRNEMLLANKSTIVRQVAATAGPEEEKIKKFATSIIEFSKPITRSLQKTRHEE---TRDGEKEETEIVVRNKQETGSRPPPSQKKSLVLSTVAGKAVERLQSSLPEYWRSSQRRKKLRAVSCEELPWRAQMGILLAGANFDLFLDKVESGQRLADAGDAKNPFYR----PSYMDPDWFGYGTSGTLIVSWAGASRRASPEPPMGFSGSAIDTPYSEHSPTGSRSHLRERARTGSKVTGVTGSEVSTVSKSPMFF----LLSALDH--------LSRAIVLTYRGKYWTMLQNACRALW-------NMTQTVLMRVVAGTLHLAEDPLAE-GSTDIDVLRKALWQKFYFGADRLLDMM 1707          

HSP 2 Score: 98.9821 bits (245), Expect = 2.165e-16
Identity = 78/311 (25.08%), Postives = 154/311 (49.52%), Query Frame = 1
Query: 5725 SFALNAMGDLYISHLHKPSL--ALSAWNGSLDCLLNQKQSVKNISQIIGIIDKDFVKCQFQMEKLLSKFGGIKCLVIGGLLTKVSR-LDDLTCDERLNICLNAAMFYKAIYSGSFAHPEDDMNYLVHSLYLDAANSIPLVPKXXXXXXXXXXXXEDVESQLYFLITHLVKAGYYQFSICLLSLYEHIVYTISRSSVKSIEAQMIKLEICIRLRRFSTASRLLFQLFTGDKVPQLADS--RPAATVTKTPANVYDDQKQLTDEKNLIVLDKIISRRIVPSLAQRLGPTIASKISLLQALFLIELSSCVPVSP 6642
            S A  AM +L     H  ++  A   W  SLD +LN   S+K    +    D            LL + G   CL+ G L + +++ +       RL  CL +A  +KA++  S  HP  + +Y ++ +         L+P +++ S++   +   V + L ++   L +A Y    + L++L  +    ++R   +S++A+++++ +   L  FS A+++L  L  G+K+P+++D   R     T TP  V+++++ L  E+NL VL+ ++  R+ PSL+   GP +  ++++  A  +I +++ V   P
Sbjct: 1999 SLAAQAMHELGNIMFHSGNIRAAYKWWAESLDTILNTVDSLKTWRDLTSSSDTLLKPGA----ALLQRCGLWGCLLGGVLASNIAQYIHTSNLGLRLECCLLSATLFKALFCSSLPHPTAEKDYALYEVGA-GCEVAELIPGIDLLSDAFRSNGRSVLAALRWITEELTRARYLIMVLPLITLCLYFSTHVARDLQRSVDARILRVRVLTDLGMFSEAAKVLTSLLRGEKLPKVSDGGFRTVENET-TPPPVFNNRESLMSEENLTVLNYLLDHRLQPSLSVLYGPQLTGQLTIAHAHLMIAIAATVYAIP 2303          
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Cavefish
Match: ENSAMXT00000057325.1 (pep primary_assembly:Astyanax_mexicanus-2.0:7:3659393:3666271:1 gene:ENSAMXG00000043566.1 transcript:ENSAMXT00000057325.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 180.644 bits (457), Expect = 2.489e-47
Identity = 117/364 (32.14%), Postives = 186/364 (51.10%), Query Frame = 1
Query:  436 AIFGLCLAEFRCMEILDKRFQANFHQRKCHCLLTIY---RRLMEIILKQERFCWLIYNGSVCIYWISEALIRSGLSMMVVEPLVWASCCLETSIPLLTIFNLKWRAVIYTATCQALFNIQYDSDAEAFARRALVKINELHELYEISSDARSTENAIIFSEAVIKMGVMIFKRNAFETRRRPKTYLRPKTKVNFKEILQNNWPRTGTERILAEMFDSPSQQILAIMEAVKQPSRTIGKIEAPASENEWEMLDVYSELFYAAIAIITGRSTSVIGKSDKALVKEYRIVDVDENTDQLALSVLNGSAITIKATFELVCWAFSYGNWEFLDTILDPLLA--AIKDSKSLSHKLPLENTLKLIRLMRKC 1512
            A+ G CL EF     L++   +  H+     LL I    R +M+ I+  E  CW++YNGS+ IY I   L+    S   +E L+WA   LE SIPLL    L WRA +Y A C+  ++ Q    AE FARRAL KI+EL  L ++S    S E    F EA IK+ VM+FK++ +E+RR+ + Y R + + +FKE    +WPRT TER+L E+F+  + Q LA++EA++  SR   ++      ++ E+ +V  EL  A I+I++G S   +                        L+    + I++ A  + V   F+Y  W+   ++   L+   ++ + KS+      +  L L++ +  C
Sbjct:   88 ALQGECLCEF----YLEREQYSAPHKSGVQKLLAILAFLRLMMQAIMPHENLCWILYNGSLHIYNICRFLMSVSHSAQALEYLLWACVSLELSIPLLMPRFLPWRATLYCAVCECYYDGQAGVQAEVFARRALGKISELATLEDMSGSLSSAETQRAFKEATIKLAVMVFKQSVYESRRKNRGYFRAERRRSFKESHNISWPRTLTERMLMELFEGNAAQFLAVLEALRVSSR---RLMHTGFSDKPEVQEVVLELMSAGISILSGTSLLTV------------------------LNCFRENLISVDAAVKFVKLLFTYEQWDTFCSLSKSLVTVLSVSEDKSVDQFAMTDELLNLVQTLHVC 420          
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003656.1 (pep scaffold:Pmarinus_7.0:GL476695:215738:229256:1 gene:ENSPMAG00000003342.1 transcript:ENSPMAT00000003656.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 200.29 bits (508), Expect = 7.985e-56
Identity = 138/429 (32.17%), Postives = 227/429 (52.91%), Query Frame = 1
Query:  199 LYEFLIKYENNLPQEFFYKHTMELGDVLLRHGYSLIARNQCYERYL----VNVHNLDVFHIEXXXXXXXXXXEQIHQTESIVSA--IFGLCLAEFRCMEILDKRFQANFHQRKCHCLLTIYRRLMEIILKQERFCWLIYNGSVCIYWISEALIRSGLSMMVVEPLVWASCCLETSIPLLTIFNLKWRAVIYTATCQALFNIQYDSDAEAFARRALVKINELHELYEISSDARSTENAIIFSEAVIKMGVMIFKRNAFETRRRPKTYLRPKTKVNFKE--ILQNNWPRTGTERILAEMFDSPSQQILAIMEAVKQ-------PSRTIGKIEAPASENEWEMLDVYSELFYAAIAIITGRSTSVIGKSDKALVKEYRIVDVDENTDQLALSVLNGSAITIKATFELVCWAFSYGNWEFLDTILDPLLAAIK 1440
            L+    KYE+ +  E F    +  GD+L+      +A N CY RYL     ++H++      L++L +     +   ++ +++A  + G C  +F    +L         +R C  LL + R L + +L+ E+ CWL+YNG+V IY IS  L+  G S  V E L+WAS C+E+S+PLL +  L WRA +YTA CQA +N +  + AE FARR L KI EL EL   SS   S +    F +A IKM +MIFK   FE+R++PK +LR + K N ++  I Q  WPRTGTER+L+E+ +  + Q++A+++A+         P    G   +PA+  + +  +V++ELF+A   II   + +    ++K  ++   ++                S ++++AT   +  AF    W+  + ++ P L  ++
Sbjct:    2 LFAIWNKYEHKISTELFRNKLLSTGDILVELKNHKMALNLCYGRYLQYIYPSLHDIG----NLNELMARFFPREFGDSDCVLTARALLGFCTCQF---ALLVAGGGGGEMKRGCLQLLFLLRLLTQALLQDEKLCWLLYNGTVHIYTISRHLMEHGHSAKVCEYLLWASVCMESSVPLLDVRYLSWRATLYTAVCQAYYNCKLPAQAEEFARRGLAKIAELSELESQSSSPHSKQAESAFRDATIKMAIMIFKHTVFESRKKPKGFLRTRMKTNLRDPKIAQAAWPRTGTERLLSELLEGGAAQMVAVLDALSHRAAEECAPHALAG---SPAAAFDHDSAEVFAELFFAGAEIIAVLNNTSF--NNKCSIQTKVVLRHKAECT---------SPLSMEATVRFLKLAFMCERWDIFEGLISPTLGYLQ 409          
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005611.1 (pep scaffold:Pmarinus_7.0:GL477691:65:5267:1 gene:ENSPMAG00000005100.1 transcript:ENSPMAT00000005611.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 2.131e-14
Identity = 64/246 (26.02%), Postives = 121/246 (49.19%), Query Frame = 1
Query: 5731 ALNAMGDLYISHLHKPSLALSAWNGSLDCLLNQKQSVKNISQIIGIIDKDFVKCQFQMEKLLSKFGGIK-CLVIGGLLTKVSRLDDLTCD--ERLNICLNAAMFYKAIYSGSFAHPEDDMNYLVHSLYLDAANSIPLVPKXXXXXXXXXXXXE--DVESQLYFLITHLVKAGYYQFSICLLSLYEHIVYTISRSSVKSIEAQMIKLEICIRLRRFSTASRLLFQLFTGDKVP-------QLADSRP 6432
            AL+ +G+L+    +    A + W+ +LD  L     + + S  +        +       +L + GG++ CL+   L +K+++   LT D   R+   + ++M +KAI+  S  HP+ D++Y  + +     + +P V  +      S  S++   + S L FL  HL +AG     + LL+LY+H+V +I R   +S+E +++K+ +   L  F  ASR +  +  G+K+P       +  DS+P
Sbjct:   69 ALHELGNLHYHSGNTSRAAFTCWSHALDAALGISDCLGSWSDAVARAAGK--EASGDASSVLLRLGGVRGCLLAAVLASKIAQFI-LTADFAVRIRCSVLSSMLFKAIFRASLPHPKADVDYARYEVDGGQGSPVPGVEPLTPSPTPSGGSLDVGTIVSCLSFLARHLHRAGLLLPVLPLLALYQHLVCSICRDVQRSVEGRLLKVNVLTDLALFGDASREMCTVLLGEKLPLPVFPGFRATDSKP 311          
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Nematostella
Match: EDO48350 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJC2])

HSP 1 Score: 426.787 bits (1096), Expect = 1.195e-119
Identity = 401/1612 (24.88%), Postives = 690/1612 (42.80%), Query Frame = 1
