Protein kinase

Overview
NameProtein kinase
Smed IDSMED30019445
Length (bp)2742
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase (SMED30019445) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase (SMED30019445) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase (SMED30019445) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase (SMED30019445) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019445

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30019445SMESG000012946.1 SmedASXL_013142SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30019445SMESG000012946.1 dd_Smed_v6_18494_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30019445SMESG000012946.1 dd_Smed_v6_26832_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30019445SMESG000012946.1 OX_Smed_1.0.08486ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase vs. Ensembl Human
Match: SCYL2 (SCY1 like pseudokinase 2 [Source:HGNC Symbol;Acc:HGNC:19286])

HSP 1 Score: 216.853 bits (551), Expect = 2.632e-59
Identity = 159/615 (25.85%), Postives = 310/615 (50.41%), Query Frame = 2
Query:  188 KAMISRITSIKRHSAAPEIPISIKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLA----EKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRN--VSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNK--ENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQL 2008
            K+ ++++T+    SA    P++  + F +G  I+  GN   WK    TK  + Q  ++ +++K+ ++K Y+   K+ + + L+R ++ L   RH  LL +   + E+ D L F  EP+  SLAN++   E LP     DIK  KL  +E   G  Q+ E L  LH +  ++HGN+ P NI+++    WK+ G  FC+       ++ K     W+P       P+  Y+APE  L       SD++SLG ++ +++N G  + E ++      +++++D++        + +P  + + V+ +L+  PT RPD +++ ++  F D   ++L    +L  +   ++  FF    K++    + +  QRILP L   F  + ++  FVLP++L +  + +K ++ K +   L  +   +   Q   + L  ++  + +    EI + +LP+  R LE P          +   N +    N++    +K  ++ ++K   N   +   L V++  L CL ++LE LD   ++D+++PFL  +     ++ + ILGIYK   + +  GI+ + +A K+LP LIP ++   L   +F   + V++++L+++E +   +L
Sbjct:    9 KSTVTKVTA-DVTSAVMGNPVT--REFDVGRHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKLIDK-YQKFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWENLPSPISPDIKDYKLYDVETKYGLLQVSEGLSFLHSSVKMVHGNITPENIILNKSGAWKIMGFDFCVSSTNPSEQEPKFPCKEWDPNLPSLCLPNPEYLAPEYILSVSCETASDMYSLGTVMYAVFNKGKPIFEVNKQDIYKSFSRQLDQLSRLGSSSLTNIPEEVREHVKLLLNVTPTVRPDADQMTKIPFFDDVGAVTLQYFDTLFQRDNLQKSQFFKGLPKVLPKLPKRVIVQRILPCLTSEF-VNPDMVPFVLPNVLLIAEECTKEEYVKLILPELGPVFKQQEPIQILLIFLQKMDLLLTKTPPDEIKNSVLPMVYRALEAPS-----IQIQELCLNIIPTFANLIDYPSMKNALIPRIK---NACLQTSSLAVRVNSLVCLGKILEYLDKWFVLDDILPFLQQIPSKEPAVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIENNLNLNQFNSFISVIKEMLNRLESEHKTKL 610          
BLAST of Protein kinase vs. Ensembl Human
Match: SCYL2 (SCY1 like pseudokinase 2 [Source:HGNC Symbol;Acc:HGNC:19286])

HSP 1 Score: 219.164 bits (557), Expect = 9.879e-59
Identity = 159/615 (25.85%), Postives = 310/615 (50.41%), Query Frame = 2
Query:  188 KAMISRITSIKRHSAAPEIPISIKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLA----EKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRN--VSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNK--ENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQL 2008
            K+ ++++T+    SA    P++  + F +G  I+  GN   WK    TK  + Q  ++ +++K+ ++K Y+   K+ + + L+R ++ L   RH  LL +   + E+ D L F  EP+  SLAN++   E LP     DIK  KL  +E   G  Q+ E L  LH +  ++HGN+ P NI+++    WK+ G  FC+       ++ K     W+P       P+  Y+APE  L       SD++SLG ++ +++N G  + E ++      +++++D++        + +P  + + V+ +L+  PT RPD +++ ++  F D   ++L    +L  +   ++  FF    K++    + +  QRILP L   F  + ++  FVLP++L +  + +K ++ K +   L  +   +   Q   + L  ++  + +    EI + +LP+  R LE P          +   N +    N++    +K  ++ ++K   N   +   L V++  L CL ++LE LD   ++D+++PFL  +     ++ + ILGIYK   + +  GI+ + +A K+LP LIP ++   L   +F   + V++++L+++E +   +L
Sbjct:    9 KSTVTKVTA-DVTSAVMGNPVT--REFDVGRHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKLIDK-YQKFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWENLPSPISPDIKDYKLYDVETKYGLLQVSEGLSFLHSSVKMVHGNITPENIILNKSGAWKIMGFDFCVSSTNPSEQEPKFPCKEWDPNLPSLCLPNPEYLAPEYILSVSCETASDMYSLGTVMYAVFNKGKPIFEVNKQDIYKSFSRQLDQLSRLGSSSLTNIPEEVREHVKLLLNVTPTVRPDADQMTKIPFFDDVGAVTLQYFDTLFQRDNLQKSQFFKGLPKVLPKLPKRVIVQRILPCLTSEF-VNPDMVPFVLPNVLLIAEECTKEEYVKLILPELGPVFKQQEPIQILLIFLQKMDLLLTKTPPDEIKNSVLPMVYRALEAPS-----IQIQELCLNIIPTFANLIDYPSMKNALIPRIK---NACLQTSSLAVRVNSLVCLGKILEYLDKWFVLDDILPFLQQIPSKEPAVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIENNLNLNQFNSFISVIKEMLNRLESEHKTKL 610          
BLAST of Protein kinase vs. Ensembl Human
Match: SCYL2 (SCY1 like pseudokinase 2 [Source:HGNC Symbol;Acc:HGNC:19286])

HSP 1 Score: 217.624 bits (553), Expect = 2.870e-58
Identity = 160/619 (25.85%), Postives = 311/619 (50.24%), Query Frame = 2
Query:  188 KAMISRITSIKRHSAAPEIPISIKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLA----EKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRN--VSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNT----EISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNK--ENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQL 2008
            K+ ++++T+    SA    P++  + F +G  I+  GN   WK    TK  + Q  ++ +++K+ ++K Y+   K+ + + L+R ++ L   RH  LL +   + E+ D L F  EP+  SLAN++   E LP     DIK  KL  +E   G  Q+ E L  LH +  ++HGN+ P NI+++    WK+ G  FC+       ++ K     W+P       P+  Y+APE  L       SD++SLG ++ +++N G  + E ++      +++++D++        + +P  + + V+ +L+  PT RPD +++ ++  F D   ++L    +L  +   ++  FF    K++    + +  QRILP L   F  + ++  FVLP++L +  + +K ++ K +   L  +       + SN    + L  ++  + +    EI + +LP+  R LE P          +   N +    N++    +K  ++ ++K   N   +   L V++  L CL ++LE LD   ++D+++PFL  +     ++ + ILGIYK   + +  GI+ + +A K+LP LIP ++   L   +F   + V++++L+++E +   +L
Sbjct:    9 KSTVTKVTA-DVTSAVMGNPVT--REFDVGRHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKLIDK-YQKFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWENLPSPISPDIKDYKLYDVETKYGLLQVSEGLSFLHSSVKMVHGNITPENIILNKSGAWKIMGFDFCVSSTNPSEQEPKFPCKEWDPNLPSLCLPNPEYLAPEYILSVSCETASDMYSLGTVMYAVFNKGKPIFEVNKQDIYKSFSRQLDQLSRLGSSSLTNIPEEVREHVKLLLNVTPTVRPDADQMTKIPFFDDVGAVTLQYFDTLFQRDNLQKSQFFKGLPKVLPKLPKRVIVQRILPCLTSEF-VNPDMVPFVLPNVLLIAEECTKEEYVKLILPELGPVFKQQEPIQASNMILLIFLQKMDLLLTKTPPDEIKNSVLPMVYRALEAPS-----IQIQELCLNIIPTFANLIDYPSMKNALIPRIK---NACLQTSSLAVRVNSLVCLGKILEYLDKWFVLDDILPFLQQIPSKEPAVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIENNLNLNQFNSFISVIKEMLNRLESEHKTKL 614          
BLAST of Protein kinase vs. Ensembl Human
Match: AC091230.1 (unc-51 like kinase 3 [Source:NCBI gene;Acc:25989])

HSP 1 Score: 61.2326 bits (147), Expect = 6.310e-9
Identity = 74/270 (27.41%), Postives = 115/270 (42.59%), Query Frame = 2
Query:  311 WKT-CQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICS---LANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILIST--HNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTER 1102
            W+  C C K D+ +  +I+   K+++ K           E L  EIE L   RH +++QL      ++D +  + E   C+   L+  I  R +LPE        R  M         Q+  AL+ LH  N I H +L P NIL+S+      K+   GF          H   W+ K V  G P   Y+APE+  +     + D++S+G+I+             SR+ S   +KI   R   L +   L     D +Q++L R P+ R
Sbjct:   38 WEARCWCAK-DTREVVAIKCVAKKSLNKAS--------VENLLTEIEILKGIRHPHIVQL-KDFQWDSDNIYLIME--FCAGGDLSRFIHTRRILPEKVA-----RVFMQ--------QLASALQFLHERN-ISHLDLKPQNILLSSLEKPHLKLADFGFA--------QHMSPWDEKHVLRGSP--LYMAPEMVCQRQYDARVDLWSMGVILYEALFGQPPF--ASRSFSELEEKIRSNRVIELPLRPLLSRDCRDLLQRLLERDPSRR 269          
BLAST of Protein kinase vs. Ensembl Human
Match: AC091230.1 (unc-51 like kinase 3 [Source:NCBI gene;Acc:25989])

HSP 1 Score: 60.8474 bits (146), Expect = 6.985e-9
Identity = 76/285 (26.67%), Postives = 119/285 (41.75%), Query Frame = 2
Query:  263 SFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICS---LANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILIST--HNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTER 1102
             FI+ E +       V+K     K D+ +  +I+   K+++ K           E L  EIE L   RH +++QL      ++D +  + E   C+   L+  I  R +LPE        R  M         Q+  AL+ LH  N I H +L P NIL+S+      K+   GF          H   W+ K V  G P   Y+APE+  +     + D++S+G+I+             SR+ S   +KI   R   L +   L     D +Q++L R P+ R
Sbjct:   13 GFILTERLGSGTYATVYKAY--AKKDTREVVAIKCVAKKSLNKA--------SVENLLTEIEILKGIRHPHIVQL-KDFQWDSDNIYLIME--FCAGGDLSRFIHTRRILPEKV-----ARVFMQ--------QLASALQFLHERN-ISHLDLKPQNILLSSLEKPHLKLADFGFA--------QHMSPWDEKHVLRGSP--LYMAPEMVCQRQYDARVDLWSMGVILYEALFGQPPF--ASRSFSELEEKIRSNRVIELPLRPLLSRDCRDLLQRLLERDPSRR 258          
BLAST of Protein kinase vs. Ensembl Celegans
Match: ZC581.9 (pep chromosome:WBcel235:I:6665077:6673840:-1 gene:WBGene00022635.1 transcript:ZC581.9b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZC581.9)

HSP 1 Score: 112.464 bits (280), Expect = 4.558e-25
Identity = 72/275 (26.18%), Postives = 132/275 (48.00%), Query Frame = 2
Query:  311 WKTCQCTKIDSGQNCSIQIYEKRTMEKIYK--SKRKEY-VSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPE--IQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEEL 1120
            W+      +   ++ S+ +++K++  K      K K Y + ++++ E + L    H  +L +  S+ E  DY+ F  E I  +L N++ +                L  LEI LG  Q+++ + +LH +  ++HGNL P  I ++    WK+ G  F +   E      Y W  K     QPDL+++APE     +      +D+FSLG++IC IY  G  LI+   N+  Y   + ++ +    I ++L  ++ D++ ++LS     RP ++ L
Sbjct:   40 WRIFNSKSVFGNKDASVLVFDKKSNVKAPPKLGKSKTYSMFDLIKYETQQLMGLIHPRILHMEHSLEETKDYISFATEQIFGNLENVVTDES--------------LDRLEIKLGVLQIIDGMSYLHNSAKMLHGNLTPDAIYVTATKTWKIGGFSFAVNAKEPNCYPCYPWTKKLPPCLQPDLDFLAPENLAPGQTTVTSAADVFSLGVLICWIYAGGKRLIDAKSNLETYHIVVGQLDAALQCISNELGPNLKDSMAKVLSLDVEVRPTVQLL 300          
BLAST of Protein kinase vs. Ensembl Celegans
Match: ZC581.9 (pep chromosome:WBcel235:I:6665077:6673602:-1 gene:WBGene00022635.1 transcript:ZC581.9d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZC581.9)