Query:  193 NKLYEFLIKYENNLPQEFFYKHTMELGDVLL---RHGYSL--------------IARNQCYERYLVNVHNLDV------FHIEXXXXXXXXXXEQIHQTESIVSAIFGLCLAEFRCMEILDKRFQANFHQRKCHCLLTIYRRLMEIILKQERFCWLIYNGSVCIYWISEALIRSGLSMMVVEPLVWASCCLETSIPLLTIFNLKWRAVIYTATCQALFNIQYDSDAEAFARRALVKINELHELYEISSDARSTENAIIFSEAVIKMGVMIFKRNAFETRRRPKTYLRPKTKVNFKEILQNNWPRTGTERILAEMFDSPSQQILAIMEAVKQPSRTIGKIEAPASENEWEMLDVYSELFYAAIAIITGRSTSVIGKSDKALVKEYRIVDVDENTDQLALSVLNGS-AITIKATFELVCWAFSYGNWEFLDTILDP---LLAAIKDSKSLSHKLPLENTLKLIRLMRKCFHSSVFVEKKVVKLSEQPIEDDRKQGDTQMNFRAPQXXXXXXXXXXXXXXXXXDNPPADEEEKKGKQSQDPLCQLSELLKEIIATDFNP--GNYFQEILVEAGLILWNKCKPIFQTTQDGSLSNEPSKPI---PSIGKWIRILDTAYRILSVTEYSTINPISYSEISIRLSVLLEQLSINNWFSTNTSEDDNCQELSLESFISQLKTEGTSKS-------------------------MKCIAAAKKIMRTSLSQLNKARNLQNLDKA------------------SNQDDKVKLIGNNLDDLYLELNSIHLRTCAREIVIHLFIIGEEIKKMNEIRQSKFY-----------------QEAIQFCNKNLLFLAILQAHLGNLLRNNLCLEDRIELVNHIKSLIEKSENNLSDVKLNQKPNSDKM-------PAPIIERKGSNYIIVKVDENVPSELKSKIGWIRLYGRAVDSPNAEVRLTDDKLPGTGVETSCLS-TKFTIYDLTVNEQYILAFSINDKFGSPIGRGIGKSTKYILAIDTINPVTAISIITQILYEMGQKEEVIWYENLLWPQFVEAIPDCVETYQRSVLPRSSFHKEYKIKVDVLN-----NSSPMLLRKFCVSVLSAIDCECRILNITNDINVKSHSQMGDQINRLKMVDKLLALFSISKKLKDSLLTMEIFTTVACLLAPIMNQNQFFKPYFSVLSTCVNVLVGLPQTTWIKIPAALKTYIHHLSACIGFYLLKCLNNFPSYGDFSETIRQSVTLLLQMSGNAPFTVTEQEDTSGTASQIEIKSEKSQINPQKKVIVKVNKGENSAANFSVQQV----------AFESFKFTLAKQGLV--DHQLSGNEEPDILMAYITLLPSRHAYKE-----------------VLKFSRKNRYLQFIVEILHKAVVEGNLENSLNYYREIKEWLKKRNEAILGRSLIQLQSQMNRETIQT-----KSQNPAVISDNNLFSRSVRT-----DEDVEDXXXXXXXXXXXXXXLQSDKAINVL---PSMSETQKQIQEQAELK------------ALDVLSTTFVSMYKQNLRRRRFRQLSEYERVSRIKMNCSMAMGYLAISHAKVDSLTQILNGGFRFSEVPEIEDITKFMLESTGKIL 4551
            N L+     +E  LP +FF +  +  GD L+   R G +               IA+ QCY RYL ++  L+       + +E  +     S  +    E  + A+ G  ++ +  +   D + Q          +L I R + +  L +E FCWL++NG+V IY IS  L+  G S  V+E L WA  C+E+S+PL+T+  L WR+ +Y ATCQ  ++++  + AE+FARR L K+NEL ++  +S+   +   A  F +A  +M VM+FKR  FETR+RPK  LRPKTK N K+ +   WPRT TER+LA+ F   + Q LAI+EA+ + +R     EAPAS+ E  + DV +ELF+A + +I G        + K   +E     VD     L   V  GS  I ++A  + V  AFSY  WE  +T++ P   LL  + DS  L        TL+L+  +   F S+   +K  V   ++   D   QG                                     KG    D L +L++ L       +    G+   +++++A L LW+KCK  FQ     S+  E  K +    +  KW+ ++   +  LS ++  T +PI ++E++++L+++LE  + N    +    +     L+ E    ++ T+   K                             +  ++ I+R +   + KAR+   +D +                   +      L+   L  L++EL  +H R     + + L  +G + +        K                    E + FC KN ++ A+L  H  +        E++ +L+     LI+K++     +    +P+SD+        PAP++  +  + +I +     P      + W RL+GR+    N +VRL D +LPGTG E       +  +  L  NE+Y+ A +  ++ G  IG+ IG S++ +LA   +  + A   + Q  Y             +LW  FV      V       L       + KIK+  LN      SSP+L+R+F  ++  ++D   R   +  +    S      Q+ RL   ++LL    ++  L D+ L+++       LLAP+++Q    KP   +L  C  VL  +P  T  +   A+   + H+ A + +++ K L+++   G  S  I +    +L +   AP +          A+             +K V+ K       A +   QQ           A E++   L+++ L   D +L G E+P++L +YI  LP++ AY E                 VLKF R+ R+L F V++L KA+ EG +E +L++  +   W+      I    LI  + +++   I+T       +N  ++++     R+  T     DE ++          K   K Q  +A+      P    T+ +++     K            A++ + T     ++ + RRR+ R +S  E   R+++N   A+  + +   K  SL+  L   +R    P + D   F   ++G  +
Sbjct:   73 NTLFNLWNNFEQRLPHDFFVQQMIATGDYLVSIRRMGITHTLLSMHTCILTEYKIAQCQCYGRYLSSIRGLNTLESCSDYTLESFNNVYLPSGIEAATAEIALRALLGESISSYHVVIAEDPKLQNPETVSLSVDILKILRLITQAALHKESFCWLVFNGTVHIYSISRHLMALGYSNKVLEFLQWACMCMESSVPLMTVRYLIWRSTLYAATCQCYYDMKAANHAESFARRGLTKVNELEDIERMSTSDATPMVARAFRQAKTRMQVMVFKRVVFETRKRPKGLLRPKTKPNLKDTVNQPWPRTPTERLLADQFTGTAAQFLAILEALSESNRRTLHCEAPASDAEDTITDVCAELFFAGMELIAGGGGPRQTHAAKH-QQEIHPSVVDFGAQGLMALVQEGSNGIPLQAVVKFVKQAFSYEQWETFNTLISPTLELLKQMTDSTGLMDT----KTLELMAALEPFFSSTPKPKKAAVTTQDE--SDSHTQG-------------------------------------KGGSHVDDLMKLADTLHSCSVEPYKSIVGHMDPDMVIDAALFLWSKCKIHFQRVVSSSM--EGCKFVLNDQNADKWVHMITVVHTALSWSDACTFDPILFAEVALKLALVLECKAANLADHSGGELESPKPALTAEERKDKVSTDAADKPSTPRSNTAASDHSLLLAGEGYPPGVRGVLTKSRDILRQAYEGMVKARD-SVIDSSGETIADIAWIKSPSPTLRGDGAPTASLMDTILKALHMELLFVHHR-----VALKLVALGSDPRSQRSTAAKKQKPDKSGTAAPTAVMSDEETELMAFCGKNPMYKALLLMHQASRATTR-GTEEQTQLLKESMDLIQKAQQRDRKLASWNRPSSDETAPSPDVPPAPLLLYRSPSVMIFRPAPYSPK--GETVAWYRLFGRSASGHNVKVRLNDYQLPGTGEEIPATDKCRLMVKSLVPNEKYVFAVAAYNRQGQLIGKTIGSSSRPVLATHPLPTLMAWGYLAQTAYIANIPSVAKVACTVLWDYFV-----TVRQPTEEELRIKKADSDIKIKLKTLNEDRLFESSPILVRQFLQTLFISVDFSIREGFLYCNSLSDSGPLYSGQVARLAECERLLLAVQVAGWLNDTALSLQAIVQCYGLLAPMVHQQIAAKPVIQILLRCHAVLQEVPSLTRHRRQTAISDSLSHMIATMTYFIAKTLHSWGEPG-ISGAIIELGKKMLNLD-TAPDSAGTMTTMQAAAAMATANMVGGPPGKKKPVVKKPKPPRGKAVDKDTQQAPGDVNLEEMKALEAYIMKLSQKALHRDDEELMGTEDPNLLYSYIASLPTKDAYFEVVLFPIILYNSPIKESQVLKFKRRTRFLGFFVQVLSKAIDEGMMETALDWTHDAMTWV------ISVLILIDTEFELSICAIRTIMFGIAERNELLLANKPTIVRTAATAIGPEDEKIKKFAMAIVEFGKPPQKSQKSEAVERELNDPDEIRTRTKLETARTSKPKSLVPSIMSRKAVERMQTILPDFWRSSQRRRKLRSVSNEELPWRVQLNYLTAICNMELFLDKTGSLSNDLGPLYR----PSLMDPDWFSFATSGTFI 1612          

HSP 2 Score: 114.39 bits (285), Expect = 7.656e-25
Identity = 167/780 (21.41%), Postives = 330/780 (42.31%), Query Frame = 1
Query: 5725 SFALNAMGDLYISHLHKPSL--ALSAWNGSLDCLLNQKQSVKNISQIIGIIDKDFVKCQFQMEKLLSKFGGIKCLVIGGLLTKVSR-LDDLTCDERLNICLNAAMFYKAIYSGSFAHPEDDMNYLVHSLYLDAANSIPLVPKXXXXXXXXXXXXEDVESQLYFLITHLVKAGYYQFSICLLSLYEHIVYTISRSSVKSIEAQMIKLEICIRLRRFSTASRLLFQLFTGDKVPQLADSRPAATVTKTPANVYDDQKQLTDEKNLIVLDKIISRRIVPSLAQRLGPTIASKISLLQALFLIELSSCVPVSPE----------------MLDPSRYSSPLQAPVLSKKPTTKKSEPIGIQTEEESHSILDS-LASNLQYSTWKDISLPILKGLMLHAATAIVHPIIEDFILAIQREDFMH---LKLNLYEVDNVFFGLLVQARNCRLRLRNRSGARLAMFAGRLLKEY-FDESISFDTKSARVFEHLDIFS-HMKWNQELVECLLGE--------------VSVENPLDVSETAISDVPPVKDVIISCIGECDG---KGLLQHKAWF-ISALAQYSFISGYEV---EKYKAILSESVEIFDNINWL--------SDHSENAFIVSQLRGINQLIS-STDKPDLRRSIVDAEKALRKLHERLLNTIDGKYLQSVMWNVNEPDLSSVQIANVYDGKLNYLCKIKLLFGIIFMEKS-RFATEKQELRMKALAVLNVGLDICRSLSRRVPWIETEYFLTIGRIQRLLISSGKVSHLSTINTFLEGLR 7896
            S A  AM +L     H  ++  A   W  +LD +LN +  +K    I+   +          E LL + G   CL+ G L   +++ +       R   CL +A  +KA+   S  HP DD +Y ++ +      S  L+P V++ S+        V + L ++   L +A +   ++ L+SL  +    + R   ++++ +++++ I   L +F+ AS++L  L  GD +P+ +D    +   K     ++++KQ+ D  N+ VL++++ RR+ P+L+   G  ++ ++S+  A FL+ L+S + V  +                 + P+       AP   KK   +KS        +++ S+  S +A   +    K+ SLP++KG +L  A +++  + +      + +D      L ++  +++ +    L  +   R    + + A L   A R L++      +  D +S  +F    I S H      +V  L+ +              +++   L   ++ +  +      + S IG CD    +GL + +A+  +   AQ+S +         K+   L   +E  D I WL        S     A  V Q   I Q  S + D P L+  +   ++A   L  +LL     +  +S+    + P L    + N+Y  +L ++  IKL  G      +            +++  L +GL + R ++ +   +E +   ++G+IQR +  +G         T +E ++