HSP 1 Score: 112.079 bits (279), Expect = 5.227e-25
Identity = 72/275 (26.18%), Postives = 132/275 (48.00%), Query Frame = 2
Query:  311 WKTCQCTKIDSGQNCSIQIYEKRTMEKIYK--SKRKEY-VSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPE--IQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEEL 1120
            W+      +   ++ S+ +++K++  K      K K Y + ++++ E + L    H  +L +  S+ E  DY+ F  E I  +L N++ +                L  LEI LG  Q+++ + +LH +  ++HGNL P  I ++    WK+ G  F +   E      Y W  K     QPDL+++APE     +      +D+FSLG++IC IY  G  LI+   N+  Y   + ++ +    I ++L  ++ D++ ++LS     RP ++ L
Sbjct:   53 WRIFNSKSVFGNKDASVLVFDKKSNVKAPPKLGKSKTYSMFDLIKYETQQLMGLIHPRILHMEHSLEETKDYISFATEQIFGNLENVVTDES--------------LDRLEIKLGVLQIIDGMSYLHNSAKMLHGNLTPDAIYVTATKTWKIGGFSFAVNAKEPNCYPCYPWTKKLPPCLQPDLDFLAPENLAPGQTTVTSAADVFSLGVLICWIYAGGKRLIDAKSNLETYHIVVGQLDAALQCISNELGPNLKDSMAKVLSLDVEVRPTVQLL 313          
BLAST of Protein kinase vs. Ensembl Celegans
Match: ZC581.9 (pep chromosome:WBcel235:I:6665077:6670409:-1 gene:WBGene00022635.1 transcript:ZC581.9a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZC581.9)

HSP 1 Score: 112.079 bits (279), Expect = 5.505e-25
Identity = 72/275 (26.18%), Postives = 132/275 (48.00%), Query Frame = 2
Query:  311 WKTCQCTKIDSGQNCSIQIYEKRTMEKIYK--SKRKEY-VSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPE--IQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEEL 1120
            W+      +   ++ S+ +++K++  K      K K Y + ++++ E + L    H  +L +  S+ E  DY+ F  E I  +L N++ +                L  LEI LG  Q+++ + +LH +  ++HGNL P  I ++    WK+ G  F +   E      Y W  K     QPDL+++APE     +      +D+FSLG++IC IY  G  LI+   N+  Y   + ++ +    I ++L  ++ D++ ++LS     RP ++ L
Sbjct:   78 WRIFNSKSVFGNKDASVLVFDKKSNVKAPPKLGKSKTYSMFDLIKYETQQLMGLIHPRILHMEHSLEETKDYISFATEQIFGNLENVVTDES--------------LDRLEIKLGVLQIIDGMSYLHNSAKMLHGNLTPDAIYVTATKTWKIGGFSFAVNAKEPNCYPCYPWTKKLPPCLQPDLDFLAPENLAPGQTTVTSAADVFSLGVLICWIYAGGKRLIDAKSNLETYHIVVGQLDAALQCISNELGPNLKDSMAKVLSLDVEVRPTVQLL 338          
BLAST of Protein kinase vs. Ensembl Celegans
Match: ZC581.9 (pep chromosome:WBcel235:I:6665077:6673807:-1 gene:WBGene00022635.1 transcript:ZC581.9c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZC581.9)

HSP 1 Score: 112.079 bits (279), Expect = 6.122e-25
Identity = 72/275 (26.18%), Postives = 132/275 (48.00%), Query Frame = 2
Query:  311 WKTCQCTKIDSGQNCSIQIYEKRTMEKIYK--SKRKEY-VSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPE--IQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEEL 1120
            W+      +   ++ S+ +++K++  K      K K Y + ++++ E + L    H  +L +  S+ E  DY+ F  E I  +L N++ +                L  LEI LG  Q+++ + +LH +  ++HGNL P  I ++    WK+ G  F +   E      Y W  K     QPDL+++APE     +      +D+FSLG++IC IY  G  LI+   N+  Y   + ++ +    I ++L  ++ D++ ++LS     RP ++ L
Sbjct:   85 WRIFNSKSVFGNKDASVLVFDKKSNVKAPPKLGKSKTYSMFDLIKYETQQLMGLIHPRILHMEHSLEETKDYISFATEQIFGNLENVVTDES--------------LDRLEIKLGVLQIIDGMSYLHNSAKMLHGNLTPDAIYVTATKTWKIGGFSFAVNAKEPNCYPCYPWTKKLPPCLQPDLDFLAPENLAPGQTTVTSAADVFSLGVLICWIYAGGKRLIDAKSNLETYHIVVGQLDAALQCISNELGPNLKDSMAKVLSLDVEVRPTVQLL 345          
BLAST of Protein kinase vs. Ensembl Celegans
Match: dyf-5 (Serine/threonine-protein kinase dyf-5 [Source:UniProtKB/Swiss-Prot;Acc:B3WFY8])

HSP 1 Score: 57.3806 bits (137), Expect = 2.997e-8
Identity = 57/224 (25.45%), Postives = 97/224 (43.30%), Query Frame = 2
Query:  296 GNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDERE-VLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNY---SWNPKQVKYGQPDLNYIAPEIQLK----NVPMFQSDIFSLGLIICSIY 943
            G+    +     KID+G   +I    KR  +K Y      +   +  RE++ L +  H  +++L   + EN D L FV E +  +L  L+ +R+   PES + +I              YQ+++ L  +H  NG  H ++ P NI+ +     K+   G   ++  K    +Y    W             Y APEI L+    N P+   D+++LG I+  +Y
Sbjct:   18 GDGTFGEVMLAKKIDTGDRVAI----KRMKKKFY-----SWEEAMSLREVKSLKKLNHPNIIKLREVIREN-DILYFVFEFMQENLYELMKDRDRYFPESVIRNI-------------IYQVLQGLAFMH-KNGFFHRDMKPENIMCNGTELVKIADFGLAREIRSKPPYTDYVSTRW-------------YRAPEILLRSTSYNSPI---DMWALGCIMAELY 201          
BLAST of Protein kinase vs. Ensembl Fly
Match: bma (gene:FBgn0085385 transcript:FBtr0331577)

HSP 1 Score: 250.366 bits (638), Expect = 2.425e-70
Identity = 165/618 (26.70%), Postives = 317/618 (51.29%), Query Frame = 2
Query:  254 IKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDERE--------------------------VLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNY---SWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFF-NLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNKENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQLNIE 2017
            I Q F IG+ ++  G E VW+     +    + CS+ I+EK+  EK++K +RKE ++E+L+  ++ L  FRH  +LQ++ +V E+ D L F  EPI  SL+N++   E                           LP+   +  K    + +E+  GF Q+ EAL +LH +  +IH N+CPS+ILI+    WK+ G+ +  ++ E   + +     W+ +  K  QP+L+++APE Q  +     SD+FSLG++IC+++NNG  LI+   + S Y K+++ +     K+  +LP ++ +   +M SR  T RP  + L+ +  F D+ I +L  L  ++ K   ++  F+     + +      L +Q I P+L      +  L   + P ++  + +A+  ++D  +   ++ I NT  S Q +  +L+ L   I++   +++ + I+P+     +    S  Q  S   +    V   + +  L ++  +L K+K +F K     K+    L C++++++ ++   ++DEV+P L  +   +  I +  + IY  +   +  G++ + +A  +LP LIP  VNP L  E++  ++ VL+++L+ I+R +  +L ++
Sbjct:   30 ITQYFEIGKPVACAGPELVWRIHDAYRKSDNKECSVFIFEKKIAEKLHKPRRKETITELLKSSVKTLERFRHPRILQIYHTVEESADTLAFASEPIFASLSNVLAFHESKTYEATNVAPAAGGAAASQAQAAANTLPQRPAH-AKEYNFLDMELKYGFLQLTEALAYLHYSGHVIHRNVCPSSILITKRGIWKLAGMEYVERMNENDLNSSIPCPPWSNRVSKMAQPNLDFMAPETQSTSKCSLLSDMFSLGMVICAVFNNGRPLIQAGNSTSNYAKQMETLDDLVHKLMPRLPIALQEATSRMASRDATARPTAQLLQLIKYFIDTPINALKFLDVVNMKDTQQKSQFYKTTLIEAMPMIPRKLWWQNIWPMLKSEINNNEVLAAVLQP-VMLFVQEATLTEYDTLMSATMKVIYNTPKSIQASVTILENLHLIIEKTKPEDVTTDIMPMLFYSFD---GSTIQVQSAAVVAVANVF--DSIDELSIRRMVLPKVKQVFEKNITDPKIVQNVLMCIERVMDRMERAQVMDEVLPLLANIRIPDPDIIMRTVRIYHKLFVDKTYGLTVETMATNVLPLLIPHTVNPSLNFEQYCYLLEVLQQMLEAIDRQQRNKLKLD 640          
BLAST of Protein kinase vs. Ensembl Fly
Match: bma (gene:FBgn0085385 transcript:FBtr0331578)

HSP 1 Score: 250.366 bits (638), Expect = 2.425e-70
Identity = 165/618 (26.70%), Postives = 317/618 (51.29%), Query Frame = 2
Query:  254 IKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDERE--------------------------VLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNY---SWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFF-NLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNKENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQLNIE 2017
            I Q F IG+ ++  G E VW+     +    + CS+ I+EK+  EK++K +RKE ++E+L+  ++ L  FRH  +LQ++ +V E+ D L F  EPI  SL+N++   E                           LP+   +  K    + +E+  GF Q+ EAL +LH +  +IH N+CPS+ILI+    WK+ G+ +  ++ E   + +     W+ +  K  QP+L+++APE Q  +     SD+FSLG++IC+++NNG  LI+   + S Y K+++ +     K+  +LP ++ +   +M SR  T RP  + L+ +  F D+ I +L  L  ++ K   ++  F+     + +      L +Q I P+L      +  L   + P ++  + +A+  ++D  +   ++ I NT  S Q +  +L+ L   I++   +++ + I+P+     +    S  Q  S   +    V   + +  L ++  +L K+K +F K     K+    L C++++++ ++   ++DEV+P L  +   +  I +  + IY  +   +  G++ + +A  +LP LIP  VNP L  E++  ++ VL+++L+ I+R +  +L ++
Sbjct:   30 ITQYFEIGKPVACAGPELVWRIHDAYRKSDNKECSVFIFEKKIAEKLHKPRRKETITELLKSSVKTLERFRHPRILQIYHTVEESADTLAFASEPIFASLSNVLAFHESKTYEATNVAPAAGGAAASQAQAAANTLPQRPAH-AKEYNFLDMELKYGFLQLTEALAYLHYSGHVIHRNVCPSSILITKRGIWKLAGMEYVERMNENDLNSSIPCPPWSNRVSKMAQPNLDFMAPETQSTSKCSLLSDMFSLGMVICAVFNNGRPLIQAGNSTSNYAKQMETLDDLVHKLMPRLPIALQEATSRMASRDATARPTAQLLQLIKYFIDTPINALKFLDVVNMKDTQQKSQFYKTTLIEAMPMIPRKLWWQNIWPMLKSEINNNEVLAAVLQP-VMLFVQEATLTEYDTLMSATMKVIYNTPKSIQASVTILENLHLIIEKTKPEDVTTDIMPMLFYSFD---GSTIQVQSAAVVAVANVF--DSIDELSIRRMVLPKVKQVFEKNITDPKIVQNVLMCIERVMDRMERAQVMDEVLPLLANIRIPDPDIIMRTVRIYHKLFVDKTYGLTVETMATNVLPLLIPHTVNPSLNFEQYCYLLEVLQQMLEAIDRQQRNKLKLD 640          
BLAST of Protein kinase vs. Ensembl Fly
Match: bma (gene:FBgn0085385 transcript:FBtr0331579)

HSP 1 Score: 249.98 bits (637), Expect = 4.720e-70
Identity = 165/618 (26.70%), Postives = 317/618 (51.29%), Query Frame = 2
Query:  254 IKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDERE--------------------------VLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNY---SWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFF-NLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNKENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQLNIE 2017
            I Q F IG+ ++  G E VW+     +    + CS+ I+EK+  EK++K +RKE ++E+L+  ++ L  FRH  +LQ++ +V E+ D L F  EPI  SL+N++   E                           LP+   +  K    + +E+  GF Q+ EAL +LH +  +IH N+CPS+ILI+    WK+ G+ +  ++ E   + +     W+ +  K  QP+L+++APE Q  +     SD+FSLG++IC+++NNG  LI+   + S Y K+++ +     K+  +LP ++ +   +M SR  T RP  + L+ +  F D+ I +L  L  ++ K   ++  F+     + +      L +Q I P+L      +  L   + P ++  + +A+  ++D  +   ++ I NT  S Q +  +L+ L   I++   +++ + I+P+     +    S  Q  S   +    V   + +  L ++  +L K+K +F K     K+    L C++++++ ++   ++DEV+P L  +   +  I +  + IY  +   +  G++ + +A  +LP LIP  VNP L  E++  ++ VL+++L+ I+R +  +L ++
Sbjct:   30 ITQYFEIGKPVACAGPELVWRIHDAYRKSDNKECSVFIFEKKIAEKLHKPRRKETITELLKSSVKTLERFRHPRILQIYHTVEESADTLAFASEPIFASLSNVLAFHESKTYEATNVAPAAGGAAASQAQAAANTLPQRPAH-AKEYNFLDMELKYGFLQLTEALAYLHYSGHVIHRNVCPSSILITKRGIWKLAGMEYVERMNENDLNSSIPCPPWSNRVSKMAQPNLDFMAPETQSTSKCSLLSDMFSLGMVICAVFNNGRPLIQAGNSTSNYAKQMETLDDLVHKLMPRLPIALQEATSRMASRDATARPTAQLLQLIKYFIDTPINALKFLDVVNMKDTQQKSQFYKTTLIEAMPMIPRKLWWQNIWPMLKSEINNNEVLAAVLQP-VMLFVQEATLTEYDTLMSATMKVIYNTPKSIQASVTILENLHLIIEKTKPEDVTTDIMPMLFYSFD---GSTIQVQSAAVVAVANVF--DSIDELSIRRMVLPKVKQVFEKNITDPKIVQNVLMCIERVMDRMERAQVMDEVLPLLANIRIPDPDIIMRTVRIYHKLFVDKTYGLTVETMATNVLPLLIPHTVNPSLNFEQYCYLLEVLQQMLEAIDRQQRNKLKLD 640          
BLAST of Protein kinase vs. Ensembl Fly
Match: CG1951 (gene:FBgn0039623 transcript:FBtr0085342)

HSP 1 Score: 192.586 bits (488), Expect = 1.551e-50
Identity = 153/591 (25.89%), Postives = 295/591 (49.92%), Query Frame = 2
Query:  254 IKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCI--KLAEKGKSHNYSWNPKQVK-----YGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQ---LKEQILSKLKVIFNKENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDR 1996
            + + + + E +   G   +WK     K  + Q  S+ ++EK+++E+  K  R E + E LRR ++ L + RH ++L +   + E+ D L F  EP+  SLAN++ +         N    +KL  +EI  G  Q+ + L+ LH    I+H N+    I+I+ +  WK+ G  FCI  + A  G  H   W  ++         QP L Y APE+ L +V    SD+FSLG++I +IY  G  L     + S + +  +++        + +P+ + ++++ +L      RP + EL+++  F+D  + +L  L SL      ++  F+    +++      +    ILP L+  F  +S +  FVLP++L +   +S+ ++  H+  +L+ I       Q   + +  ++  +     +E+   +LPL  R LE              L  CL +L    T +    +K  +L ++K +  + + V  V++ CL  + +LLE+LD  +++DE++PFL  +     +I + I+GIYK  ++    GI+  ++A K +P L+P +V  GL   +F  ++ ++++++ ++E+++
Sbjct:   27 VTREYEVLEQVCTAGVGLMWKVYNGHKKSTKQEVSVFVFEKKSLERWSKDDR-ETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVGD---------NVRSEKKLYDVEIRHGLLQLFDGLQFLHQDAKIVHRNISAETIVINKNRSWKLFGFDFCIANQPATDGTPH---WPFREYTTSLHVLAQPSLEYTAPELALNSVNTPDSDLFSLGVLIFTIYA-GKPLKMFGSDYSSFRRYANDLNQRKYPPMNAVPSELTESLKALLHPSANLRPKLHELKQIAYFQDVGVKTLSYLDSLYQWDNLQKSKFYKGLPQIIPTLPHRVNLHSILPYLVKEF-VNSPMIPFVLPNVLLIAEMSSQREYCDHILPHLKPIFKLTDPIQILLIFMQKMDLLLKLTPAEEVKQSVLPLLYRSLE------CDMPQIQDL--CLAVLPTFSTLIDYNAMKNSVLPRIKKLCLQSSNV-SVKVNCLISIGKLLENLDKWLVLDEILPFLQQIQSREPAIIMGIIGIYKIAMTNTKLGITKDVMAHKCIPYLVPLSVENGLTIAQFNTIISLIKEMMGRVEQEQ 593          
BLAST of Protein kinase vs. Ensembl Fly
Match: PEK (gene:FBgn0037327 transcript:FBtr0330026)

HSP 1 Score: 55.4546 bits (132), Expect = 2.273e-7
Identity = 47/165 (28.48%), Postives = 83/165 (50.30%), Query Frame = 2
Query:  647 FYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAE----KGKSHNYSWNPKQVKYGQPDLN--YIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELR 1123
            F+Q+V+A+ ++H+  G+IH +L PSNI  S   Q K+   G    +A+      K  + S  P   ++ Q      Y++PE  L     ++ DI+SLGLI   ++    + +E  R  ++ + +  +   +F   Y +      D +QQMLS  P +RP  ++L+
Sbjct:  909 FHQIVDAVDYVHL-KGLIHRDLKPSNIFFSQDGQIKIGDFGLVTDMADIPNLVAKCGDQSGLPSCARHTQQVGTHLYMSPEQLLGQHYDYKVDIYSLGLIFFELHVYFSTEME--RIKTLRSLRDGQYPKDFAVNYPQQ----YDLLQQMLSAQPEQRPQTKQLK 1066          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: SCYL2 (si:ch211-244b2.1 [Source:ZFIN;Acc:ZDB-GENE-041210-205])

HSP 1 Score: 207.608 bits (527), Expect = 3.799e-55
Identity = 146/591 (24.70%), Postives = 293/591 (49.58%), Query Frame = 2
Query:  254 IKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHN----YSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRN--VSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNKENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQL 2008
            + + F +G+ I+  G    W+    TK  + Q  ++ +++K+ +++ Y+   K+ + + L++ I+ L   RH  LL +   + E+ D L F  EP+  SLAN++ + + LP     DIK  KL  +E   G  Q+ E L  LH    ++HGNLC  NI+++    WK+ G  F I  +    +        W+P       P+  Y+APE  L       SD++SLG++I +++N G  + + ++      +++++D++      + S++P  +   V+ +LS     RPD +++ ++  F D   ++L    SL  +   ++  FF    K++    + +   RILP LM  F  + ++  F+LP++L +  + +K ++ + +  +L  +   +   Q   + L  ++  + +   ++I + +LP+  R +E P          +   N +    N++    +K  ++ ++K     +   L V++  L CL ++LE LD   ++DE++PFL  +     ++ + ILGIYK   + +  GI  + +A K LP L+  +++  L   +F   M V++ +L ++E +   +L
Sbjct:   28 VTREFEVGKHIASGGPGMSWRIYNGTKKSTKQEVAVFVFDKKVIDR-YQKFEKDQIIDSLKKGIQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGQWDNLPSPVPTDIKDYKLYDVETKYGLLQVSEGLSFLHSGVKMVHGNLCSENIILNKSGAWKIMGFDFSISSSNPSDAEPKYVCKEWDPNLPPLCLPNPEYVAPEYILSVSCDSASDMYSLGVLIHAVFNEGKPVFKVNKQDIFKSFSRQLDQLSHLSPGVLSQIPEEVRQHVKMLLSVTSNVRPDADQMTKIPFFDDVGAMTLQYFDSLFQRDNLQKSQFFKGLPKVLPKLPKRVVVYRILPALMSEF-VNPDMVPFILPNVLLIAEECTKEEYVRLVLPDLTPVFKMQEPVQILLIFLQKMDLLLTKTPPEDIKNSVLPMVYRAVEAPS-----VQIQELCLNIIPTFANLIEYPSMKNSLIPRIKSTC-LQTSSLAVRVNSLVCLGKILEYLDKWFVIDEILPFLQQIPSREPAVLMGILGIYKCTFTHKKLGIPKEHLAGKSLPHLVSLSIDNNLNLNQFNSFMAVIKDMLTRMEAEHKVKL 610          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: SCYL2 (si:ch211-244b2.1 [Source:ZFIN;Acc:ZDB-GENE-041210-205])

HSP 1 Score: 207.608 bits (527), Expect = 3.799e-55
Identity = 146/591 (24.70%), Postives = 293/591 (49.58%), Query Frame = 2
Query:  254 IKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHN----YSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRN--VSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNKENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQL 2008
            + + F +G+ I+  G    W+    TK  + Q  ++ +++K+ +++ Y+   K+ + + L++ I+ L   RH  LL +   + E+ D L F  EP+  SLAN++ + + LP     DIK  KL  +E   G  Q+ E L  LH    ++HGNLC  NI+++    WK+ G  F I  +    +        W+P       P+  Y+APE  L       SD++SLG++I +++N G  + + ++      +++++D++      + S++P  +   V+ +LS     RPD +++ ++  F D   ++L    SL  +   ++  FF    K++    + +   RILP LM  F  + ++  F+LP++L +  + +K ++ + +  +L  +   +   Q   + L  ++  + +   ++I + +LP+  R +E P          +   N +    N++    +K  ++ ++K     +   L V++  L CL ++LE LD   ++DE++PFL  +     ++ + ILGIYK   + +  GI  + +A K LP L+  +++  L   +F   M V++ +L ++E +   +L
Sbjct:   28 VTREFEVGKHIASGGPGMSWRIYNGTKKSTKQEVAVFVFDKKVIDR-YQKFEKDQIIDSLKKGIQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGQWDNLPSPVPTDIKDYKLYDVETKYGLLQVSEGLSFLHSGVKMVHGNLCSENIILNKSGAWKIMGFDFSISSSNPSDAEPKYVCKEWDPNLPPLCLPNPEYVAPEYILSVSCDSASDMYSLGVLIHAVFNEGKPVFKVNKQDIFKSFSRQLDQLSHLSPGVLSQIPEEVRQHVKMLLSVTSNVRPDADQMTKIPFFDDVGAMTLQYFDSLFQRDNLQKSQFFKGLPKVLPKLPKRVVVYRILPALMSEF-VNPDMVPFILPNVLLIAEECTKEEYVRLVLPDLTPVFKMQEPVQILLIFLQKMDLLLTKTPPEDIKNSVLPMVYRAVEAPS-----VQIQELCLNIIPTFANLIEYPSMKNSLIPRIKSTC-LQTSSLAVRVNSLVCLGKILEYLDKWFVIDEILPFLQQIPSREPAVLMGILGIYKCTFTHKKLGIPKEHLAGKSLPHLVSLSIDNNLNLNQFNSFMAVIKDMLTRMEAEHKVKL 610          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: si:ch211-197l9.5 (si:ch211-197l9.5 [Source:ZFIN;Acc:ZDB-GENE-091204-323])