Sbjct: 2071 SLAAQAMHELGNIMFHSGNIRAAYKWWAEALDTILNTQDCLKTWRDIVSGEEHKQTG-----EVLLQRCGIWGCLLAGVLAANIAQYIHTSNLGLRQECCLLSAALFKALLRSSLPHPTDDKDYALYEIGA-GHGSADLIPGVDLLSDVFRSDGRSVVASLRWVAEELARAQHLLTALPLVSLCLYFTSRVCRDVQRTVDVRILRVRILTDLGKFADASKVLSDLLIGDGLPRTSDDGNKSIKDKQKIPTFNNRKQILDPGNIEVLNELLERRLTPALSSLYGQPLSGQLSVAHAHFLVALASSINVIADDVREELQRYQNEKEEAEVPPTPRGGMPPAPSFIKKTAKQKS-------SDDTLSVKSSFIAIKKKLLDAKNSSLPVIKGFLLFTAESMLDNLCDSLTEKTEEQDLEEESALNMSPSDLELLVLAKLELSAIARQCYHSVTSASLVYSAMRTLEDVSILSELDIDKRSPSLFITSPIRSAHTTARPTMVHYLVAQARCRLDARLWLTCRLALALSLSGEDSGMGKLGGTTRSVTSFIGSCDHHCRQGLDESEAFGDVELTAQFSMLETVHALHQGKFSQELLHKLE--DVIAWLERSQSLSFSGQQLLAMAVVQFADIGQQPSVACDLPYLKGILPAYKQACDILLGQLL-----EVGESIDLVTSSPVLP---LKNLYLSQLPHIVDIKLRLGRALARNAVDLNANVAPAWGESVRELELGLGLARGIAYQRQSVEAQLLFSLGQIQRQMFCTGATPDHVVPATLVEAIK 2827          
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Medaka
Match: ENSORLT00000007417.2 (pep primary_assembly:ASM223467v1:14:13217858:13221656:1 gene:ENSORLG00000005899.2 transcript:ENSORLT00000007417.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.1073 bits (196), Expect = 4.015e-15
Identity = 59/197 (29.95%), Postives = 92/197 (46.70%), Query Frame = 1
Query:  652 SMMVVEPLVWASCCLETSIPLLTIFNLKWRAVIYTATCQALFNIQYDSDAEAFARRALVKINELHELYEISSDARSTENAIIFSEAVIKMGVMIFKRNAFETRRRPKTYLRPKTKVNFKEILQNNWPRTGTERILAEMFDSPSQQILAIMEAVKQPS------RTIGKIEAPASENEWEMLDVYSELFYAAIAIITG 1224
            S   +E L+WAS  +E S+PL+T   L     +Y A C   ++ Q  + AE   R  L   +++   +  S     + +  +    + ++G ++FKR  FE+RR       PK K   +      WPRT TE++L  MFDS + Q LAI+EA+   S      R +G           E+ +   EL  A I I++G
Sbjct:  146 SFQALEYLLWASISVELSVPLMTAKYLPLSVTLYCAVCHCYYDNQAGTKAEV--RSRLSASDQISGGFYQSIHRLGSLHLFL----LFQLGALVFKRAVFESRR-------PKYKTRIQP-----WPRTSTEKLLTSMFDSCAGQFLAILEALWDSSARPLQMRMLGDA---------ELQETALELLSAGICILSG 315          
BLAST of cilia- and flagella-associated protein 54-like vs. Planmine SMEST
Match: SMESG000072637.1 (SMESG000072637.1)

HSP 1 Score: 6294.53 bits (16329), Expect = 0.000e+0
Identity = 3149/3149 (100.00%), Postives = 3149/3149 (100.00%), Query Frame = 1
Query:   28 MSSNLFNKALKNIKTKDNLNKINCSEDEINENLKKSFEFELKNITKTIQLQKLLPNKLYEFLIKYENNLPQEFFYKHTMELGDVLLRHGYSLIARNQCYERYLVNVHNLDVFHIEXXXXXXXXXXEQIHQTESIVSAIFGLCLAEFRCMEILDKRFQANFHQRKCHCLLTIYRRLMEIILKQERFCWLIYNGSVCIYWISEALIRSGLSMMVVEPLVWASCCLETSIPLLTIFNLKWRAVIYTATCQALFNIQYDSDAEAFARRALVKINELHELYEISSDARSTENAIIFSEAVIKMGVMIFKRNAFETRRRPKTYLRPKTKVNFKEILQNNWPRTGTERILAEMFDSPSQQILAIMEAVKQPSRTIGKIEAPASENEWEMLDVYSELFYAAIAIITGRSTSVIGKSDKALVKEYRIVDVDENTDQLALSVLNGSAITIKATFELVCWAFSYGNWEFLDTILDPLLAAIKDSKSLSHKLPLENTLKLIRLMRKCFHSSVFVEKKVVKLSEQPIEDDRKQGDTQMNFRAPQXXXXXXXXXXXXXXXXXDNPPADEEEKKGKQSQDPLCQLSELLKEIIATDFNPGNYFQEILVEAGLILWNKCKPIFQTTQDGSLSNEPSKPIPSIGKWIRILDTAYRILSVTEYSTINPISYSEISIRLSVLLEQLSINNWFSTNTSEDDNCQELSLESFISQLKTEGTSKSMKCIAAAKKIMRTSLSQLNKARNLQNLDKASNQDDKVKLIGNNLDDLYLELNSIHLRTCAREIVIHLFIIGEEIKKMNEIRQSKFYQEAIQFCNKNLLFLAILQAHLGNLLRNNLCLEDRIELVNHIKSLIEKSENNLSDVKLNQKPNSDKMPAPIIERKGSNYIIVKVDENVPSELKSKIGWIRLYGRAVDSPNAEVRLTDDKLPGTGVETSCLSTKFTIYDLTVNEQYILAFSINDKFGSPIGRGIGKSTKYILAIDTINPVTAISIITQILYEMGQKEEVIWYENLLWPQFVEAIPDCVETYQRSVLPRSSFHKEYKIKVDVLNNSSPMLLRKFCVSVLSAIDCECRILNITNDINVKSHSQMGDQINRLKMVDKLLALFSISKKLKDSLLTMEIFTTVACLLAPIMNQNQFFKPYFSVLSTCVNVLVGLPQTTWIKIPAALKTYIHHLSACIGFYLLKCLNNFPSYGDFSETIRQSVTLLLQMSGNAPFTVTEQEDTSGTASQIEIKSEKSQINPQKKVIVKVNKGENSAANFSVQQVAFESFKFTLAKQGLVDHQLSGNEEPDILMAYITLLPSRHAYKEVLKFSRKNRYLQFIVEILHKAVVEGNLENSLNYYREIKEWLKKRNEAILGRSLIQLQSQMNRETIQTKSQNPAVISDNNLFSRSVRTDEDVEDXXXXXXXXXXXXXXLQSDKAINVLPSMSETQKQIQEQAELKALDVLSTTFVSMYKQNLRRRRFRQLSEYERVSRIKMNCSMAMGYLAISHAKVDSLTQILNGGFRFSEVPEIEDITKFMLESTGKILPLDETPIPDQISTVLKMTKQQTSRQTDTPRTYRSDVNVSEKRLFVEAPKLLSQLSDAMNKAALLLKRAIVLAARSKVWVLLFKACSLSWYTLSSFINTTNRLTKFLNAAKKDFPEVDWSQIQSFSMNNLFKLYSSVFFFGSQSILDMIEVLGKSNLHKISKDFDENFTENFILKSVHLLFETGSYEKSIHVILRFTSITNYLFVNVTHPILIESQQQLCQKAKDNQARNPDWTLQQCEQYVTDCQSKMKVDHLDSSNYQQFLNKILSGYFGRKKLYQSKSKVLRKVQQSEHEDLYVNNLLNILKSEASSNLIFSVPVRPEVSHKEWVTYQNVRSIKREWMELYYKRNYFDYLHSSDCITVGNNHKMNLQELLTSYKEFXXXXXXXXXXXHYSFALNAMGDLYISHLHKPSLALSAWNGSLDCLLNQKQSVKNISQIIGIIDKDFVKCQFQMEKLLSKFGGIKCLVIGGLLTKVSRLDDLTCDERLNICLNAAMFYKAIYSGSFAHPEDDMNYLVHSLYLDAANSIPLVPKXXXXXXXXXXXXEDVESQLYFLITHLVKAGYYQFSICLLSLYEHIVYTISRSSVKSIEAQMIKLEICIRLRRFSTASRLLFQLFTGDKVPQLADSRPAATVTKTPANVYDDQKQLTDEKNLIVLDKIISRRIVPSLAQRLGPTIASKISLLQALFLIELSSCVPVSPEMLDPSRYSSPLQAPVLSKKPTTKKSEPIGIQTEEESHSILDSLASNLQYSTWKDISLPILKGLMLHAATAIVHPIIEDFILAIQREDFMHLKLNLYEVDNVFFGLLVQARNCRLRLRNRSGARLAMFAGRLLKEYFDESISFDTKSARVFEHLDIFSHMKWNQELVECLLGEVSVENPLDVSETAISDVPPVKDVIISCIGECDGKGLLQHKAWFISALAQYSFISGYEVEKYKAILSESVEIFDNINWLSDHSENAFIVSQLRGINQLISSTDKPDLRRSIVDAEKALRKLHERLLNTIDGKYLQSVMWNVNEPDLSSVQIANVYDGKLNYLCKIKLLFGIIFMEKSRFATEKQELRMKALAVLNVGLDICRSLSRRVPWIETEYFLTIGRIQRLLISSGKVSHLSTINTFLEGLRLCVLSTGHLGLKKQFFLELAITFMISSHLVGDSVEKDGEIVESTKLLFNTHQAQMLQNHKISKNEALTFKRLSWLAIKCASSVSDSIQHLNYCKSDTSKLLSEDAQDNFPISALFDLYGRFKLGSKRITFKNEIEEELSRMPEYKLLKDNENLDDQLDKIKPYTSRTSLSQVLAYHEVLMKLTNNTFLTKSESFELRVKPLTRCIFNDDQFFEKEEEINKFLFQHIPEYRGKCITLIPKDFSNLSPTNTSEGIEELIIGNVNEEIWNTRIVEGESIETPQCLRLFTEYPKGILLSIEIPERIPLEKSEVNETEIFMNFYESPFEFHMESESRTMMLYAESKKVPKSVNKSESILSGWLLISSKDIFPVYQDFRESAQLLEILANNPESTTASKSSEGVKKXXXXXXXXXXXXTKQLKASSQILPLPVGSEISVIELNVRQGLDRLASWVRQTSSILFTPPYDGLIKNSEHMYTVVTSGCIVNAIPFDVTKENLRLLSNALNPILSRPIINAPQLSKFVQDVLKIDF 9474
            MSSNLFNKALKNIKTKDNLNKINCSEDEINENLKKSFEFELKNITKTIQLQKLLPNKLYEFLIKYENNLPQEFFYKHTMELGDVLLRHGYSLIARNQCYERYLVNVHNLDVFHIELDDLDSHLSLEQIHQTESIVSAIFGLCLAEFRCMEILDKRFQANFHQRKCHCLLTIYRRLMEIILKQERFCWLIYNGSVCIYWISEALIRSGLSMMVVEPLVWASCCLETSIPLLTIFNLKWRAVIYTATCQALFNIQYDSDAEAFARRALVKINELHELYEISSDARSTENAIIFSEAVIKMGVMIFKRNAFETRRRPKTYLRPKTKVNFKEILQNNWPRTGTERILAEMFDSPSQQILAIMEAVKQPSRTIGKIEAPASENEWEMLDVYSELFYAAIAIITGRSTSVIGKSDKALVKEYRIVDVDENTDQLALSVLNGSAITIKATFELVCWAFSYGNWEFLDTILDPLLAAIKDSKSLSHKLPLENTLKLIRLMRKCFHSSVFVEKKVVKLSEQPIEDDRKQGDTQMNFRAPQRSNSSVSKDTRSSKSRKDNPPADEEEKKGKQSQDPLCQLSELLKEIIATDFNPGNYFQEILVEAGLILWNKCKPIFQTTQDGSLSNEPSKPIPSIGKWIRILDTAYRILSVTEYSTINPISYSEISIRLSVLLEQLSINNWFSTNTSEDDNCQELSLESFISQLKTEGTSKSMKCIAAAKKIMRTSLSQLNKARNLQNLDKASNQDDKVKLIGNNLDDLYLELNSIHLRTCAREIVIHLFIIGEEIKKMNEIRQSKFYQEAIQFCNKNLLFLAILQAHLGNLLRNNLCLEDRIELVNHIKSLIEKSENNLSDVKLNQKPNSDKMPAPIIERKGSNYIIVKVDENVPSELKSKIGWIRLYGRAVDSPNAEVRLTDDKLPGTGVETSCLSTKFTIYDLTVNEQYILAFSINDKFGSPIGRGIGKSTKYILAIDTINPVTAISIITQILYEMGQKEEVIWYENLLWPQFVEAIPDCVETYQRSVLPRSSFHKEYKIKVDVLNNSSPMLLRKFCVSVLSAIDCECRILNITNDINVKSHSQMGDQINRLKMVDKLLALFSISKKLKDSLLTMEIFTTVACLLAPIMNQNQFFKPYFSVLSTCVNVLVGLPQTTWIKIPAALKTYIHHLSACIGFYLLKCLNNFPSYGDFSETIRQSVTLLLQMSGNAPFTVTEQEDTSGTASQIEIKSEKSQINPQKKVIVKVNKGENSAANFSVQQVAFESFKFTLAKQGLVDHQLSGNEEPDILMAYITLLPSRHAYKEVLKFSRKNRYLQFIVEILHKAVVEGNLENSLNYYREIKEWLKKRNEAILGRSLIQLQSQMNRETIQTKSQNPAVISDNNLFSRSVRTDEDVEDSKRPSKPKKKAKYKLQSDKAINVLPSMSETQKQIQEQAELKALDVLSTTFVSMYKQNLRRRRFRQLSEYERVSRIKMNCSMAMGYLAISHAKVDSLTQILNGGFRFSEVPEIEDITKFMLESTGKILPLDETPIPDQISTVLKMTKQQTSRQTDTPRTYRSDVNVSEKRLFVEAPKLLSQLSDAMNKAALLLKRAIVLAARSKVWVLLFKACSLSWYTLSSFINTTNRLTKFLNAAKKDFPEVDWSQIQSFSMNNLFKLYSSVFFFGSQSILDMIEVLGKSNLHKISKDFDENFTENFILKSVHLLFETGSYEKSIHVILRFTSITNYLFVNVTHPILIESQQQLCQKAKDNQARNPDWTLQQCEQYVTDCQSKMKVDHLDSSNYQQFLNKILSGYFGRKKLYQSKSKVLRKVQQSEHEDLYVNNLLNILKSEASSNLIFSVPVRPEVSHKEWVTYQNVRSIKREWMELYYKRNYFDYLHSSDCITVGNNHKMNLQELLTSYKEFLDNSLSNNDLNHYSFALNAMGDLYISHLHKPSLALSAWNGSLDCLLNQKQSVKNISQIIGIIDKDFVKCQFQMEKLLSKFGGIKCLVIGGLLTKVSRLDDLTCDERLNICLNAAMFYKAIYSGSFAHPEDDMNYLVHSLYLDAANSIPLVPKVNIFSNSSVISVEDVESQLYFLITHLVKAGYYQFSICLLSLYEHIVYTISRSSVKSIEAQMIKLEICIRLRRFSTASRLLFQLFTGDKVPQLADSRPAATVTKTPANVYDDQKQLTDEKNLIVLDKIISRRIVPSLAQRLGPTIASKISLLQALFLIELSSCVPVSPEMLDPSRYSSPLQAPVLSKKPTTKKSEPIGIQTEEESHSILDSLASNLQYSTWKDISLPILKGLMLHAATAIVHPIIEDFILAIQREDFMHLKLNLYEVDNVFFGLLVQARNCRLRLRNRSGARLAMFAGRLLKEYFDESISFDTKSARVFEHLDIFSHMKWNQELVECLLGEVSVENPLDVSETAISDVPPVKDVIISCIGECDGKGLLQHKAWFISALAQYSFISGYEVEKYKAILSESVEIFDNINWLSDHSENAFIVSQLRGINQLISSTDKPDLRRSIVDAEKALRKLHERLLNTIDGKYLQSVMWNVNEPDLSSVQIANVYDGKLNYLCKIKLLFGIIFMEKSRFATEKQELRMKALAVLNVGLDICRSLSRRVPWIETEYFLTIGRIQRLLISSGKVSHLSTINTFLEGLRLCVLSTGHLGLKKQFFLELAITFMISSHLVGDSVEKDGEIVESTKLLFNTHQAQMLQNHKISKNEALTFKRLSWLAIKCASSVSDSIQHLNYCKSDTSKLLSEDAQDNFPISALFDLYGRFKLGSKRITFKNEIEEELSRMPEYKLLKDNENLDDQLDKIKPYTSRTSLSQVLAYHEVLMKLTNNTFLTKSESFELRVKPLTRCIFNDDQFFEKEEEINKFLFQHIPEYRGKCITLIPKDFSNLSPTNTSEGIEELIIGNVNEEIWNTRIVEGESIETPQCLRLFTEYPKGILLSIEIPERIPLEKSEVNETEIFMNFYESPFEFHMESESRTMMLYAESKKVPKSVNKSESILSGWLLISSKDIFPVYQDFRESAQLLEILANNPESTTASKSSEGVKKPPSNASSGNPNNTKQLKASSQILPLPVGSEISVIELNVRQGLDRLASWVRQTSSILFTPPYDGLIKNSEHMYTVVTSGCIVNAIPFDVTKENLRLLSNALNPILSRPIINAPQLSKFVQDVLKIDF
Sbjct:    1 MSSNLFNKALKNIKTKDNLNKINCSEDEINENLKKSFEFELKNITKTIQLQKLLPNKLYEFLIKYENNLPQEFFYKHTMELGDVLLRHGYSLIARNQCYERYLVNVHNLDVFHIELDDLDSHLSLEQIHQTESIVSAIFGLCLAEFRCMEILDKRFQANFHQRKCHCLLTIYRRLMEIILKQERFCWLIYNGSVCIYWISEALIRSGLSMMVVEPLVWASCCLETSIPLLTIFNLKWRAVIYTATCQALFNIQYDSDAEAFARRALVKINELHELYEISSDARSTENAIIFSEAVIKMGVMIFKRNAFETRRRPKTYLRPKTKVNFKEILQNNWPRTGTERILAEMFDSPSQQILAIMEAVKQPSRTIGKIEAPASENEWEMLDVYSELFYAAIAIITGRSTSVIGKSDKALVKEYRIVDVDENTDQLALSVLNGSAITIKATFELVCWAFSYGNWEFLDTILDPLLAAIKDSKSLSHKLPLENTLKLIRLMRKCFHSSVFVEKKVVKLSEQPIEDDRKQGDTQMNFRAPQRSNSSVSKDTRSSKSRKDNPPADEEEKKGKQSQDPLCQLSELLKEIIATDFNPGNYFQEILVEAGLILWNKCKPIFQTTQDGSLSNEPSKPIPSIGKWIRILDTAYRILSVTEYSTINPISYSEISIRLSVLLEQLSINNWFSTNTSEDDNCQELSLESFISQLKTEGTSKSMKCIAAAKKIMRTSLSQLNKARNLQNLDKASNQDDKVKLIGNNLDDLYLELNSIHLRTCAREIVIHLFIIGEEIKKMNEIRQSKFYQEAIQFCNKNLLFLAILQAHLGNLLRNNLCLEDRIELVNHIKSLIEKSENNLSDVKLNQKPNSDKMPAPIIERKGSNYIIVKVDENVPSELKSKIGWIRLYGRAVDSPNAEVRLTDDKLPGTGVETSCLSTKFTIYDLTVNEQYILAFSINDKFGSPIGRGIGKSTKYILAIDTINPVTAISIITQILYEMGQKEEVIWYENLLWPQFVEAIPDCVETYQRSVLPRSSFHKEYKIKVDVLNNSSPMLLRKFCVSVLSAIDCECRILNITNDINVKSHSQMGDQINRLKMVDKLLALFSISKKLKDSLLTMEIFTTVACLLAPIMNQNQFFKPYFSVLSTCVNVLVGLPQTTWIKIPAALKTYIHHLSACIGFYLLKCLNNFPSYGDFSETIRQSVTLLLQMSGNAPFTVTEQEDTSGTASQIEIKSEKSQINPQKKVIVKVNKGENSAANFSVQQVAFESFKFTLAKQGLVDHQLSGNEEPDILMAYITLLPSRHAYKEVLKFSRKNRYLQFIVEILHKAVVEGNLENSLNYYREIKEWLKKRNEAILGRSLIQLQSQMNRETIQTKSQNPAVISDNNLFSRSVRTDEDVEDSKRPSKPKKKAKYKLQSDKAINVLPSMSETQKQIQEQAELKALDVLSTTFVSMYKQNLRRRRFRQLSEYERVSRIKMNCSMAMGYLAISHAKVDSLTQILNGGFRFSEVPEIEDITKFMLESTGKILPLDETPIPDQISTVLKMTKQQTSRQTDTPRTYRSDVNVSEKRLFVEAPKLLSQLSDAMNKAALLLKRAIVLAARSKVWVLLFKACSLSWYTLSSFINTTNRLTKFLNAAKKDFPEVDWSQIQSFSMNNLFKLYSSVFFFGSQSILDMIEVLGKSNLHKISKDFDENFTENFILKSVHLLFETGSYEKSIHVILRFTSITNYLFVNVTHPILIESQQQLCQKAKDNQARNPDWTLQQCEQYVTDCQSKMKVDHLDSSNYQQFLNKILSGYFGRKKLYQSKSKVLRKVQQSEHEDLYVNNLLNILKSEASSNLIFSVPVRPEVSHKEWVTYQNVRSIKREWMELYYKRNYFDYLHSSDCITVGNNHKMNLQELLTSYKEFLDNSLSNNDLNHYSFALNAMGDLYISHLHKPSLALSAWNGSLDCLLNQKQSVKNISQIIGIIDKDFVKCQFQMEKLLSKFGGIKCLVIGGLLTKVSRLDDLTCDERLNICLNAAMFYKAIYSGSFAHPEDDMNYLVHSLYLDAANSIPLVPKVNIFSNSSVISVEDVESQLYFLITHLVKAGYYQFSICLLSLYEHIVYTISRSSVKSIEAQMIKLEICIRLRRFSTASRLLFQLFTGDKVPQLADSRPAATVTKTPANVYDDQKQLTDEKNLIVLDKIISRRIVPSLAQRLGPTIASKISLLQALFLIELSSCVPVSPEMLDPSRYSSPLQAPVLSKKPTTKKSEPIGIQTEEESHSILDSLASNLQYSTWKDISLPILKGLMLHAATAIVHPIIEDFILAIQREDFMHLKLNLYEVDNVFFGLLVQARNCRLRLRNRSGARLAMFAGRLLKEYFDESISFDTKSARVFEHLDIFSHMKWNQELVECLLGEVSVENPLDVSETAISDVPPVKDVIISCIGECDGKGLLQHKAWFISALAQYSFISGYEVEKYKAILSESVEIFDNINWLSDHSENAFIVSQLRGINQLISSTDKPDLRRSIVDAEKALRKLHERLLNTIDGKYLQSVMWNVNEPDLSSVQIANVYDGKLNYLCKIKLLFGIIFMEKSRFATEKQELRMKALAVLNVGLDICRSLSRRVPWIETEYFLTIGRIQRLLISSGKVSHLSTINTFLEGLRLCVLSTGHLGLKKQFFLELAITFMISSHLVGDSVEKDGEIVESTKLLFNTHQAQMLQNHKISKNEALTFKRLSWLAIKCASSVSDSIQHLNYCKSDTSKLLSEDAQDNFPISALFDLYGRFKLGSKRITFKNEIEEELSRMPEYKLLKDNENLDDQLDKIKPYTSRTSLSQVLAYHEVLMKLTNNTFLTKSESFELRVKPLTRCIFNDDQFFEKEEEINKFLFQHIPEYRGKCITLIPKDFSNLSPTNTSEGIEELIIGNVNEEIWNTRIVEGESIETPQCLRLFTEYPKGILLSIEIPERIPLEKSEVNETEIFMNFYESPFEFHMESESRTMMLYAESKKVPKSVNKSESILSGWLLISSKDIFPVYQDFRESAQLLEILANNPESTTASKSSEGVKKPPSNASSGNPNNTKQLKASSQILPLPVGSEISVIELNVRQGLDRLASWVRQTSSILFTPPYDGLIKNSEHMYTVVTSGCIVNAIPFDVTKENLRLLSNALNPILSRPIINAPQLSKFVQDVLKIDF 3149          
BLAST of cilia- and flagella-associated protein 54-like vs. Planmine SMEST
Match: SMESG000072637.1 (SMESG000072637.1)

HSP 1 Score: 6281.05 bits (16294), Expect = 0.000e+0
Identity = 3144/3149 (99.84%), Postives = 3144/3149 (99.84%), Query Frame = 1
Query:   28 MSSNLFNKALKNIKTKDNLNKINCSEDEINENLKKSFEFELKNITKTIQLQKLLPNKLYEFLIKYENNLPQEFFYKHTMELGDVLLRHGYSLIARNQCYERYLVNVHNLDVFHIEXXXXXXXXXXEQIHQTESIVSAIFGLCLAEFRCMEILDKRFQANFHQRKCHCLLTIYRRLMEIILKQERFCWLIYNGSVCIYWISEALIRSGLSMMVVEPLVWASCCLETSIPLLTIFNLKWRAVIYTATCQALFNIQYDSDAEAFARRALVKINELHELYEISSDARSTENAIIFSEAVIKMGVMIFKRNAFETRRRPKTYLRPKTKVNFKEILQNNWPRTGTERILAEMFDSPSQQILAIMEAVKQPSRTIGKIEAPASENEWEMLDVYSELFYAAIAIITGRSTSVIGKSDKALVKEYRIVDVDENTDQLALSVLNGSAITIKATFELVCWAFSYGNWEFLDTILDPLLAAIKDSKSLSHKLPLENTLKLIRLMRKCFHSSVFVEKKVVKLSEQPIEDDRKQGDTQMNFRAPQXXXXXXXXXXXXXXXXXDNPPADEEEKKGKQSQDPLCQLSELLKEIIATDFNPGNYFQEILVEAGLILWNKCKPIFQTTQDGSLSNEPSKPIPSIGKWIRILDTAYRILSVTEYSTINPISYSEISIRLSVLLEQLSINNWFSTNTSEDDNCQELSLESFISQLKTEGTSKSMKCIAAAKKIMRTSLSQLNKARNLQNLDKASNQDDKVKLIGNNLDDLYLELNSIHLRTCAREIVIHLFIIGEEIKKMNEIRQSKFYQEAIQFCNKNLLFLAILQAHLGNLLRNNLCLEDRIELVNHIKSLIEKSENNLSDVKLNQKPNSDKMPAPIIERKGSNYIIVKVDENVPSELKSKIGWIRLYGRAVDSPNAEVRLTDDKLPGTGVETSCLSTKFTIYDLTVNEQYILAFSINDKFGSPIGRGIGKSTKYILAIDTINPVTAISIITQILYEMGQKEEVIWYENLLWPQFVEAIPDCVETYQRSVLPRSSFHKEYKIKVDVLNNSSPMLLRKFCVSVLSAIDCECRILNITNDINVKSHSQMGDQINRLKMVDKLLALFSISKKLKDSLLTMEIFTTVACLLAPIMNQNQFFKPYFSVLSTCVNVLVGLPQTTWIKIPAALKTYIHHLSACIGFYLLKCLNNFPSYGDFSETIRQSVTLLLQMSGNAPFTVTEQEDTSGTASQIEIKSEKSQINPQKKVIVKVNKGENSAANFSVQQVAFESFKFTLAKQGLVDHQLSGNEEPDILMAYITLLPSRHAYKEVLKFSRKNRYLQFIVEILHKAVVEGNLENSLNYYREIKEWLKKRNEAILGRSLIQLQSQMNRETIQTKSQNPAVISDNNLFSRSVRTDEDVEDXXXXXXXXXXXXXXLQSDKAINVLPSMSETQKQIQEQAELKALDVLSTTFVSMYKQNLRRRRFRQLSEYERVSRIKMNCSMAMGYLAISHAKVDSLTQILNGGFRFSEVPEIEDITKFMLESTGKILPLDETPIPDQISTVLKMTKQQTSRQTDTPRTYRSDVNVSEKRLFVEAPKLLSQLSDAMNKAALLLKRAIVLAARSKVWVLLFKACSLSWYTLSSFINTTNRLTKFLNAAKKDFPEVDWSQIQSFSMNNLFKLYSSVFFFGSQSILDMIEVLGKSNLHKISKDFDENFTENFILKSVHLLFETGSYEKSIHVILRFTSITNYLFVNVTHPILIESQQQLCQKAKDNQARNPDWTLQQCEQYVTDCQSKMKVDHLDSSNYQQFLNKILSGYFGRKKLYQSKSKVLRKVQQSEHEDLYVNNLLNILKSEASSNLIFSVPVRPEVSHKEWVTYQNVRSIKREWMELYYKRNYFDYLHSSDCITVGNNHKMNLQELLTSYKEFXXXXXXXXXXXHYSFALNAMGDLYISHLHKPSLALSAWNGSLDCLLNQKQSVKNISQIIGIIDKDFVKCQFQMEKLLSKFGGIKCLVIGGLLTKVSRLDDLTCDERLNICLNAAMFYKAIYSGSFAHPEDDMNYLVHSLYLDAANSIPLVPKXXXXXXXXXXXXEDVESQLYFLITHLVKAGYYQFSICLLSLYEHIVYTISRSSVKSIEAQMIKLEICIRLRRFSTASRLLFQLFTGDKVPQLADSRPAATVTKTPANVYDDQKQLTDEKNLIVLDKIISRRIVPSLAQRLGPTIASKISLLQALFLIELSSCVPVSPEMLDPSRYSSPLQAPVLSKKPTTKKSEPIGIQTEEESHSILDSLASNLQYSTWKDISLPILKGLMLHAATAIVHPIIEDFILAIQREDFMHLKLNLYEVDNVFFGLLVQARNCRLRLRNRSGARLAMFAGRLLKEYFDESISFDTKSARVFEHLDIFSHMKWNQELVECLLGEVSVENPLDVSETAISDVPPVKDVIISCIGECDGKGLLQHKAWFISALAQYSFISGYEVEKYKAILSESVEIFDNINWLSDHSENAFIVSQLRGINQLISSTDKPDLRRSIVDAEKALRKLHERLLNTIDGKYLQSVMWNVNEPDLSSVQIANVYDGKLNYLCKIKLLFGIIFMEKSRFATEKQELRMKALAVLNVGLDICRSLSRRVPWIETEYFLTIGRIQRLLISSGKVSHLSTINTFLEGLRLCVLSTGHLGLKKQFFLELAITFMISSHLVGDSVEKDGEIVESTKLLFNTHQAQMLQNHKISKNEALTFKRLSWLAIKCASSVSDSIQHLNYCKSDTSKLLSEDAQDNFPISALFDLYGRFKLGSKRITFKNEIEEELSRMPEYKLLKDNENLDDQLDKIKPYTSRTSLSQVLAYHEVLMKLTNNTFLTKSESFELRVKPLTRCIFNDDQFFEKEEEINKFLFQHIPEYRGKCITLIPKDFSNLSPTNTSEGIEELIIGNVNEEIWNTRIVEGESIETPQCLRLFTEYPKGILLSIEIPERIPLEKSEVNETEIFMNFYESPFEFHMESESRTMMLYAESKKVPKSVNKSESILSGWLLISSKDIFPVYQDFRESAQLLEILANNPESTTASKSSEGVKKXXXXXXXXXXXXTKQLKASSQILPLPVGSEISVIELNVRQGLDRLASWVRQTSSILFTPPYDGLIKNSEHMYTVVTSGCIVNAIPFDVTKENLRLLSNALNPILSRPIINAPQLSKFVQDVLKIDF 9474
            MSSNLFNKALKNIKTKDNLNKINCSEDEINENLKKSFEFELKNITKTIQLQKLLPNKLYEFLIKYENNLPQEFFYKHTMELGDVLLRHGYSLIARNQCYERYLVNVHNLDVFHIELDDLDSHLSLEQIHQTESIVSAIFGLCLAEFRCMEILDKRFQANFHQRKCHCLLTIYRRLMEIILKQERFCWLIYNGSVCIYWISEALIRSGLSMMVVEPLVWASCCLETSIPLLTIFNLKWRAVIYTATCQALFNIQYDSDAEAFARRALVKINELHELYEISSDARSTENAIIFSEAVIKMGVMIFKRNAFETRRRPKTYLRPKTKVNFKEILQNNWPRTGTERILAEMFDSPSQQILAIMEAVKQPSRTIGKIEAPASENEWEMLDVYSELFYAAIAIITGRSTSVIGKSDKALVKEYRIVDVDENTDQLALSVLNGSAITIKATFELVCWAFSYGNWEFLDTILDPLLAAIKDSKSLSHKLPLENTLKLIRLMRKCFHSSVFVEKKVVKLSEQPIEDDRKQGDTQMNFRAPQRSNSSVSKDTRSSKSRKDNPPADEEEKKGKQSQDPLCQLSELLKEIIATDFNPGNYFQEILVEAGLILWNKCKPIFQTTQDGSLSNEPSKPIPSIGKWIRILDTAYRILSVTEYSTINPISYSEISIRLSVLLEQLSINNWFSTNTSEDDNCQELSLESFISQLKTEGTSKSMKCIAAAKKIMRTSLSQLNKARNLQNLDKASNQDDKVKLIGNNLDDLYLELNSIHLRTCAREIVIHLFIIGEEIKKMNEIRQSKFYQEAIQFCNKNLLFLAILQAHLGNLLRNNLCLEDRIELVNHIKSLIEKSENNLSDVKLNQKPNSDKMPAPIIERKGSNYIIVKVDENVPSELKSKIGWIRLYGRAVDSPNAEVRLTDDKLPGTGVETSCLSTKFTIYDLTVNEQYILAFSINDKFGSPIGRGIGKSTKYILAIDTINPVTAISIITQILYEMGQKEEVIWYENLLWPQFVEAIPDCVETYQRSVLPRSSFHKEYKIKVDVLNNSSPMLLRKFCVSVLSAIDCECRILNITNDINVKSHSQMGDQINRLKMVDKLLALFSISKKLKDSLLTMEIFTTVACLLAPIMNQNQFFKPYFSVLSTCVNVLVGLPQTTWIKIPAALKTYIHHLSACIGFYLLKCLNNFPSYGDFSETIRQSVTLLLQMSGNAPFTVTEQEDTSGTASQIEIKSEKSQINPQKKVIVKVNKGENSAANFSVQQVAFESFKFTLAKQGLVDHQLSGNEEPDILMAYITLLPSRHAYKEVLKFSRKNRYLQFIVEILHKAVVEGNLENSLNYYREIKEWLKKRNEAILGRSLIQLQSQMNRETIQTKSQNPAVISDNNLFSRSVRTDEDVEDSKRPSKPKKKAKY     KAINVLPSMSETQKQIQEQAELKALDVLSTTFVSMYKQNLRRRRFRQLSEYERVSRIKMNCSMAMGYLAISHAKVDSLTQILNGGFRFSEVPEIEDITKFMLESTGKILPLDETPIPDQISTVLKMTKQQTSRQTDTPRTYRSDVNVSEKRLFVEAPKLLSQLSDAMNKAALLLKRAIVLAARSKVWVLLFKACSLSWYTLSSFINTTNRLTKFLNAAKKDFPEVDWSQIQSFSMNNLFKLYSSVFFFGSQSILDMIEVLGKSNLHKISKDFDENFTENFILKSVHLLFETGSYEKSIHVILRFTSITNYLFVNVTHPILIESQQQLCQKAKDNQARNPDWTLQQCEQYVTDCQSKMKVDHLDSSNYQQFLNKILSGYFGRKKLYQSKSKVLRKVQQSEHEDLYVNNLLNILKSEASSNLIFSVPVRPEVSHKEWVTYQNVRSIKREWMELYYKRNYFDYLHSSDCITVGNNHKMNLQELLTSYKEFLDNSLSNNDLNHYSFALNAMGDLYISHLHKPSLALSAWNGSLDCLLNQKQSVKNISQIIGIIDKDFVKCQFQMEKLLSKFGGIKCLVIGGLLTKVSRLDDLTCDERLNICLNAAMFYKAIYSGSFAHPEDDMNYLVHSLYLDAANSIPLVPKVNIFSNSSVISVEDVESQLYFLITHLVKAGYYQFSICLLSLYEHIVYTISRSSVKSIEAQMIKLEICIRLRRFSTASRLLFQLFTGDKVPQLADSRPAATVTKTPANVYDDQKQLTDEKNLIVLDKIISRRIVPSLAQRLGPTIASKISLLQALFLIELSSCVPVSPEMLDPSRYSSPLQAPVLSKKPTTKKSEPIGIQTEEESHSILDSLASNLQYSTWKDISLPILKGLMLHAATAIVHPIIEDFILAIQREDFMHLKLNLYEVDNVFFGLLVQARNCRLRLRNRSGARLAMFAGRLLKEYFDESISFDTKSARVFEHLDIFSHMKWNQELVECLLGEVSVENPLDVSETAISDVPPVKDVIISCIGECDGKGLLQHKAWFISALAQYSFISGYEVEKYKAILSESVEIFDNINWLSDHSENAFIVSQLRGINQLISSTDKPDLRRSIVDAEKALRKLHERLLNTIDGKYLQSVMWNVNEPDLSSVQIANVYDGKLNYLCKIKLLFGIIFMEKSRFATEKQELRMKALAVLNVGLDICRSLSRRVPWIETEYFLTIGRIQRLLISSGKVSHLSTINTFLEGLRLCVLSTGHLGLKKQFFLELAITFMISSHLVGDSVEKDGEIVESTKLLFNTHQAQMLQNHKISKNEALTFKRLSWLAIKCASSVSDSIQHLNYCKSDTSKLLSEDAQDNFPISALFDLYGRFKLGSKRITFKNEIEEELSRMPEYKLLKDNENLDDQLDKIKPYTSRTSLSQVLAYHEVLMKLTNNTFLTKSESFELRVKPLTRCIFNDDQFFEKEEEINKFLFQHIPEYRGKCITLIPKDFSNLSPTNTSEGIEELIIGNVNEEIWNTRIVEGESIETPQCLRLFTEYPKGILLSIEIPERIPLEKSEVNETEIFMNFYESPFEFHMESESRTMMLYAESKKVPKSVNKSESILSGWLLISSKDIFPVYQDFRESAQLLEILANNPESTTASKSSEGVKKPPSNASSGNPNNTKQLKASSQILPLPVGSEISVIELNVRQGLDRLASWVRQTSSILFTPPYDGLIKNSEHMYTVVTSGCIVNAIPFDVTKENLRLLSNALNPILSRPIINAPQLSKFVQDVLKIDF