HSP 1 Score: 57.3806 bits (137), Expect = 3.929e-8
Identity = 67/291 (23.02%), Postives = 126/291 (43.30%), Query Frame = 2
Query:  263 SFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLID---EREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELRE 1126
            S+++G++I+     +  K      I +G+  +I++ +K+      K+++  YV + ++RE       RH  ++ L  ++   N Y M +    +C   +L+D   ER+ L E  V    TR            Q++ A+ HLH  +GI+H +L   N L+  HN  K+   G    L    K  + S +    + G P   Y APE+        + D++S+G+ + ++            N+    +K+  V      I S +  +  + V  +L   P +RP ++   E
Sbjct:   46 SYLVGKMIN---KGSFAKVMLGMNISTGEKVAIKVIDKK------KARQDSYVLKNMKREPRIHQLIRHPNIVLLLETLETENCYYMAME---LCGGGDLMDRICERKRLDEREVRRF-TR------------QILSAVEHLH-RHGIVHRDLKIENFLLDEHNNIKIVDFGLSNTL----KGDSLSVDLLNTQCGSP--AYAAPELLAHKKYGPKVDVWSVGVSMFAMLTGTLPFTVEPFNIKQLHQKM--VNGEISPIPSDISKAAVEFVLSLLEPEPAKRPTVKAAME 302          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: plk2b (polo-like kinase 2b (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-070720-17])

HSP 1 Score: 56.225 bits (134), Expect = 1.439e-7
Identity = 69/286 (24.13%), Postives = 123/286 (43.01%), Query Frame = 2
Query:  320 CQCTKIDSGQNCSIQIYEKRTME--KIYKSK-------RKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQ----MLSRIPTERPDIEELREMDCF 1138
            C C     G+    + YE   +   KIY +K        K +  E + REIE      H +++  +    + ++  + +      SLA+++  R+VL E              E+     Q V AL++LH    I+H +L   N+ +S   + KV   G   KL           N ++   G P  NY++PE+  K    ++SD+++LG I+ ++   G    E + N+    + I E R         LP+S+    +Q    ML++ P +RP ++++   + F
Sbjct:   53 CYCRGKVLGKGGFAKCYEMTDLSSSKIYAAKIIPHTRVSKPHQREKINREIELHRTLSHKHIVHFYHHFEDKDNIYILLEYCGRRSLAHILKARKVLTEP-------------EVRYYLKQTVSALKYLHDLE-ILHRDLKLGNLFVSDSMELKVGDFGLAAKLEPVS-------NRRKTICGTP--NYLSPEVLNKQGHGWESDVWALGCIMYTML-LGKPPFETT-NLKETYRCIREARYT-------LPSSLSLPAKQLISGMLAQNPVDRPHLDDIIRHEFF 306          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: plk2b (polo-like kinase 2b (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-070720-17])

HSP 1 Score: 56.225 bits (134), Expect = 1.439e-7
Identity = 69/286 (24.13%), Postives = 123/286 (43.01%), Query Frame = 2
Query:  320 CQCTKIDSGQNCSIQIYEKRTME--KIYKSK-------RKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQ----MLSRIPTERPDIEELREMDCF 1138
            C C     G+    + YE   +   KIY +K        K +  E + REIE      H +++  +    + ++  + +      SLA+++  R+VL E              E+     Q V AL++LH    I+H +L   N+ +S   + KV   G   KL           N ++   G P  NY++PE+  K    ++SD+++LG I+ ++   G    E + N+    + I E R         LP+S+    +Q    ML++ P +RP ++++   + F
Sbjct:   53 CYCRGKVLGKGGFAKCYEMTDLSSSKIYAAKIIPHTRVSKPHQREKINREIELHRTLSHKHIVHFYHHFEDKDNIYILLEYCGRRSLAHILKARKVLTEP-------------EVRYYLKQTVSALKYLHDLE-ILHRDLKLGNLFVSDSMELKVGDFGLAAKLEPVS-------NRRKTICGTP--NYLSPEVLNKQGHGWESDVWALGCIMYTML-LGKPPFETT-NLKETYRCIREARYT-------LPSSLSLPAKQLISGMLAQNPVDRPHLDDIIRHEFF 306          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: gatad2b (GATA zinc finger domain containing 2B [Source:Xenbase;Acc:XB-GENE-5995517])

HSP 1 Score: 221.861 bits (564), Expect = 1.032e-59
Identity = 157/591 (26.57%), Postives = 299/591 (50.59%), Query Frame = 2
Query:  254 IKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLA----EKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRN--VSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNKENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQL 2008
            + + F +G+ I+  GN   WK    TK  + Q  ++ +++K+ ++K Y+   K+ + + L+R ++ L   RH  LL +   + E+ D L F  EP+  SLAN++   + LP     +I+  KL   E   G  Q+ E L  LH +  +IH NL P NI+++    WK+ G  FC        ++ K     W+P       P+  Y+APE  L       SD++SLG+II ++YN G ++ E ++      +++++D++      +   +P  + + V+ +L+   T RPD +++ ++  F D  +++L    SL  +   ++  FF    K++    + +  QRILP L   F  + ++  FVLP++L +  + +K ++ K +  +L  +   +   Q   + L  ++  + +    EI + +LP+  R LE P          +   N +    N++    +K  ++ ++K     +   L V++  L CL ++LE LD   ++DE++PFL  +     ++ + ILGIYK   + +  GI+ + +A K+LP LIP +++  L   +F   M V++++L+K+E +   +L
Sbjct:   28 VTREFDVGKHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKIIDK-YQKYEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGSWDNLPSPLPPEIREHKLFDAEAKYGLLQVSEGLSFLHSSVKMIHANLTPENIILNKSGAWKIMGFDFCNPATNPSDQEAKFVCKEWDPNLPPLCLPNPEYLAPEYILSVSCDPASDMYSLGVIIHAVYNKGKTIFEVNKQDIYKSFSRQLDQLSRLNPNVLVNIPEEVKEHVKLLLNVTSTVRPDADQMTKIPFFDDVGVVTLQYFDSLFQQDNLQKSQFFKELPKVLQKLPKRVVVQRILPALTSEF-VNPDMVPFVLPNVLLIAEECTKEEYTKLILPDLGPVFRQQEPIQILLIFLQKMDLLLTKTPPDEIRNSVLPMVYRALEAPS-----IQIQELCLNIIPTFANLIDYPSMKNSLIPRIKNAC-LQTSSLAVRVNSLVCLGKILEYLDKWFVIDELLPFLQQIPSREPAVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIDNNLNLSQFNSFMAVIKEMLNKLESEHKTKL 610          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: gatad2b (GATA zinc finger domain containing 2B [Source:Xenbase;Acc:XB-GENE-5995517])

HSP 1 Score: 210.69 bits (535), Expect = 2.484e-56
Identity = 152/571 (26.62%), Postives = 286/571 (50.09%), Query Frame = 2
Query:  254 IKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLA----EKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRN--VSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNK--ENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEF 1942
            + + F +G+ I+  GN   WK    TK  + Q  ++ +++K+ ++K Y+   K+ + + L+R ++ L   RH  LL +   + E+ D L F  EP+  SLAN++   + LP     +I+  KL   E   G  Q+ E L  LH +  +IH NL P NI+++    WK+ G  FC        ++ K     W+P       P+  Y+APE  L       SD++SLG+II ++YN G ++ E ++      +++++D++      +   +P  + + V+ +L+   T RPD +++ ++  F D  +++L    SL  +   ++  FF    K++    + +  QRILP L   F  + ++  FVLP++L +  + +K ++ K +  +L  +   +   Q   + L  ++  + +    EI + +LP+  R LE P          +   N +    N++    +K  ++ ++K   N   +   L V++  L CL ++LE LD   ++DE++PFL  +     ++ + ILGIYK   + +  GI+ + +A K+LP LIP +++  L   +F
Sbjct:   28 VTREFDVGKHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKIIDK-YQKYEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGSWDNLPSPLPPEIREHKLFDAEAKYGLLQVSEGLSFLHSSVKMIHANLTPENIILNKSGAWKIMGFDFCNPATNPSDQEAKFVCKEWDPNLPPLCLPNPEYLAPEYILSVSCDPASDMYSLGVIIHAVYNKGKTIFEVNKQDIYKSFSRQLDQLSRLNPNVLVNIPEEVKEHVKLLLNVTSTVRPDADQMTKIPFFDDVGVVTLQYFDSLFQQDNLQKSQFFKELPKVLQKLPKRVVVQRILPALTSEF-VNPDMVPFVLPNVLLIAEECTKEEYTKLILPDLGPVFRQQEPIQILLIFLQKMDLLLTKTPPDEIRNSVLPMVYRALEAPS-----IQIQELCLNIIPTFANLIDYPSMKNSLIPRIK---NACLQTSSLAVRVNSLVCLGKILEYLDKWFVIDELLPFLQQIPSREPAVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIDNNLNLSQF 588          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: gatad2b (GATA zinc finger domain containing 2B [Source:Xenbase;Acc:XB-GENE-5995517])

HSP 1 Score: 207.994 bits (528), Expect = 1.009e-55
Identity = 153/575 (26.61%), Postives = 287/575 (49.91%), Query Frame = 2
Query:  254 IKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLA----EKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRN--VSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILN----TEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNK--ENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEF 1942
            + + F +G+ I+  GN   WK    TK  + Q  ++ +++K+ ++K Y+   K+ + + L+R ++ L   RH  LL +   + E+ D L F  EP+  SLAN++   + LP     +I+  KL   E   G  Q+ E L  LH +  +IH NL P NI+++    WK+ G  FC        ++ K     W+P       P+  Y+APE  L       SD++SLG+II ++YN G ++ E ++      +++++D++      +   +P  + + V+ +L+   T RPD +++ ++  F D  +++L    SL  +   ++  FF    K++    + +  QRILP L   F  + ++  FVLP++L +  + +K ++ K +  +L  +       + SN    + L  ++  + +    EI + +LP+  R LE P          +   N +    N++    +K  ++ ++K   N   +   L V++  L CL ++LE LD   ++DE++PFL  +     ++ + ILGIYK   + +  GI+ + +A K+LP LIP +++  L   +F
Sbjct:   28 VTREFDVGKHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKIIDK-YQKYEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGSWDNLPSPLPPEIREHKLFDAEAKYGLLQVSEGLSFLHSSVKMIHANLTPENIILNKSGAWKIMGFDFCNPATNPSDQEAKFVCKEWDPNLPPLCLPNPEYLAPEYILSVSCDPASDMYSLGVIIHAVYNKGKTIFEVNKQDIYKSFSRQLDQLSRLNPNVLVNIPEEVKEHVKLLLNVTSTVRPDADQMTKIPFFDDVGVVTLQYFDSLFQQDNLQKSQFFKELPKVLQKLPKRVVVQRILPALTSEF-VNPDMVPFVLPNVLLIAEECTKEEYTKLILPDLGPVFRQQEPIQASNMILLIFLQKMDLLLTKTPPDEIRNSVLPMVYRALEAPS-----IQIQELCLNIIPTFANLIDYPSMKNSLIPRIK---NACLQTSSLAVRVNSLVCLGKILEYLDKWFVIDELLPFLQQIPSREPAVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIDNNLNLSQF 592          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: gatad2b (GATA zinc finger domain containing 2B [Source:Xenbase;Acc:XB-GENE-5995517])

HSP 1 Score: 207.994 bits (528), Expect = 1.445e-55
Identity = 153/575 (26.61%), Postives = 287/575 (49.91%), Query Frame = 2
Query:  254 IKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLA----EKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRN--VSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILN----TEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNK--ENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEF 1942
            + + F +G+ I+  GN   WK    TK  + Q  ++ +++K+ ++K Y+   K+ + + L+R ++ L   RH  LL +   + E+ D L F  EP+  SLAN++   + LP     +I+  KL   E   G  Q+ E L  LH +  +IH NL P NI+++    WK+ G  FC        ++ K     W+P       P+  Y+APE  L       SD++SLG+II ++YN G ++ E ++      +++++D++      +   +P  + + V+ +L+   T RPD +++ ++  F D  +++L    SL  +   ++  FF    K++    + +  QRILP L   F  + ++  FVLP++L +  + +K ++ K +  +L  +       + SN    + L  ++  + +    EI + +LP+  R LE P          +   N +    N++    +K  ++ ++K   N   +   L V++  L CL ++LE LD   ++DE++PFL  +     ++ + ILGIYK   + +  GI+ + +A K+LP LIP +++  L   +F
Sbjct:   28 VTREFDVGKHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKIIDK-YQKYEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGSWDNLPSPLPPEIREHKLFDAEAKYGLLQVSEGLSFLHSSVKMIHANLTPENIILNKSGAWKIMGFDFCNPATNPSDQEAKFVCKEWDPNLPPLCLPNPEYLAPEYILSVSCDPASDMYSLGVIIHAVYNKGKTIFEVNKQDIYKSFSRQLDQLSRLNPNVLVNIPEEVKEHVKLLLNVTSTVRPDADQMTKIPFFDDVGVVTLQYFDSLFQQDNLQKSQFFKELPKVLQKLPKRVVVQRILPALTSEF-VNPDMVPFVLPNVLLIAEECTKEEYTKLILPDLGPVFRQQEPIQASNMILLIFLQKMDLLLTKTPPDEIRNSVLPMVYRALEAPS-----IQIQELCLNIIPTFANLIDYPSMKNSLIPRIK---NACLQTSSLAVRVNSLVCLGKILEYLDKWFVIDELLPFLQQIPSREPAVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIDNNLNLSQF 592          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: gatad2b (GATA zinc finger domain containing 2B [Source:Xenbase;Acc:XB-GENE-5995517])