Sbjct:    1 MSSNLFNKALKNIKTKDNLNKINCSEDEINENLKKSFEFELKNITKTIQLQKLLPNKLYEFLIKYENNLPQEFFYKHTMELGDVLLRHGYSLIARNQCYERYLVNVHNLDVFHIELDDLDSHLSLEQIHQTESIVSAIFGLCLAEFRCMEILDKRFQANFHQRKCHCLLTIYRRLMEIILKQERFCWLIYNGSVCIYWISEALIRSGLSMMVVEPLVWASCCLETSIPLLTIFNLKWRAVIYTATCQALFNIQYDSDAEAFARRALVKINELHELYEISSDARSTENAIIFSEAVIKMGVMIFKRNAFETRRRPKTYLRPKTKVNFKEILQNNWPRTGTERILAEMFDSPSQQILAIMEAVKQPSRTIGKIEAPASENEWEMLDVYSELFYAAIAIITGRSTSVIGKSDKALVKEYRIVDVDENTDQLALSVLNGSAITIKATFELVCWAFSYGNWEFLDTILDPLLAAIKDSKSLSHKLPLENTLKLIRLMRKCFHSSVFVEKKVVKLSEQPIEDDRKQGDTQMNFRAPQRSNSSVSKDTRSSKSRKDNPPADEEEKKGKQSQDPLCQLSELLKEIIATDFNPGNYFQEILVEAGLILWNKCKPIFQTTQDGSLSNEPSKPIPSIGKWIRILDTAYRILSVTEYSTINPISYSEISIRLSVLLEQLSINNWFSTNTSEDDNCQELSLESFISQLKTEGTSKSMKCIAAAKKIMRTSLSQLNKARNLQNLDKASNQDDKVKLIGNNLDDLYLELNSIHLRTCAREIVIHLFIIGEEIKKMNEIRQSKFYQEAIQFCNKNLLFLAILQAHLGNLLRNNLCLEDRIELVNHIKSLIEKSENNLSDVKLNQKPNSDKMPAPIIERKGSNYIIVKVDENVPSELKSKIGWIRLYGRAVDSPNAEVRLTDDKLPGTGVETSCLSTKFTIYDLTVNEQYILAFSINDKFGSPIGRGIGKSTKYILAIDTINPVTAISIITQILYEMGQKEEVIWYENLLWPQFVEAIPDCVETYQRSVLPRSSFHKEYKIKVDVLNNSSPMLLRKFCVSVLSAIDCECRILNITNDINVKSHSQMGDQINRLKMVDKLLALFSISKKLKDSLLTMEIFTTVACLLAPIMNQNQFFKPYFSVLSTCVNVLVGLPQTTWIKIPAALKTYIHHLSACIGFYLLKCLNNFPSYGDFSETIRQSVTLLLQMSGNAPFTVTEQEDTSGTASQIEIKSEKSQINPQKKVIVKVNKGENSAANFSVQQVAFESFKFTLAKQGLVDHQLSGNEEPDILMAYITLLPSRHAYKEVLKFSRKNRYLQFIVEILHKAVVEGNLENSLNYYREIKEWLKKRNEAILGRSLIQLQSQMNRETIQTKSQNPAVISDNNLFSRSVRTDEDVEDSKRPSKPKKKAKY-----KAINVLPSMSETQKQIQEQAELKALDVLSTTFVSMYKQNLRRRRFRQLSEYERVSRIKMNCSMAMGYLAISHAKVDSLTQILNGGFRFSEVPEIEDITKFMLESTGKILPLDETPIPDQISTVLKMTKQQTSRQTDTPRTYRSDVNVSEKRLFVEAPKLLSQLSDAMNKAALLLKRAIVLAARSKVWVLLFKACSLSWYTLSSFINTTNRLTKFLNAAKKDFPEVDWSQIQSFSMNNLFKLYSSVFFFGSQSILDMIEVLGKSNLHKISKDFDENFTENFILKSVHLLFETGSYEKSIHVILRFTSITNYLFVNVTHPILIESQQQLCQKAKDNQARNPDWTLQQCEQYVTDCQSKMKVDHLDSSNYQQFLNKILSGYFGRKKLYQSKSKVLRKVQQSEHEDLYVNNLLNILKSEASSNLIFSVPVRPEVSHKEWVTYQNVRSIKREWMELYYKRNYFDYLHSSDCITVGNNHKMNLQELLTSYKEFLDNSLSNNDLNHYSFALNAMGDLYISHLHKPSLALSAWNGSLDCLLNQKQSVKNISQIIGIIDKDFVKCQFQMEKLLSKFGGIKCLVIGGLLTKVSRLDDLTCDERLNICLNAAMFYKAIYSGSFAHPEDDMNYLVHSLYLDAANSIPLVPKVNIFSNSSVISVEDVESQLYFLITHLVKAGYYQFSICLLSLYEHIVYTISRSSVKSIEAQMIKLEICIRLRRFSTASRLLFQLFTGDKVPQLADSRPAATVTKTPANVYDDQKQLTDEKNLIVLDKIISRRIVPSLAQRLGPTIASKISLLQALFLIELSSCVPVSPEMLDPSRYSSPLQAPVLSKKPTTKKSEPIGIQTEEESHSILDSLASNLQYSTWKDISLPILKGLMLHAATAIVHPIIEDFILAIQREDFMHLKLNLYEVDNVFFGLLVQARNCRLRLRNRSGARLAMFAGRLLKEYFDESISFDTKSARVFEHLDIFSHMKWNQELVECLLGEVSVENPLDVSETAISDVPPVKDVIISCIGECDGKGLLQHKAWFISALAQYSFISGYEVEKYKAILSESVEIFDNINWLSDHSENAFIVSQLRGINQLISSTDKPDLRRSIVDAEKALRKLHERLLNTIDGKYLQSVMWNVNEPDLSSVQIANVYDGKLNYLCKIKLLFGIIFMEKSRFATEKQELRMKALAVLNVGLDICRSLSRRVPWIETEYFLTIGRIQRLLISSGKVSHLSTINTFLEGLRLCVLSTGHLGLKKQFFLELAITFMISSHLVGDSVEKDGEIVESTKLLFNTHQAQMLQNHKISKNEALTFKRLSWLAIKCASSVSDSIQHLNYCKSDTSKLLSEDAQDNFPISALFDLYGRFKLGSKRITFKNEIEEELSRMPEYKLLKDNENLDDQLDKIKPYTSRTSLSQVLAYHEVLMKLTNNTFLTKSESFELRVKPLTRCIFNDDQFFEKEEEINKFLFQHIPEYRGKCITLIPKDFSNLSPTNTSEGIEELIIGNVNEEIWNTRIVEGESIETPQCLRLFTEYPKGILLSIEIPERIPLEKSEVNETEIFMNFYESPFEFHMESESRTMMLYAESKKVPKSVNKSESILSGWLLISSKDIFPVYQDFRESAQLLEILANNPESTTASKSSEGVKKPPSNASSGNPNNTKQLKASSQILPLPVGSEISVIELNVRQGLDRLASWVRQTSSILFTPPYDGLIKNSEHMYTVVTSGCIVNAIPFDVTKENLRLLSNALNPILSRPIINAPQLSKFVQDVLKIDF 3144          
The following BLAST results are available for this feature:
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CFAP544.667e-6128.85cilia and flagella associated protein 54 [Source:H... [more]
CFAP541.093e-5731.88cilia and flagella associated protein 54 [Source:H... [more]
CFAP541.210e-4320.91cilia and flagella associated protein 54 [Source:H... [more]
CFAP541.549e-624.90cilia and flagella associated protein 54 [Source:H... [more]
back to top
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ppm1e2.341e-6837.46protein phosphatase, Mg2+/Mn2+ dependent 1E [Sourc... [more]
back to top
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cfap543.039e-6135.10cilia and flagella associated protein 54 [Source:M... [more]
Cfap541.726e-5935.10cilia and flagella associated protein 54 [Source:M... [more]
Cfap542.291e-5935.10cilia and flagella associated protein 54 [Source:M... [more]
Cfap546.610e-5738.73cilia and flagella associated protein 54 [Source:M... [more]
Cfap545.262e-1329.41cilia and flagella associated protein 54 [Source:M... [more]
back to top
BLAST of cilia- and flagella-associated protein 54-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q96N23|CFA54_HUMAN2.241e-6028.85Cilia- and flagella-associated protein 54 OS=Homo ... [more]
sp|Q8C6S9|CFA54_MOUSE1.603e-5835.10Cilia- and flagella-associated protein 54 OS=Mus m... [more]
back to top
BLAST of cilia- and flagella-associated protein 54-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7VDR02.103e-14027.61Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A2T7NTX31.534e-13026.80Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A151LZ643.083e-12826.01Cilia-and flagella-associated protein 54 isoform B... [more]
A0A1L8GY673.458e-12825.03Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
A0A2B4RIE91.204e-12125.38Uncharacterized protein C12orf55-like OS=Stylophor... [more]
back to top
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000057325.12.489e-4732.14pep primary_assembly:Astyanax_mexicanus-2.0:7:3659... [more]
back to top
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000003656.17.985e-5632.17pep scaffold:Pmarinus_7.0:GL476695:215738:229256:1... [more]
ENSPMAT00000005611.12.131e-1426.02pep scaffold:Pmarinus_7.0:GL477691:65:5267:1 gene:... [more]
back to top
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO483501.195e-11924.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cilia- and flagella-associated protein 54-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000007417.24.015e-1529.95pep primary_assembly:ASM223467v1:14:13217858:13221... [more]
back to top
BLAST of cilia- and flagella-associated protein 54-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000072637.10.000e+0100.00SMESG000072637.1[more]
SMESG000072637.10.000e+099.84SMESG000072637.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019449 ID=SMED30019449|Name=cilia- and flagella-associated protein 54-like|organism=Schmidtea mediterranea sexual|type=transcript|length=9485bp
GGTTGATGTCAATAATTTGAGTGTAAAATGTCTAGCAATTTATTTAACAA
AGCTCTAAAGAATATCAAAACAAAAGATAATCTAAATAAAATAAACTGCT
CAGAAGATGAAATAAATGAAAATTTAAAAAAATCTTTCGAATTCGAATTG
AAAAATATTACGAAAACAATTCAATTGCAAAAATTGTTGCCGAATAAATT
ATACGAATTCCTAATTAAATATGAAAATAATTTACCGCAGGAATTTTTCT
ATAAACATACAATGGAGCTCGGTGACGTCCTCCTTCGGCACGGATATTCA
TTGATTGCTCGCAACCAGTGTTACGAGCGATATTTGGTGAATGTTCACAA
TTTGGATGTATTCCACATTGAGTTAGACGATTTAGACTCACATTTATCGC
TTGAGCAAATCCACCAAACCGAGTCAATCGTTTCTGCAATTTTCGGTCTC
TGCCTCGCGGAATTCCGGTGCATGGAAATACTTGACAAACGGTTCCAGGC
AAACTTCCATCAGCGGAAATGTCATTGCTTACTGACAATTTATCGCCGCC
TCATGGAAATCATATTGAAACAGGAGCGATTTTGCTGGCTGATTTATAAC
GGCTCAGTTTGCATCTACTGGATAAGTGAGGCTTTGATTCGGTCCGGCTT
GTCCATGATGGTTGTTGAGCCCCTAGTTTGGGCATCCTGCTGTTTGGAAA
CTTCCATTCCTCTGTTGACAATTTTTAACTTGAAATGGAGAGCTGTTATT
TATACTGCAACTTGCCAAGCATTATTCAACATTCAATACGATTCAGACGC
GGAGGCATTTGCCAGGAGGGCCCTGGTGAAAATTAACGAGTTGCACGAGC
TTTATGAAATATCATCCGATGCTCGCAGCACTGAAAACGCAATCATCTTT
TCGGAAGCTGTCATAAAAATGGGAGTGATGATATTCAAAAGAAATGCATT
CGAAACGAGAAGACGACCAAAAACCTATTTAAGACCGAAAACAAAAGTCA
ACTTCAAAGAAATTTTGCAAAACAATTGGCCAAGGACGGGCACGGAGCGA
ATACTGGCGGAAATGTTTGACAGTCCCTCACAGCAAATTCTCGCTATCAT