HSP 1 Score: 208.379 bits (529), Expect = 1.934e-55
Identity = 153/575 (26.61%), Postives = 287/575 (49.91%), Query Frame = 2
Query:  254 IKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLA----EKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRN--VSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNT----EISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNK--ENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEF 1942
            + + F +G+ I+  GN   WK    TK  + Q  ++ +++K+ ++K Y+   K+ + + L+R ++ L   RH  LL +   + E+ D L F  EP+  SLAN++   + LP     +I+  KL   E   G  Q+ E L  LH +  +IH NL P NI+++    WK+ G  FC        ++ K     W+P       P+  Y+APE  L       SD++SLG+II ++YN G ++ E ++      +++++D++      +   +P  + + V+ +L+   T RPD +++ ++  F D  +++L    SL  +   ++  FF    K++    + +  QRILP L   F  + ++  FVLP++L +  + +K ++ K +  +L  +       + SN    + L  ++  + +    EI + +LP+  R LE P          +   N +    N++    +K  ++ ++K   N   +   L V++  L CL ++LE LD   ++DE++PFL  +     ++ + ILGIYK   + +  GI+ + +A K+LP LIP +++  L   +F
Sbjct:   28 VTREFDVGKHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKIIDK-YQKYEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGSWDNLPSPLPPEIREHKLFDAEAKYGLLQVSEGLSFLHSSVKMIHANLTPENIILNKSGAWKIMGFDFCNPATNPSDQEAKFVCKEWDPNLPPLCLPNPEYLAPEYILSVSCDPASDMYSLGVIIHAVYNKGKTIFEVNKQDIYKSFSRQLDQLSRLNPNVLVNIPEEVKEHVKLLLNVTSTVRPDADQMTKIPFFDDVGVVTLQYFDSLFQQDNLQKSQFFKELPKVLQKLPKRVVVQRILPALTSEF-VNPDMVPFVLPNVLLIAEECTKEEYTKLILPDLGPVFRQQEPIQASNMILLIFLQKMDLLLTKTPPDEIRNSVLPMVYRALEAPS-----IQIQELCLNIIPTFANLIDYPSMKNSLIPRIK---NACLQTSSLAVRVNSLVCLGKILEYLDKWFVIDELLPFLQQIPSREPAVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIDNNLNLSQF 592          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Scyl2 (SCY1-like 2 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1289172])

HSP 1 Score: 220.705 bits (561), Expect = 2.051e-59
Identity = 159/615 (25.85%), Postives = 311/615 (50.57%), Query Frame = 2
Query:  188 KAMISRITSIKRHSAAPEIPISIKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLA----EKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRN--VSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNK--ENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQL 2008
            K+ ++++T+    SA    P++  + F +G  I+  GN   WK    TK  + Q  ++ +++K+ ++K Y+   K+ + + L+R ++ L   RH  LL +   + E+ D L F  EP+  SLAN++   E LP S   DIK  KL  +E   G  Q+ E L  LH +  ++HGN+ P N++++    WK+ G  FC+  +    ++ K     W+P       P+  Y+APE  L       SD++SLG ++ +++N G  + E ++      +++++D++        + +P  + + V+ +L+  PT RPD +++ ++  F D   ++L    +L  +   ++  FF    K++    + +  QRILP L   F  + ++  FVLP++L +  + +K ++ K +   L  +   +   Q   + L  ++  + +    EI + +LP+  R LE P          +   N +    N++    +K  ++ ++K   N   +   L V++  L CL ++LE LD   ++D+++PFL  +     ++ + ILGIYK   + +  GI+ + +A K+LP LIP ++   L   +F   + V++++L ++E +   +L
Sbjct:    9 KSTVTKVTA-DVTSAVMGNPVT--REFDVGRHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKLIDK-YQKFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWENLPSSISPDIKDYKLYDVETKYGLLQVSEGLSFLHSSVKMVHGNVTPENVILNKSGAWKIMGFDFCVSSSNPSEQEPKFPCKEWDPNLPSLCLPNPEYLAPEYILSVSCETASDMYSLGAVMYAVFNQGRPIFEVNKQDIYKSFSRQLDQLSRLGSSSLTSIPEEVREHVKLLLNVTPTVRPDADQMTKIPFFDDVGAVTLQYFDTLFQRDNLQKSQFFKGLPKVLPKLPKRVIVQRILPCLTSEF-VNPDMVPFVLPNVLLIAEECTKEEYIKLILPELGPVFKQQEPIQILLIFLQKMDLLLTKTPPDEIKNSVLPMVYRALEAPS-----IQIQELCLNIIPTFANLIDYPSMKNALIPRIK---NACLQTSSLAVRVNSLVCLGKILEYLDKWFVLDDILPFLQQIPSKEPAVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIENNLNLNQFSSFIAVIKEMLSRLESEHRTKL 610          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Scyl2 (SCY1-like 2 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1289172])

HSP 1 Score: 220.705 bits (561), Expect = 2.146e-59
Identity = 159/615 (25.85%), Postives = 311/615 (50.57%), Query Frame = 2
Query:  188 KAMISRITSIKRHSAAPEIPISIKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLA----EKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRN--VSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNK--ENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQL 2008
            K+ ++++T+    SA    P++  + F +G  I+  GN   WK    TK  + Q  ++ +++K+ ++K Y+   K+ + + L+R ++ L   RH  LL +   + E+ D L F  EP+  SLAN++   E LP S   DIK  KL  +E   G  Q+ E L  LH +  ++HGN+ P N++++    WK+ G  FC+  +    ++ K     W+P       P+  Y+APE  L       SD++SLG ++ +++N G  + E ++      +++++D++        + +P  + + V+ +L+  PT RPD +++ ++  F D   ++L    +L  +   ++  FF    K++    + +  QRILP L   F  + ++  FVLP++L +  + +K ++ K +   L  +   +   Q   + L  ++  + +    EI + +LP+  R LE P          +   N +    N++    +K  ++ ++K   N   +   L V++  L CL ++LE LD   ++D+++PFL  +     ++ + ILGIYK   + +  GI+ + +A K+LP LIP ++   L   +F   + V++++L ++E +   +L
Sbjct:    9 KSTVTKVTA-DVTSAVMGNPVT--REFDVGRHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKLIDK-YQKFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWENLPSSISPDIKDYKLYDVETKYGLLQVSEGLSFLHSSVKMVHGNVTPENVILNKSGAWKIMGFDFCVSSSNPSEQEPKFPCKEWDPNLPSLCLPNPEYLAPEYILSVSCETASDMYSLGAVMYAVFNQGRPIFEVNKQDIYKSFSRQLDQLSRLGSSSLTSIPEEVREHVKLLLNVTPTVRPDADQMTKIPFFDDVGAVTLQYFDTLFQRDNLQKSQFFKGLPKVLPKLPKRVIVQRILPCLTSEF-VNPDMVPFVLPNVLLIAEECTKEEYIKLILPELGPVFKQQEPIQILLIFLQKMDLLLTKTPPDEIKNSVLPMVYRALEAPS-----IQIQELCLNIIPTFANLIDYPSMKNALIPRIK---NACLQTSSLAVRVNSLVCLGKILEYLDKWFVLDDILPFLQQIPSKEPAVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIENNLNLNQFSSFIAVIKEMLSRLESEHRTKL 610          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Scyl3 (SCY1-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1921385])

HSP 1 Score: 65.855 bits (159), Expect = 1.705e-10
Identity = 92/412 (22.33%), Postives = 171/412 (41.50%), Query Frame = 2
Query:  335 IDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPE---IQLKNVPMFQS---DIFSLGLIICSIYNNGCSLIECSRNVSIYTKKID-EVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNS 1549
            +  G+  S+ +Y++   +K+ K+ +              L   RH  LL+  +   E +               +L+ ER V P     ++    L   E+  G Y ++ AL  LH    + H N+C S++ +S    WK+ G+    ++ +   +  +  N + V+    D   I PE    +   +P       D ++ G ++ S+             + I+ +++  +V S+FL+I              +L+ +P  RP +  L   D F++  +  ++ L SL  KS +E+ +FF      V+  SE+L   R++PLL++   F+  +    + S L  +    KA F   +   L  +           VLL  +E Y++   Q+++   ILP  L  L D  NS
Sbjct:   31 LQDGKCASVFVYKRENEDKVNKAAKH-------------LKTLRHPCLLRFLSCTVEADGI-------------HLVTER-VQP----LEVALETLSPAEVCAGIYDILLALIFLHDRGHLTHNNVCLSSVFVSEDGHWKLGGMETVCQVPQ--ATPEFLRNIQSVR----DPASIPPEEMSPEFSGLPESHGHARDAYAFGALVDSL-------------LPIFNEQVSADVLSSFLQILHS----------ALLNPMPECRPALSTLLSHDFFRNDFLEVVNFLKSLTLKSEDEKTEFFKFLLDRVSCLSEELIASRLVPLLLNQLVFAEPV---AVKSFLPYLLGPKKALFQSRVIPVLLRLFEVH-EEHVRMVLLSHIEAYVEHFTQEQLKKVILPQVLLGLRDTSNS 378          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Scyl3 (SCY1-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1921385])

HSP 1 Score: 65.855 bits (159), Expect = 1.705e-10
Identity = 92/412 (22.33%), Postives = 171/412 (41.50%), Query Frame = 2
Query:  335 IDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPE---IQLKNVPMFQS---DIFSLGLIICSIYNNGCSLIECSRNVSIYTKKID-EVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNS 1549
            +  G+  S+ +Y++   +K+ K+ +              L   RH  LL+  +   E +               +L+ ER V P     ++    L   E+  G Y ++ AL  LH    + H N+C S++ +S    WK+ G+    ++ +   +  +  N + V+    D   I PE    +   +P       D ++ G ++ S+             + I+ +++  +V S+FL+I              +L+ +P  RP +  L   D F++  +  ++ L SL  KS +E+ +FF      V+  SE+L   R++PLL++   F+  +    + S L  +    KA F   +   L  +           VLL  +E Y++   Q+++   ILP  L  L D  NS
Sbjct:   31 LQDGKCASVFVYKRENEDKVNKAAKH-------------LKTLRHPCLLRFLSCTVEADGI-------------HLVTER-VQP----LEVALETLSPAEVCAGIYDILLALIFLHDRGHLTHNNVCLSSVFVSEDGHWKLGGMETVCQVPQ--ATPEFLRNIQSVR----DPASIPPEEMSPEFSGLPESHGHARDAYAFGALVDSL-------------LPIFNEQVSADVLSSFLQILHS----------ALLNPMPECRPALSTLLSHDFFRNDFLEVVNFLKSLTLKSEDEKTEFFKFLLDRVSCLSEELIASRLVPLLLNQLVFAEPV---AVKSFLPYLLGPKKALFQSRVIPVLLRLFEVH-EEHVRMVLLSHIEAYVEHFTQEQLKKVILPQVLLGLRDTSNS 378          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Plk5 (polo like kinase 5 [Source:MGI Symbol;Acc:MGI:3026984])

HSP 1 Score: 64.6994 bits (156), Expect = 3.966e-10
Identity = 59/239 (24.69%), Postives = 107/239 (44.77%), Query Frame = 2
Query:  437 REIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMT-LEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRI----PTERPDIEELREMDCF 1138
            REI      RH  ++  F +   + D++  V E   CS       R+V  +S  + +K R+ +T  E+      +V  LR+LH    I+H +L PSN  ++ + + K+  LG   ++   G+ H       +V  G P  N+ APE+  +N    +SDI++LG I+ ++                    + E+  N    +   P  +  + + +++R+    P ERP ++ L + D F
Sbjct:   74 REIALHSRLRHRNIVA-FHAHFADRDHVYMVLE--YCS-------RQVPLQSLAHVLKVRRTLTEPEVRYYLRGLVSGLRYLHQQR-IVHRDLKPSNFFLNKNMEVKIGDLGLAARVGPAGRCH-------RVLCGTP--NFQAPEVVSRNGHSCKSDIWALGCIMYTVLTG---------TPPFAAAPLSEMYQNIRDGHYLEPTHLSPSARSLIARLLAPDPAERPSLDHLLQDDFF 283          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q8CFE4|SCYL2_MOUSE (SCY1-like protein 2 OS=Mus musculus OX=10090 GN=Scyl2 PE=1 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 1.501e-58
Identity = 159/615 (25.85%), Postives = 311/615 (50.57%), Query Frame = 2
Query:  188 KAMISRITSIKRHSAAPEIPISIKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLA----EKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRN--VSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNK--ENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQL 2008
            K+ ++++T+    SA    P++  + F +G  I+  GN   WK    TK  + Q  ++ +++K+ ++K Y+   K+ + + L+R ++ L   RH  LL +   + E+ D L F  EP+  SLAN++   E LP S   DIK  KL  +E   G  Q+ E L  LH +  ++HGN+ P N++++    WK+ G  FC+  +    ++ K     W+P       P+  Y+APE  L       SD++SLG ++ +++N G  + E ++      +++++D++        + +P  + + V+ +L+  PT RPD +++ ++  F D   ++L    +L  +   ++  FF    K++    + +  QRILP L   F  + ++  FVLP++L +  + +K ++ K +   L  +   +   Q   + L  ++  + +    EI + +LP+  R LE P          +   N +    N++    +K  ++ ++K   N   +   L V++  L CL ++LE LD   ++D+++PFL  +     ++ + ILGIYK   + +  GI+ + +A K+LP LIP ++   L   +F   + V++++L ++E +   +L
Sbjct:    9 KSTVTKVTA-DVTSAVMGNPVT--REFDVGRHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKLIDK-YQKFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWENLPSSISPDIKDYKLYDVETKYGLLQVSEGLSFLHSSVKMVHGNVTPENVILNKSGAWKIMGFDFCVSSSNPSEQEPKFPCKEWDPNLPSLCLPNPEYLAPEYILSVSCETASDMYSLGAVMYAVFNQGRPIFEVNKQDIYKSFSRQLDQLSRLGSSSLTSIPEEVREHVKLLLNVTPTVRPDADQMTKIPFFDDVGAVTLQYFDTLFQRDNLQKSQFFKGLPKVLPKLPKRVIVQRILPCLTSEF-VNPDMVPFVLPNVLLIAEECTKEEYIKLILPELGPVFKQQEPIQILLIFLQKMDLLLTKTPPDEIKNSVLPMVYRALEAPS-----IQIQELCLNIIPTFANLIDYPSMKNALIPRIK---NACLQTSSLAVRVNSLVCLGKILEYLDKWFVLDDILPFLQQIPSKEPAVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIENNLNLNQFSSFIAVIKEMLSRLESEHRTKL 610          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q6P3W7|SCYL2_HUMAN (SCY1-like protein 2 OS=Homo sapiens OX=9606 GN=SCYL2 PE=1 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 4.744e-58
Identity = 159/615 (25.85%), Postives = 310/615 (50.41%), Query Frame = 2
Query:  188 KAMISRITSIKRHSAAPEIPISIKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLA----EKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRN--VSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNK--ENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQL 2008
            K+ ++++T+    SA    P++  + F +G  I+  GN   WK    TK  + Q  ++ +++K+ ++K Y+   K+ + + L+R ++ L   RH  LL +   + E+ D L F  EP+  SLAN++   E LP     DIK  KL  +E   G  Q+ E L  LH +  ++HGN+ P NI+++    WK+ G  FC+       ++ K     W+P       P+  Y+APE  L       SD++SLG ++ +++N G  + E ++      +++++D++        + +P  + + V+ +L+  PT RPD +++ ++  F D   ++L    +L  +   ++  FF    K++    + +  QRILP L   F  + ++  FVLP++L +  + +K ++ K +   L  +   +   Q   + L  ++  + +    EI + +LP+  R LE P          +   N +    N++    +K  ++ ++K   N   +   L V++  L CL ++LE LD   ++D+++PFL  +     ++ + ILGIYK   + +  GI+ + +A K+LP LIP ++   L   +F   + V++++L+++E +   +L
Sbjct:    9 KSTVTKVTA-DVTSAVMGNPVT--REFDVGRHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKLIDK-YQKFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWENLPSPISPDIKDYKLYDVETKYGLLQVSEGLSFLHSSVKMVHGNITPENIILNKSGAWKIMGFDFCVSSTNPSEQEPKFPCKEWDPNLPSLCLPNPEYLAPEYILSVSCETASDMYSLGTVMYAVFNKGKPIFEVNKQDIYKSFSRQLDQLSRLGSSSLTNIPEEVREHVKLLLNVTPTVRPDADQMTKIPFFDDVGAVTLQYFDTLFQRDNLQKSQFFKGLPKVLPKLPKRVIVQRILPCLTSEF-VNPDMVPFVLPNVLLIAEECTKEEYVKLILPELGPVFKQQEPIQILLIFLQKMDLLLTKTPPDEIKNSVLPMVYRALEAPS-----IQIQELCLNIIPTFANLIDYPSMKNALIPRIK---NACLQTSSLAVRVNSLVCLGKILEYLDKWFVLDDILPFLQQIPSKEPAVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIENNLNLNQFNSFISVIKEMLNRLESEHKTKL 610          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q9P7X5|PPK32_SCHPO (Protein kinase domain-containing protein ppk32 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk32 PE=1 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.123e-31
Identity = 141/589 (23.94%), Postives = 263/589 (44.65%), Query Frame = 2
Query:  311 WKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSK------RKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREV----LPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPD-----LNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPN-SIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASK----ADFDKHLYYNLQYILNTEIS--NQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNKENQV-LKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQL 2008
            W     +K  + +  S+  ++K+ +  + K        +  YV E+LR+++  L   RH  LLQ+   + E+   + FV   I   L + I            S         L  +EI  G  Q+++ L  LH +  +IH N+ PS++++     WK+ G  F    ++  +S  Y +N     +G P      ++++APE     +   +SD+FS G +I SI+N   S+I  + ++  Y K+I  + S        LP+ ++   +++ L+  P +R  + EL     F  S I +L  L S   K  +E+  F    SK +  +   ++ Q+ILP L+D           ++PS+L  I++ SK    + F   ++  +  I++   S   +    +   ++    +L   E LSKI+P      E+   +   TS        L  L +I+    +K  I  KL   F+  NQ+ +KV IL    +    + LD+  IVD+++P L  V     ++ + ++ +Y     +    I  + + ++++P L   +V+P L  E++   M  +R L D +++    +L
Sbjct:   32 WTVYSASKKGTNEEVSVFTFDKKNLSTLLKRGSIDSNLKTNYVLELLRKDVSSLSRLRHPSLLQVVEPLEESKSSMSFVTRRIQSMLQDFIKSSNGGFSNYGSSANGKSSGNALEEVEIQKGLLQIIDGLVFLHGSAKVIHYNIRPSSVVVDAKGDWKLCGFSF----SQSVESARYEFN--DYDFGIPSSLQQSMDFLAPEYITHEIAGPESDVFSFGCLIYSIFNKNQSIINANNHLLSYEKEITSLNSPTFIESKNLPSENLKSLLKETLAVDPKQRASMFELERSPYFTGSAIAALRFLESFPEKLPSEKVSFMESLSKNLTTFPYRIQSQKILPTLLDHLNDQK-----LVPSLLPCIFEISKGLDSSIFSSKVFTAIFPIISAANSYPERVPLCIFQYMDCLKSKLPSGEFLSKIVPFIYGCFENSSLNVQTTS-----IQILGTLLDIIDVTTVKSSICPKLYHSFSVTNQLDVKVAILDTFNVFINQKFLDSFAIVDKLLPVLEKVKTREPTVVMGMVTVYI----SAGAIIPEETVHEQVIPRLWILSVSPSLSLEQYNKCMREIRSLSDAVQKSHAKKL 600          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q55BQ3|SCY2_DICDI (Probable inactive serine/threonine-protein kinase scy2 OS=Dictyostelium discoideum OX=44689 GN=scy2 PE=3 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 5.887e-26
Identity = 152/619 (24.56%), Postives = 273/619 (44.10%), Query Frame = 2
Query:  293 CGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDI---------KTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKG-----------KSHNY------SWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNN------GCSLIECSRN---VSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQ--QMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFV-LPSILTM-IYKASKADFDKHLYYNLQYILNT-EISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNKENQV-----LKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTV-NHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQLN 2011
             G +  WK  Q TK  +   CS+ ++EK+  EK+ KS   E V   L++E   L   RH  +LQ+ + + E   ++ F  EPI+ +L +L+       +STV+           K      LE+  G +Q+++ L  L+ T  ++H N+ P +I I+   +WK+ GLGF   +  K            + + Y        +     Y  P L+Y+APE   +      SD+FS+G +I  +  N         LI        +S Y   I++VR       S +     D+ +   +L   P  R D+E       F+D L  +L  L ++  K    +  FF    ++V  +S  ++   ILP+L+     S++   +V LP+I+++      K  F   +   +  IL + E   +    +L+ L   + +    +I   +LP+ L  +  P        +N+ ++ CL   Q I    +  +  +  + VI    N       + ++   ++    L+  ++ KIIVD ++P L  +    N+ + L  L      +S +  G   +L+AK +LP LIP + +  +  E+F  VM V+R +L+  E++R  +L+
Sbjct:   36 VGQDKFWKIYQSTKKTTNTECSLFVFEKKLYEKVSKSNL-ENVITFLKKEATTLQRLRHPSILQVVSVMEETKTHIHFATEPILATLEDLLGYYRQRKKSTVDQSSQSEEGYKKKDFTFEELELKAGIFQILDGLLFLNQTAKLLHRNISPESIFITKDLKWKLGGLGFTCSIETKEPPISNLSLQDLREYQYISGGGGGESSNNSNYILPQLDYLAPEFISQRKFETNSDLFSIGRLIFELSINLEQKALDSHLISQLPKLGVISYYNTMIEQVRRQ-----STMNTQRSDSAKVCTILLGDPMLRGDLENFIRSSFFQDVLTKTLLYLANISQKEDESKLQFFRGLLRIVQQFSPRIQNNYILPVLLS--EISNDRIIYVLLPNIMSISANHVKKETFQSKVLPAISNILQSKEPKPEVLSCVLENLPMLLQKCSLDQIKKILLPICLGSMCGP--------TNEIIFQCLSTAQPI---AKFFDTDMISVAVIPRLTNLCVGGFPVHIRTKAIQWFTLLVPSIEKKIIVDSLLPNLEKILAGDNSPVILQSLVETYEALSKKLGG---ELLAKSVLPALIPLSSDKHIDLEQFKTVMKVIRDILNTYEQERINELS 632          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|P53009|SCY1_YEAST (Protein kinase-like protein SCY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCY1 PE=1 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 8.382e-20
Identity = 103/393 (26.21%), Postives = 183/393 (46.56%), Query Frame = 2
Query:  425 EILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLI----DEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNY---SWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRS-----NFLKIYSKLPNSIGDTVQQMLSRIPTERPD-IEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFR-------FSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYV-LLDLLEFYIDRLDQQEILSKIL-PLFLRVLED 1537
            EILR +   L + +H  +L L   + E++   MFV E +  SL  +     DE +   +  V D        + +  G  Q+V AL  +H     +H N+ P  I I+ ++ WK++GLG+ +K+     +  Y    ++P+   +    LNY APEI  +N   F++D FSLGL+I  +Y  G  L     + S Y  + ++  S     ++  I+SK+P  +   + ++++R    R D I  + + + F+D L+ +L+ L  L  K+  E+  F      L+ ++   L  ++ LP+L++           S       L  I+ +    S+  F + +Y  L    N  +  + A + L+D L+    ++ + + L  IL PLF  VL D
Sbjct:   82 EILRNQANNLAKLKHPNILTLIEPLEEHSKNFMFVTEFVTSSLETVFRETDDEEQNFLQGHVKD-------NIVVQRGILQLVNALDFVHNRASFVHLNIQPRAIFINENSDWKISGLGYLVKIPPGTNTSEYFLPQYDPRVPPFMHLQLNYTAPEIVFENTLTFKNDYFSLGLLIYFLY-TGKDLFRSENSTSEYKLEYNKFESKISTMSWDNIFSKVPQKLRHCIPKLINRDIYSRYDNITLILDSEFFQDPLVKTLNFLDDLPTKNNEEKYVFLEGLVNLLPEFPPALLQKKFLPILLELLSQFCAEKVVSDKCVGKSLDLIIKIGSTLSQLSFQEKVYPVLLSDANFPVLLKKATICLIDNLDTLKQKVKRSDFLENILKPLFNYVLHD 466          
BLAST of Protein kinase vs. TrEMBL
Match: A0A4S2LX64 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004249 PE=4 SV=1)