GGAAGCTGTTAAACAACCATCAAGAACTATTGGTAAAATAGAAGCTCCAG
CGTCAGAAAATGAATGGGAAATGCTCGATGTATATTCCGAACTGTTCTAT
GCAGCAATTGCTATAATAACCGGTCGATCTACATCCGTTATTGGGAAATC
AGATAAGGCACTTGTCAAGGAATACAGGATCGTGGATGTCGATGAGAACA
CGGATCAACTTGCACTATCGGTTCTCAATGGATCTGCGATAACAATCAAG
GCAACATTTGAATTGGTCTGCTGGGCGTTTTCCTATGGAAATTGGGAGTT
TCTCGACACGATCCTTGACCCGTTACTCGCGGCTATCAAGGATTCCAAAT
CTTTGAGCCATAAATTGCCGTTAGAAAATACCTTGAAACTTATTCGATTG
ATGAGAAAATGTTTCCATTCCTCGGTTTTTGTCGAGAAGAAAGTTGTAAA
ACTATCTGAGCAACCAATAGAAGATGATAGGAAGCAAGGAGACACACAAA
TGAATTTCAGAGCTCCCCAGAGGTCCAATTCCTCTGTATCGAAGGATACG
AGGTCTTCAAAATCAAGAAAAGACAATCCTCCAGCTGATGAGGAGGAAAA
GAAAGGTAAACAATCACAGGATCCTCTCTGTCAGTTGTCAGAGCTCCTTA
AGGAGATAATCGCTACTGATTTCAATCCGGGGAACTATTTCCAAGAAATT
CTCGTTGAAGCTGGACTCATACTGTGGAATAAATGCAAACCGATATTCCA
GACAACCCAAGATGGGTCTCTGTCAAATGAACCCAGTAAACCGATTCCTA
GCATCGGAAAGTGGATCCGGATTCTCGATACTGCATATCGGATTCTCTCG
GTGACAGAATACAGCACAATCAATCCGATCTCCTATTCGGAAATCTCCAT
TAGGTTAAGCGTCCTACTAGAGCAATTATCCATCAACAATTGGTTCTCTA
CAAACACTTCTGAAGATGACAACTGCCAGGAGTTGAGTTTGGAATCTTTT
ATCTCGCAACTGAAAACAGAAGGAACTTCCAAATCAATGAAATGCATTGC
TGCAGCGAAAAAGATCATGAGAACGAGTCTCAGTCAGTTAAACAAGGCGA
GGAATTTGCAGAACTTGGATAAAGCAAGCAATCAAGACGATAAAGTAAAA
TTAATTGGAAATAATTTGGACGATTTATATTTGGAATTAAACTCAATTCA
TCTACGAACTTGTGCAAGAGAAATCGTGATCCATTTGTTCATCATTGGCG
AGGAAATAAAGAAAATGAATGAAATCCGACAATCGAAATTCTACCAAGAA
GCAATTCAGTTTTGCAATAAAAATCTGCTTTTTTTGGCGATTTTGCAAGC
TCACTTAGGCAATTTGTTAAGGAATAATTTATGCCTTGAGGATAGGATAG
AGCTTGTGAATCACATAAAGTCACTGATTGAGAAATCTGAGAACAACTTG
TCTGATGTGAAACTGAACCAAAAACCTAACTCGGACAAAATGCCGGCACC
GATTATTGAGAGAAAAGGCAGTAATTACATCATTGTGAAGGTGGATGAGA
ATGTCCCTTCCGAGTTGAAATCCAAAATTGGCTGGATCAGACTGTACGGT
CGAGCGGTTGATTCTCCCAATGCAGAGGTGCGATTGACAGATGATAAGTT
ACCAGGGACTGGGGTCGAGACTTCTTGCCTGTCTACCAAGTTCACCATTT
ACGATCTGACTGTTAATGAGCAATACATATTGGCTTTCAGTATTAATGAT
AAATTCGGGTCTCCCATTGGCAGAGGCATCGGTAAATCTACCAAATATAT
TCTAGCAATTGATACAATCAATCCTGTTACAGCAATTTCAATTATTACTC
AGATTCTCTATGAAATGGGACAAAAAGAAGAGGTGATTTGGTATGAAAAT
TTGCTGTGGCCTCAGTTTGTTGAAGCGATTCCCGATTGTGTGGAAACCTA
TCAAAGATCTGTTTTACCAAGATCTAGTTTCCATAAAGAATACAAGATAA
AAGTGGACGTACTTAATAACTCATCACCCATGCTGTTGCGAAAATTCTGT
GTTTCCGTGCTGTCGGCGATTGATTGTGAATGTCGGATTCTAAACATAAC
GAACGACATCAACGTCAAATCCCATTCACAAATGGGAGATCAAATAAATC
GGTTGAAAATGGTTGACAAACTGTTGGCTTTGTTTAGCATCAGTAAGAAA
CTGAAGGACAGCTTGCTGACAATGGAGATATTTACGACTGTCGCCTGTTT
GCTGGCTCCAATTATGAACCAGAATCAATTTTTCAAGCCTTATTTCTCAG
TGTTATCAACTTGCGTGAATGTTCTGGTTGGGTTACCGCAAACGACTTGG
ATCAAGATCCCTGCAGCCCTTAAGACTTACATTCATCATTTATCAGCATG
CATTGGGTTTTATCTTTTGAAATGCCTCAATAACTTCCCATCTTATGGTG
ATTTCTCGGAAACGATACGTCAATCCGTTACATTACTCTTGCAAATGTCA
GGAAACGCTCCATTTACAGTAACTGAACAGGAAGATACGTCGGGAACTGC
CAGTCAAATCGAAATTAAGAGTGAAAAGTCTCAAATAAATCCTCAGAAAA
AGGTGATTGTCAAAGTCAATAAGGGAGAAAATTCCGCTGCGAATTTCTCT
GTCCAGCAAGTGGCGTTTGAGAGTTTTAAATTCACTTTGGCTAAACAAGG
TCTGGTTGATCATCAGTTGTCTGGAAATGAGGAACCCGATATCCTTATGG
CCTACATTACCCTATTGCCCAGTCGTCACGCTTATAAAGAAGTTTTGAAG
TTTTCCCGCAAAAATCGCTATTTGCAATTTATCGTGGAAATCCTTCACAA
AGCCGTTGTTGAGGGTAACCTAGAAAATTCGTTGAATTATTACCGAGAAA
TAAAGGAATGGCTGAAAAAGAGAAATGAAGCGATTTTGGGTCGATCTCTG
ATCCAGCTTCAAAGTCAAATGAACCGCGAAACTATTCAAACTAAATCACA
GAATCCGGCCGTTATCAGTGACAATAATTTGTTTTCCCGATCAGTCAGAA
CGGACGAAGATGTCGAAGACTCAAAAAGACCTTCAAAACCAAAAAAGAAA
GCTAAGTACAAGCTCCAATCTGATAAGGCTATCAATGTTTTGCCAAGCAT
GAGTGAGACTCAGAAACAAATTCAGGAACAGGCAGAATTAAAGGCACTTG
ACGTTCTATCTACGACATTTGTGTCAATGTATAAGCAGAATTTGAGACGA
CGCCGATTTCGCCAGTTATCAGAATACGAAAGGGTATCCCGTATAAAGAT
GAATTGCTCCATGGCCATGGGTTACTTAGCAATCAGCCATGCTAAAGTCG
ATTCTCTAACTCAAATTTTAAATGGGGGATTTAGGTTTTCCGAAGTACCT
GAAATTGAAGATATTACTAAGTTCATGTTGGAAAGCACTGGGAAAATTCT
CCCATTGGACGAAACGCCAATTCCTGATCAGATTTCTACAGTTTTGAAGA
TGACCAAACAACAAACCTCAAGACAAACAGACACTCCTCGGACATATCGA
TCGGATGTCAATGTCTCTGAGAAGCGACTGTTTGTGGAGGCACCAAAATT
GTTAAGCCAGCTTTCTGATGCGATGAATAAAGCAGCCTTGCTACTGAAGA
GAGCCATAGTGCTCGCAGCCCGTAGTAAAGTTTGGGTATTATTATTCAAA
GCCTGCTCATTGTCATGGTACACTTTATCCTCATTTATAAACACAACCAA
CCGACTAACGAAATTCCTCAATGCCGCAAAGAAAGACTTTCCTGAAGTTG
ATTGGAGTCAAATACAGTCTTTTTCTATGAACAATCTTTTCAAATTGTAT
TCCAGCGTATTCTTTTTTGGGTCTCAATCAATTTTAGACATGATCGAAGT
TCTTGGCAAATCCAATCTGCACAAAATTTCAAAAGACTTTGATGAAAATT
TCACGGAGAACTTTATTTTGAAATCAGTCCATCTGCTGTTTGAAACCGGA
AGCTATGAAAAATCCATTCACGTTATTCTGAGGTTCACCTCGATTACCAA
CTATCTATTCGTCAATGTCACCCATCCTATCCTCATCGAATCCCAACAGC
AGCTTTGCCAAAAAGCGAAAGACAATCAAGCTAGAAACCCTGATTGGACC
CTACAACAATGTGAACAATATGTAACAGATTGTCAATCAAAAATGAAGGT
TGACCATCTCGATTCATCCAACTACCAACAATTCCTCAACAAAATCCTAT
CGGGATATTTCGGCCGGAAAAAGCTTTATCAATCCAAATCTAAAGTTCTC
CGCAAAGTCCAACAATCAGAACATGAGGATTTATATGTAAATAACCTTTT
AAACATTCTGAAATCGGAGGCATCTTCGAATTTGATTTTCTCCGTTCCCG
TTAGGCCTGAAGTGTCCCACAAGGAGTGGGTAACGTATCAAAACGTGCGC
AGCATCAAACGAGAATGGATGGAATTATATTATAAGAGAAACTATTTTGA
CTACTTGCATAGTTCTGATTGCATAACCGTCGGAAATAATCATAAGATGA
ATTTACAAGAACTTCTGACTTCATACAAGGAATTCCTCGATAACTCTCTG
TCGAATAACGACCTGAATCATTACTCTTTCGCACTGAATGCCATGGGAGA
TCTCTATATTAGTCACCTACATAAGCCAAGTTTGGCCTTGTCTGCCTGGA
ATGGAAGTCTGGATTGCCTTTTGAATCAAAAACAATCGGTGAAGAACATT
AGCCAAATAATCGGGATCATTGACAAAGATTTTGTGAAATGTCAATTTCA
AATGGAAAAGTTGCTGTCAAAGTTCGGGGGGATCAAATGTCTTGTTATTG
GCGGTTTGCTGACAAAGGTCTCCAGATTGGATGATCTCACATGTGATGAA
CGGCTCAATATTTGTCTTAATGCCGCCATGTTTTATAAGGCGATTTACAG
CGGTTCCTTTGCTCATCCTGAGGATGACATGAATTACTTAGTTCATTCTC
TTTACCTCGATGCAGCAAATTCTATCCCATTAGTTCCCAAAGTCAACATA
TTTTCAAATTCTTCTGTTATCAGTGTTGAAGATGTAGAATCCCAGCTATA
TTTCCTCATAACCCACCTTGTGAAGGCGGGATATTATCAATTCTCGATTT
GCCTGCTGTCCTTGTACGAGCACATCGTATACACGATTTCTAGGAGTTCT
GTGAAATCCATTGAAGCTCAAATGATCAAATTAGAAATTTGTATTAGATT
GAGACGATTCTCAACTGCCAGTCGGCTCCTTTTCCAATTGTTTACTGGGG
ATAAAGTTCCTCAACTGGCCGATTCCCGGCCAGCAGCAACAGTTACCAAA
ACACCAGCAAATGTATATGATGATCAGAAACAACTAACTGATGAAAAGAA
TCTTATAGTTCTTGATAAAATTATCTCCAGAAGAATTGTTCCTAGTTTAG
CTCAAAGATTAGGTCCAACAATAGCCAGTAAAATATCCCTTCTACAAGCA
CTGTTCCTAATTGAATTATCCTCGTGCGTTCCAGTTTCCCCTGAAATGCT
AGATCCCAGTCGCTATAGTTCCCCTCTGCAGGCTCCAGTATTGTCCAAAA
AACCGACAACAAAGAAATCAGAACCCATTGGAATTCAAACTGAAGAAGAA
AGTCATTCCATTTTGGATTCTTTAGCATCCAATTTGCAGTACTCGACATG
GAAGGACATTTCCTTACCGATACTAAAAGGATTGATGCTCCACGCTGCTA
CTGCTATTGTCCATCCAATCATCGAGGATTTTATCCTCGCAATTCAGAGA
GAGGACTTTATGCATTTGAAGCTGAATCTTTATGAAGTGGATAACGTGTT
TTTCGGCTTACTAGTCCAGGCAAGAAATTGTAGATTACGCCTGCGCAACC
GTTCCGGGGCCAGACTTGCAATGTTTGCCGGGAGGCTCTTGAAGGAGTAT
TTCGATGAATCTATATCATTCGATACAAAATCTGCCAGGGTTTTTGAGCA
TTTGGATATTTTCTCCCATATGAAATGGAACCAAGAATTAGTCGAGTGCT
TGCTGGGAGAAGTTTCAGTCGAAAATCCTTTGGATGTAAGCGAAACTGCG
ATATCTGACGTTCCGCCTGTGAAGGATGTTATCATATCATGCATTGGTGA
GTGTGATGGGAAAGGTCTCCTTCAACATAAAGCGTGGTTCATTTCCGCTC
TTGCGCAGTATTCATTTATATCCGGCTATGAGGTTGAGAAATACAAAGCA
ATCTTGTCAGAATCTGTGGAAATCTTTGACAACATCAATTGGTTATCCGA
TCACAGTGAGAATGCTTTCATTGTATCCCAATTGAGAGGGATAAACCAAC
TGATTTCCTCAACAGACAAACCGGATTTACGCCGCTCGATTGTTGATGCG
GAAAAGGCATTGCGGAAACTTCATGAGCGGTTATTGAATACGATTGACGG
AAAGTACTTACAATCGGTTATGTGGAACGTCAACGAGCCGGATTTGTCTT
CGGTGCAAATCGCAAATGTCTATGATGGGAAGCTGAATTATCTGTGCAAA
ATCAAGCTTTTATTCGGGATCATTTTCATGGAGAAAAGTAGATTTGCTAC
CGAGAAACAAGAGTTACGCATGAAAGCATTGGCGGTTCTCAACGTCGGAT
TGGACATTTGTCGGTCTTTGTCCCGAAGAGTGCCTTGGATAGAAACGGAA
TACTTTCTGACAATTGGACGAATTCAGAGACTTCTTATATCTTCTGGAAA
AGTATCTCATTTGTCGACAATAAACACTTTTCTTGAAGGTCTTAGGCTTT
GTGTTCTATCAACTGGTCATTTAGGGTTGAAAAAGCAATTTTTCCTTGAA
TTAGCGATTACGTTCATGATTAGCAGTCATTTGGTAGGGGACTCGGTAGA
GAAAGATGGGGAAATTGTTGAATCGACAAAATTGCTATTCAACACTCACC
AAGCCCAGATGTTACAAAATCACAAAATCTCCAAGAATGAAGCTTTGACC
TTTAAAAGACTTTCTTGGCTCGCCATCAAATGTGCAAGTAGCGTGTCGGA
TTCCATTCAACATTTAAACTACTGTAAAAGCGATACTAGTAAACTGCTGT
CTGAAGACGCTCAGGACAATTTTCCCATTTCCGCTTTGTTCGATTTGTAT
GGAAGATTCAAGTTGGGCAGTAAACGAATTACTTTTAAAAATGAAATAGA
GGAGGAACTCAGTCGAATGCCGGAATACAAACTTTTGAAAGATAATGAGA
ATCTTGATGACCAACTTGATAAAATCAAACCCTATACAAGCAGAACTTCA
TTGTCTCAAGTTCTTGCTTATCATGAGGTGCTCATGAAGCTGACCAATAA
TACTTTCCTTACCAAGTCGGAGAGTTTTGAATTGCGAGTGAAACCTTTGA
CCCGCTGCATTTTCAACGATGATCAGTTTTTCGAAAAGGAAGAAGAAATA
AATAAATTTCTCTTTCAACACATTCCTGAATACCGAGGTAAATGTATCAC
ACTGATCCCAAAGGATTTCTCGAATTTATCTCCGACAAACACATCGGAAG
GAATCGAAGAACTTATCATTGGAAATGTTAATGAAGAAATCTGGAATACG
AGAATAGTTGAAGGAGAAAGTATCGAAACTCCGCAATGTCTTAGATTGTT
CACCGAATATCCAAAAGGAATCTTGTTATCAATTGAAATTCCCGAAAGGA
TTCCTTTGGAAAAATCTGAGGTCAACGAAACGGAAATATTTATGAACTTC
TATGAGTCTCCGTTCGAATTCCATATGGAATCGGAATCTAGAACGATGAT
GTTATATGCAGAATCGAAGAAAGTTCCGAAGTCGGTAAATAAGTCAGAAT
CAATATTGAGCGGGTGGTTGTTAATTTCATCAAAGGATATCTTTCCAGTT
TATCAGGATTTCCGGGAATCGGCTCAGTTATTAGAAATCCTGGCAAATAA
TCCAGAATCAACTACTGCATCCAAATCATCCGAAGGAGTCAAAAAGCCTC
CCTCTAATGCGTCGTCTGGTAATCCAAATAACACAAAGCAATTGAAAGCC
AGTTCTCAAATATTGCCTTTGCCGGTTGGATCGGAAATATCAGTTATAGA
GCTGAATGTTCGACAAGGACTTGACCGATTGGCTTCATGGGTTCGTCAGA
CATCGAGTATATTGTTCACTCCTCCTTACGATGGATTAATAAAGAATTCG
GAGCACATGTACACGGTCGTTACTTCTGGTTGCATCGTTAATGCGATTCC
ATTTGATGTTACCAAGGAAAATTTGCGCCTTCTCTCAAATGCCTTGAATC
CAATATTGTCGAGGCCCATCATAAATGCTCCACAACTTTCTAAATTTGTA
CAAGATGTCTTGAAAATTGACTTTTGATAGGGATT
back to top

protein sequence of SMED30019449-orf-1

>SMED30019449-orf-1 ID=SMED30019449-orf-1|Name=SMED30019449-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=3150bp
MSSNLFNKALKNIKTKDNLNKINCSEDEINENLKKSFEFELKNITKTIQL
QKLLPNKLYEFLIKYENNLPQEFFYKHTMELGDVLLRHGYSLIARNQCYE
RYLVNVHNLDVFHIELDDLDSHLSLEQIHQTESIVSAIFGLCLAEFRCME
ILDKRFQANFHQRKCHCLLTIYRRLMEIILKQERFCWLIYNGSVCIYWIS
EALIRSGLSMMVVEPLVWASCCLETSIPLLTIFNLKWRAVIYTATCQALF
NIQYDSDAEAFARRALVKINELHELYEISSDARSTENAIIFSEAVIKMGV
MIFKRNAFETRRRPKTYLRPKTKVNFKEILQNNWPRTGTERILAEMFDSP
SQQILAIMEAVKQPSRTIGKIEAPASENEWEMLDVYSELFYAAIAIITGR
STSVIGKSDKALVKEYRIVDVDENTDQLALSVLNGSAITIKATFELVCWA
FSYGNWEFLDTILDPLLAAIKDSKSLSHKLPLENTLKLIRLMRKCFHSSV
FVEKKVVKLSEQPIEDDRKQGDTQMNFRAPQRSNSSVSKDTRSSKSRKDN
PPADEEEKKGKQSQDPLCQLSELLKEIIATDFNPGNYFQEILVEAGLILW
NKCKPIFQTTQDGSLSNEPSKPIPSIGKWIRILDTAYRILSVTEYSTINP
ISYSEISIRLSVLLEQLSINNWFSTNTSEDDNCQELSLESFISQLKTEGT
SKSMKCIAAAKKIMRTSLSQLNKARNLQNLDKASNQDDKVKLIGNNLDDL
YLELNSIHLRTCAREIVIHLFIIGEEIKKMNEIRQSKFYQEAIQFCNKNL
LFLAILQAHLGNLLRNNLCLEDRIELVNHIKSLIEKSENNLSDVKLNQKP
NSDKMPAPIIERKGSNYIIVKVDENVPSELKSKIGWIRLYGRAVDSPNAE
VRLTDDKLPGTGVETSCLSTKFTIYDLTVNEQYILAFSINDKFGSPIGRG
IGKSTKYILAIDTINPVTAISIITQILYEMGQKEEVIWYENLLWPQFVEA
IPDCVETYQRSVLPRSSFHKEYKIKVDVLNNSSPMLLRKFCVSVLSAIDC
ECRILNITNDINVKSHSQMGDQINRLKMVDKLLALFSISKKLKDSLLTME
IFTTVACLLAPIMNQNQFFKPYFSVLSTCVNVLVGLPQTTWIKIPAALKT
YIHHLSACIGFYLLKCLNNFPSYGDFSETIRQSVTLLLQMSGNAPFTVTE
QEDTSGTASQIEIKSEKSQINPQKKVIVKVNKGENSAANFSVQQVAFESF
KFTLAKQGLVDHQLSGNEEPDILMAYITLLPSRHAYKEVLKFSRKNRYLQ
FIVEILHKAVVEGNLENSLNYYREIKEWLKKRNEAILGRSLIQLQSQMNR
ETIQTKSQNPAVISDNNLFSRSVRTDEDVEDSKRPSKPKKKAKYKLQSDK
AINVLPSMSETQKQIQEQAELKALDVLSTTFVSMYKQNLRRRRFRQLSEY
ERVSRIKMNCSMAMGYLAISHAKVDSLTQILNGGFRFSEVPEIEDITKFM
LESTGKILPLDETPIPDQISTVLKMTKQQTSRQTDTPRTYRSDVNVSEKR
LFVEAPKLLSQLSDAMNKAALLLKRAIVLAARSKVWVLLFKACSLSWYTL
SSFINTTNRLTKFLNAAKKDFPEVDWSQIQSFSMNNLFKLYSSVFFFGSQ
SILDMIEVLGKSNLHKISKDFDENFTENFILKSVHLLFETGSYEKSIHVI
LRFTSITNYLFVNVTHPILIESQQQLCQKAKDNQARNPDWTLQQCEQYVT
DCQSKMKVDHLDSSNYQQFLNKILSGYFGRKKLYQSKSKVLRKVQQSEHE
DLYVNNLLNILKSEASSNLIFSVPVRPEVSHKEWVTYQNVRSIKREWMEL
YYKRNYFDYLHSSDCITVGNNHKMNLQELLTSYKEFLDNSLSNNDLNHYS
FALNAMGDLYISHLHKPSLALSAWNGSLDCLLNQKQSVKNISQIIGIIDK
DFVKCQFQMEKLLSKFGGIKCLVIGGLLTKVSRLDDLTCDERLNICLNAA
MFYKAIYSGSFAHPEDDMNYLVHSLYLDAANSIPLVPKVNIFSNSSVISV
EDVESQLYFLITHLVKAGYYQFSICLLSLYEHIVYTISRSSVKSIEAQMI
KLEICIRLRRFSTASRLLFQLFTGDKVPQLADSRPAATVTKTPANVYDDQ
KQLTDEKNLIVLDKIISRRIVPSLAQRLGPTIASKISLLQALFLIELSSC
VPVSPEMLDPSRYSSPLQAPVLSKKPTTKKSEPIGIQTEEESHSILDSLA
SNLQYSTWKDISLPILKGLMLHAATAIVHPIIEDFILAIQREDFMHLKLN
LYEVDNVFFGLLVQARNCRLRLRNRSGARLAMFAGRLLKEYFDESISFDT
KSARVFEHLDIFSHMKWNQELVECLLGEVSVENPLDVSETAISDVPPVKD
VIISCIGECDGKGLLQHKAWFISALAQYSFISGYEVEKYKAILSESVEIF
DNINWLSDHSENAFIVSQLRGINQLISSTDKPDLRRSIVDAEKALRKLHE
RLLNTIDGKYLQSVMWNVNEPDLSSVQIANVYDGKLNYLCKIKLLFGIIF
MEKSRFATEKQELRMKALAVLNVGLDICRSLSRRVPWIETEYFLTIGRIQ
RLLISSGKVSHLSTINTFLEGLRLCVLSTGHLGLKKQFFLELAITFMISS
HLVGDSVEKDGEIVESTKLLFNTHQAQMLQNHKISKNEALTFKRLSWLAI
KCASSVSDSIQHLNYCKSDTSKLLSEDAQDNFPISALFDLYGRFKLGSKR
ITFKNEIEEELSRMPEYKLLKDNENLDDQLDKIKPYTSRTSLSQVLAYHE
VLMKLTNNTFLTKSESFELRVKPLTRCIFNDDQFFEKEEEINKFLFQHIP
EYRGKCITLIPKDFSNLSPTNTSEGIEELIIGNVNEEIWNTRIVEGESIE
TPQCLRLFTEYPKGILLSIEIPERIPLEKSEVNETEIFMNFYESPFEFHM
ESESRTMMLYAESKKVPKSVNKSESILSGWLLISSKDIFPVYQDFRESAQ
LLEILANNPESTTASKSSEGVKKPPSNASSGNPNNTKQLKASSQILPLPV
GSEISVIELNVRQGLDRLASWVRQTSSILFTPPYDGLIKNSEHMYTVVTS
GCIVNAIPFDVTKENLRLLSNALNPILSRPIINAPQLSKFVQDVLKIDF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000074oocyte
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000231vitelline gland
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR027912CFAP54
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR027912Cilia- and flagella-associated protein 54PFAMPF14858DUF4486coord: 56..613
e-value: 4.4E-116
score: 388.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 541..563
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 3012..3035
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 513..565
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1374..1393
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 524..540
NoneNo IPR availablePANTHERPTHR33487FAMILY NOT NAMEDcoord: 49..2740