HSP 1 Score: 417.157 bits (1071), Expect = 2.181e-128
Identity = 299/848 (35.26%), Postives = 481/848 (56.72%), Query Frame = 2
Query:  272 IGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHN--YSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNKENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQLNIEXXXXXXXXXXXXXXXXXCNRVLPLISMQQPTMEIDYGSQNSFNSRMTGSRRGSNVTDYRRGSTDNTPGSR---RNSALLNRLKL--NNSESLLFPTRNRRG-SAFDNRNWSKTNSNP-AFISQLSGENSRENIQL------SSNSMQYRRLSGNTSS---YLNK---GLAVP--NNQF--PRRHSYESSHNASINSLITASVCEGPFISPXXXXXXXXXXXXXXLGP----QIIPGNNSRRMSSTGSRRLSFNAFSDTLINLFQ 2728
            IG ++   G + VW+  +   I + + CS+ + +K++ EK  KS+R++ + E+LR E       +    L++   +HENNDYL F+ EPI   L +  +E+ V                L+I+ G YQ+ +ALR LH T  ++H N+ P  ++++   +WK+ GL F  K+ +  K+      ++ K  K  QP+L++IAPE Q+ N     +D+FSLG+++C+IYN G SLIE   N ++Y K+I E+   F KI   LP ++ + V++M+S    +RP  +    +  F +  +LS + L SL+ +S+N++K+FFN F+K+V +Y   LRYQRILPLL++W+  S++L+ FVLPS+LTMI+ A   DF+ +L   L  I+    + QT+ V +DL+EF+I RL + EI   ILP      E   N  ++T     + N + I+ + L   Q++  I+ KL+ +F++     K+Q+  LEC+++LL  L++  +  E+  FL+TV  +++S+   IL I +H++S +  GI+   IA K+LPPL+    +P L   +F L+M VLR +LD ++R R C+L +   +S  GS S+I +     R LPLISMQ+PT++ D+   +  ++R +     ++++D+R  + D T  +R   R++  L RL+   N SES+L+  + R   +  D  NWS+  SNP A I   S  + R N         +     +RR SGN  S   Y  +    L VP  N +F  PRRHSY  S  AS+NSL+T +VCEGPF++P NSR  + R +A SL      Q +  N++  +     RR SF+  +D L N F+
Sbjct:   27 IGRVVGRAGPDLVWRIHEAKCITTNEACSVFVLDKKS-EKFSKSRRRDLILELLRNEFHNCEMLKSTRFLEVRLGMHENNDYLTFIAEPIYGCLTDAFEEKRVT-----------DFTELDIIFGVYQLTDALRFLHSTQEMMHCNVNPGAVMLAGEGKWKLGGLNFMEKVIDTTKASPRFTGYSAKFPKAAQPNLDFIAPEAQMHNSMSPLADMFSLGMVLCAIYNEGHSLIESDFNPTVYAKRISELPQRFEKISKHLPKALVEPVRKMISEDVRDRPTSQLFALLKIFNEPTVLSYEGLLSLESRSVNQKKEFFNRFAKVVPEYDLVLRYQRILPLLLNWYEKSADLSPFVLPSLLTMIHVAENDDFEAYLREPLMKIMTQRKTLQTSVVFVDLIEFFISRLTKTEIEQYILPELFVCFEPVTNKTTET-----VQNAISIMPSYLGEDQIQRHIIPKLREMFSQTASGSKLQLCVLECIERLLPSLNSPCVAQEISAFLSTVRTTDSSMLGCILAINRHLLSEQKFGITCPTIAGKLLPPLLDALASPLLGLNDFRLLMDVLRFMLDTVDRQRTCELILRERKSQGGSCSNISTPTGLGRNLPLISMQKPTVDADFVGSDIDDARFS----RTSLSDHRHSTGDETSNTRNWLRSNLQLQRLRASGNRSESVLYGLKQRNSLTGPDRYNWSEVASNPTAEIRTPSYASYRANGSYFCIPSPAGGPTAFRRHSGNLPSRSLYSQEPFGSLNVPHTNGRFLDPRRHSYGCSTTASVNSLLTVNVCEGPFVTPFNSRLATHRGTATSLNQSLNRQCLKDNDTDPV-----RRSSFDVINDILANTFK 848          
BLAST of Protein kinase vs. TrEMBL
Match: A0A4S2LX66 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004249 PE=4 SV=1)

HSP 1 Score: 415.231 bits (1066), Expect = 5.316e-128
Identity = 282/794 (35.52%), Postives = 455/794 (57.30%), Query Frame = 2
Query:  272 IGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHN--YSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNKENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQLNIEXXXXXXXXXXXXXXXXXCNRVLPLISMQQPTMEIDYGSQNSFNSRMTGSRRGSNVTDYRRGSTDNTPGSR---RNSALLNRLKL--NNSESLLFPTRNRRG-SAFDNRNWSKTNSNP-AFISQLSGENSRENIQL------SSNSMQYRRLSGNTSS---YLNK---GLAVP--NNQF--PRRHSYESSHNASINSLITASVCEGPFISP 2578
            IG ++   G + VW+  +   I + + CS+ + +K++ EK  KS+R++ + E+LR E       +    L++   +HENNDYL F+ EPI   L +  +E+ V                L+I+ G YQ+ +ALR LH T  ++H N+ P  ++++   +WK+ GL F  K+ +  K+      ++ K  K  QP+L++IAPE Q+ N     +D+FSLG+++C+IYN G SLIE   N ++Y K+I E+   F KI   LP ++ + V++M+S    +RP  +    +  F +  +LS + L SL+ +S+N++K+FFN F+K+V +Y   LRYQRILPLL++W+  S++L+ FVLPS+LTMI+ A   DF+ +L   L  I+    + QT+ V +DL+EF+I RL + EI   ILP      E   N  ++T     + N + I+ + L   Q++  I+ KL+ +F++     K+Q+  LEC+++LL  L++  +  E+  FL+TV  +++S+   IL I +H++S +  GI+   IA K+LPPL+    +P L   +F L+M VLR +LD ++R R C+L +   +S  GS S+I +     R LPLISMQ+PT++ D+   +  ++R +     ++++D+R  + D T  +R   R++  L RL+   N SES+L+  + R   +  D  NWS+  SNP A I   S  + R N         +     +RR SGN  S   Y  +    L VP  N +F  PRRHSY  S  AS+NSL+T +VCEGPF++P
Sbjct:   27 IGRVVGRAGPDLVWRIHEAKCITTNEACSVFVLDKKS-EKFSKSRRRDLILELLRNEFHNCEMLKSTRFLEVRLGMHENNDYLTFIAEPIYGCLTDAFEEKRVT-----------DFTELDIIFGVYQLTDALRFLHSTQEMMHCNVNPGAVMLAGEGKWKLGGLNFMEKVIDTTKASPRFTGYSAKFPKAAQPNLDFIAPEAQMHNSMSPLADMFSLGMVLCAIYNEGHSLIESDFNPTVYAKRISELPQRFEKISKHLPKALVEPVRKMISEDVRDRPTSQLFALLKIFNEPTVLSYEGLLSLESRSVNQKKEFFNRFAKVVPEYDLVLRYQRILPLLLNWYEKSADLSPFVLPSLLTMIHVAENDDFEAYLREPLMKIMTQRKTLQTSVVFVDLIEFFISRLTKTEIEQYILPELFVCFEPVTNKTTET-----VQNAISIMPSYLGEDQIQRHIIPKLREMFSQTASGSKLQLCVLECIERLLPSLNSPCVAQEISAFLSTVRTTDSSMLGCILAINRHLLSEQKFGITCPTIAGKLLPPLLDALASPLLGLNDFRLLMDVLRFMLDTVDRQRTCELILRERKSQGGSCSNISTPTGLGRNLPLISMQKPTVDADFVGSDIDDARFS----RTSLSDHRHSTGDETSNTRNWLRSNLQLQRLRASGNRSESVLYGLKQRNSLTGPDRYNWSEVASNPTAEIRTPSYASYRANGSYFCIPSPAGGPTAFRRHSGNLPSRSLYSQEPFGSLNVPHTNGRFLDPRRHSYGCSTTASVNSLLTVNVCEGPFVTP 799          
BLAST of Protein kinase vs. TrEMBL
Match: A0A4S2LX67 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004249 PE=4 SV=1)

HSP 1 Score: 414.846 bits (1065), Expect = 9.666e-128
Identity = 282/794 (35.52%), Postives = 455/794 (57.30%), Query Frame = 2
Query:  272 IGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHN--YSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNKENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQLNIEXXXXXXXXXXXXXXXXXCNRVLPLISMQQPTMEIDYGSQNSFNSRMTGSRRGSNVTDYRRGSTDNTPGSR---RNSALLNRLKL--NNSESLLFPTRNRRG-SAFDNRNWSKTNSNP-AFISQLSGENSRENIQL------SSNSMQYRRLSGNTSS---YLNK---GLAVP--NNQF--PRRHSYESSHNASINSLITASVCEGPFISP 2578
            IG ++   G + VW+  +   I + + CS+ + +K++ EK  KS+R++ + E+LR E       +    L++   +HENNDYL F+ EPI   L +  +E+ V                L+I+ G YQ+ +ALR LH T  ++H N+ P  ++++   +WK+ GL F  K+ +  K+      ++ K  K  QP+L++IAPE Q+ N     +D+FSLG+++C+IYN G SLIE   N ++Y K+I E+   F KI   LP ++ + V++M+S    +RP  +    +  F +  +LS + L SL+ +S+N++K+FFN F+K+V +Y   LRYQRILPLL++W+  S++L+ FVLPS+LTMI+ A   DF+ +L   L  I+    + QT+ V +DL+EF+I RL + EI   ILP      E   N  ++T     + N + I+ + L   Q++  I+ KL+ +F++     K+Q+  LEC+++LL  L++  +  E+  FL+TV  +++S+   IL I +H++S +  GI+   IA K+LPPL+    +P L   +F L+M VLR +LD ++R R C+L +   +S  GS S+I +     R LPLISMQ+PT++ D+   +  ++R +     ++++D+R  + D T  +R   R++  L RL+   N SES+L+  + R   +  D  NWS+  SNP A I   S  + R N         +     +RR SGN  S   Y  +    L VP  N +F  PRRHSY  S  AS+NSL+T +VCEGPF++P
Sbjct:   27 IGRVVGRAGPDLVWRIHEAKCITTNEACSVFVLDKKS-EKFSKSRRRDLILELLRNEFHNCEMLKSTRFLEVRLGMHENNDYLTFIAEPIYGCLTDAFEEKRVT-----------DFTELDIIFGVYQLTDALRFLHSTQEMMHCNVNPGAVMLAGEGKWKLGGLNFMEKVIDTTKASPRFTGYSAKFPKAAQPNLDFIAPEAQMHNSMSPLADMFSLGMVLCAIYNEGHSLIESDFNPTVYAKRISELPQRFEKISKHLPKALVEPVRKMISEDVRDRPTSQLFALLKIFNEPTVLSYEGLLSLESRSVNQKKEFFNRFAKVVPEYDLVLRYQRILPLLLNWYEKSADLSPFVLPSLLTMIHVAENDDFEAYLREPLMKIMTQRKTLQTSVVFVDLIEFFISRLTKTEIEQYILPELFVCFEPVTNKTTET-----VQNAISIMPSYLGEDQIQRHIIPKLREMFSQTASGSKLQLCVLECIERLLPSLNSPCVAQEISAFLSTVRTTDSSMLGCILAINRHLLSEQKFGITCPTIAGKLLPPLLDALASPLLGLNDFRLLMDVLRFMLDTVDRQRTCELILRERKSQGGSCSNISTPTGLGRNLPLISMQKPTVDADFVGSDIDDARFS----RTSLSDHRHSTGDETSNTRNWLRSNLQLQRLRASGNRSESVLYGLKQRNSLTGPDRYNWSEVASNPTAEIRTPSYASYRANGSYFCIPSPAGGPTAFRRHSGNLPSRSLYSQEPFGSLNVPHTNGRFLDPRRHSYGCSTTASVNSLLTVNVCEGPFVTP 799          
BLAST of Protein kinase vs. TrEMBL
Match: A0A5K4EU33 (Protein kinase OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 379.022 bits (972), Expect = 7.260e-114
Identity = 282/852 (33.10%), Postives = 478/852 (56.10%), Query Frame = 2
Query:  254 IKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGK-SHNYSWNPKQVK-YGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNKENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQLNIEXXXXXXXXX-XXXXXXXXCNRVLPLISMQQPTMEIDYGSQNSFNSRMTGSRRGSNVTDYRRGSTDNTPGS---RRNSALLNRLKL--NNSESLLFPTRNRRGSAFDNRNWSKTNSNPAF-ISQLSGENSRENIQLSSNS-------MQYRRLSGN---------TSSYLNKG-LAVP--NNQF--PRRHSYESSHNASINSLITASVCEGPFISPXXXXXXXXXXXXXXLGPQIIPGNNSRRMSSTGSRRLSFNAFSDTLIN 2719
            I Q+  IG+ +   G   +W   +  + ++G   ++  ++K+T++++ K++R++ + E LR ++  L++ +H   +QL   + E N+YL F+ EPII SLA++           +ND +      LEI+ G YQ+ +ALR+LH T  ++H N+  ++IL+   + WK+ GL F  K+ +  K +  ++    +V  + QPDL++IAPE Q+ N     +D+FSLG+++C+I+N G SLI+  +N ++Y K++ E+ +NF +I  +LP ++ + V++M+S+   ERP  +    +  F + ++LS + L +L  KS+N++K+FF    K++  +  ++RY+ ILP+++ W   S++L +++LPS LTMI  A   D+D++L  +L  IL    S QT+ V+LDL +F+I  + Q +I + +LP     LE PG  +S     +++ N + +L   L   Q+ + IL +LK I+N++    K++I CLECL +L + L    + D+V+PF++++   +  + LA++ + + ++S RN  I +  IA  +LP ++       L   +F  V+++ R +LD I+R R  +L  ++   + G   S + S+    R LPLI+MQ+PT++ +    +  +S+++ S       DYRR S     G+    RNS L+ RL+   + SESLLF T++ R S  D+R W+++ SNP F     S  NSR       NS        + RR SGN          + Y N G L VP  NN F  PRRHSY  + + S  SLIT +VCEGPF++P + R   RR S  S G Q       +       RR S NA  D L++
Sbjct:   22 ILQNVEIGKHVGRYGPGFLWSLFEGMESNTGLKSTVFTFDKKTLDRVNKNRRRDLILETLRNDLINLNKLKHPRFVQLIHDIEETNEYLTFITEPIIGSLADMY----------IND-QDSSFCELEIIFGIYQITDALRYLHSTQELMHCNINTASILLVNKSIWKLGGLNFLEKIVDTTKITPKFTGCSVKVPVFAQPDLDFIAPEAQMYNSMSPLADMFSLGMVVCAIHNQGHSLIDSEQNPNVYVKQLPEIPNNFERICERLPRTLLEPVRKMISKDVRERPTSQLFALLKVFNEPVVLSYEGLLTLSDKSLNQKKEFFGRLPKVIPLFEPNVRYKYILPIILQWLYESNDLISYILPSFLTMIKVAESDDYDRYLKSHLHKILTETKSLQTSMVILDLSDFFIHHISQDDIGNLLLPEIFVCLE-PGTPKSL----ETVQNAISVLSKYLNNTQIVQSILPQLKEIYNRKTSNPKIRIACLECLGKLFKKLTLPTLCDDVLPFVSSIRTVDRELVLAVIALNRRLISDRNNEIPYTYIAGMLLPSMVNFLALKTLTISDFRAVINLTRTMLDLIDRQRSVELRSQTGSKSVGGSCSDMSSSFGAPRNLPLIAMQRPTIDSELLYVDMEDSKLSRSS-----LDYRRSSGSEVTGTSRWSRNSLLIQRLQASKHRSESLLFNTKH-RNSIGDHRFWNESASNPNFNYHGHSSTNSRIGPSPFYNSSPTCEDLYKMRRYSGNILTRSTDNQVNVYDNLGSLNVPRYNNGFLDPRRHSYGFTPSTSTKSLITVNVCEGPFVTPLSYRGSIRRNSGWSCG-QFPTSQVMKPTDEDIQRRCSLNAIGDLLVS 850          
BLAST of Protein kinase vs. TrEMBL
Match: A0A5K4ET09 (Protein kinase OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 377.867 bits (969), Expect = 1.429e-113
Identity = 268/805 (33.29%), Postives = 460/805 (57.14%), Query Frame = 2
Query:  254 IKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGK-SHNYSWNPKQVK-YGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNKENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQLNIEXXXXXXXXX-XXXXXXXXCNRVLPLISMQQPTMEIDYGSQNSFNSRMTGSRRGSNVTDYRRGSTDNTPGS---RRNSALLNRLKL--NNSESLLFPTRNRRGSAFDNRNWSKTNSNPAF-ISQLSGENSRENIQLSSNS-------MQYRRLSGN---------TSSYLNKG-LAVP--NNQF--PRRHSYESSHNASINSLITASVCEGPFISP 2578
            I Q+  IG+ +   G   +W   +  + ++G   ++  ++K+T++++ K++R++ + E LR ++  L++ +H   +QL   + E N+YL F+ EPII SLA++           +ND +      LEI+ G YQ+ +ALR+LH T  ++H N+  ++IL+   + WK+ GL F  K+ +  K +  ++    +V  + QPDL++IAPE Q+ N     +D+FSLG+++C+I+N G SLI+  +N ++Y K++ E+ +NF +I  +LP ++ + V++M+S+   ERP  +    +  F + ++LS + L +L  KS+N++K+FF    K++  +  ++RY+ ILP+++ W   S++L +++LPS LTMI  A   D+D++L  +L  IL    S QT+ V+LDL +F+I  + Q +I + +LP     LE PG  +S     +++ N + +L   L   Q+ + IL +LK I+N++    K++I CLECL +L + L    + D+V+PF++++   +  + LA++ + + ++S RN  I +  IA  +LP ++       L   +F  V+++ R +LD I+R R  +L  ++   + G   S + S+    R LPLI+MQ+PT++ +    +  +S+++ S       DYRR S     G+    RNS L+ RL+   + SESLLF T++ R S  D+R W+++ SNP F     S  NSR       NS        + RR SGN          + Y N G L VP  NN F  PRRHSY  + + S  SLIT +VCEGPF++P
Sbjct:   22 ILQNVEIGKHVGRYGPGFLWSLFEGMESNTGLKSTVFTFDKKTLDRVNKNRRRDLILETLRNDLINLNKLKHPRFVQLIHDIEETNEYLTFITEPIIGSLADMY----------IND-QDSSFCELEIIFGIYQITDALRYLHSTQELMHCNINTASILLVNKSIWKLGGLNFLEKIVDTTKITPKFTGCSVKVPVFAQPDLDFIAPEAQMYNSMSPLADMFSLGMVVCAIHNQGHSLIDSEQNPNVYVKQLPEIPNNFERICERLPRTLLEPVRKMISKDVRERPTSQLFALLKVFNEPVVLSYEGLLTLSDKSLNQKKEFFGRLPKVIPLFEPNVRYKYILPIILQWLYESNDLISYILPSFLTMIKVAESDDYDRYLKSHLHKILTETKSLQTSMVILDLSDFFIHHISQDDIGNLLLPEIFVCLE-PGTPKSL----ETVQNAISVLSKYLNNTQIVQSILPQLKEIYNRKTSNPKIRIACLECLGKLFKKLTLPTLCDDVLPFVSSIRTVDRELVLAVIALNRRLISDRNNEIPYTYIAGMLLPSMVNFLALKTLTISDFRAVINLTRTMLDLIDRQRSVELRSQTGSKSVGGSCSDMSSSFGAPRNLPLIAMQRPTIDSELLYVDMEDSKLSRSS-----LDYRRSSGSEVTGTSRWSRNSLLIQRLQASKHRSESLLFNTKH-RNSIGDHRFWNESASNPNFNYHGHSSTNSRIGPSPFYNSSPTCEDLYKMRRYSGNILTRSTDNQVNVYDNLGSLNVPRYNNGFLDPRRHSYGFTPSTSTKSLITVNVCEGPFVTP 804          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: si:ch211-244b2.1 (SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:103035475])

HSP 1 Score: 210.305 bits (534), Expect = 5.020e-56
Identity = 146/591 (24.70%), Postives = 294/591 (49.75%), Query Frame = 2
Query:  254 IKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHN----YSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRN--VSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNKENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQL 2008
            + + F +G  I+  G    W+    TK  + Q  ++ +++K+ +++ Y+   K+ + + L++ ++ L   RH  LL +   + E+ D L F  EP+  SLAN++ + + LP     DIK  KL  +E   G  Q+ E L  LH    ++HGNLCP NI+++    WK+ G  F I  +    +        W+P       P+  Y+APE  L       SD++SLG+++ +++N G  +   ++      +++++D++      + SK+P+ + + V+ +LS     RPD +++ ++  F D   ++L    SL  +   ++  F+    K++    + +   RILP L   F  + ++  FVLP++L +  + +K ++ + +  +L  +   +   Q   + L  ++  + +   ++I + +LP+  R LE P          +   N +    N++    +K  ++ ++K     +   L V++  L CL ++LE LD   ++DE++PFL  +     ++ + ILGIYK   + +  GI  + +A K +P L+  ++   L   +F   M V+R++L+++E +   +L
Sbjct:   28 VTREFEVGRHIASGGPGMCWRIYNGTKKSTKQEVAVFVFDKKIVDR-YQKFEKDQIIDSLKKGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGQWDNLPSPVPTDIKDYKLYDVETKYGLLQISEGLSFLHSGVKMVHGNLCPENIILNKSGAWKIMGFDFSISSSNPSDAEPKYVCKEWDPNSPPLCLPNPEYVAPEYILSVSCDSASDMYSLGVVVHAVFNEGKPVFRVNKQDIFKSFSRQLDQLSRLSPGVLSKIPDEVREHVKMLLSVTANVRPDADQMTKIPFFDDVGAVTLQYFDSLFQRDNLQKSQFYKGLPKVLPKLPKRVVVYRILPALTSEF-VNPDMVPFVLPNVLLIAEECTKEEYVRLILPDLTPVFKQQEPIQILLIFLQKMDLLLTKTPPEDIKNSVLPMVYRALEAP-----SIQIQELCLNIIPSFANLIDYPSMKNALIPRIKSAC-LQTSSLAVRVNSLVCLGKILEYLDKWFVIDEILPFLQQIPSREPAVLMGILGIYKCTFAHKKLGIPKEHLAGKSVPHLVSISIENNLNLNQFNSFMAVIREMLNRMEAEHKTKL 610          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: si:ch211-244b2.1 (SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:103035475])

HSP 1 Score: 208.379 bits (529), Expect = 1.827e-55
Identity = 147/595 (24.71%), Postives = 295/595 (49.58%), Query Frame = 2
Query:  254 IKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHN----YSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRN--VSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNT----EISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNKENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQL 2008
            + + F +G  I+  G    W+    TK  + Q  ++ +++K+ +++ Y+   K+ + + L++ ++ L   RH  LL +   + E+ D L F  EP+  SLAN++ + + LP     DIK  KL  +E   G  Q+ E L  LH    ++HGNLCP NI+++    WK+ G  F I  +    +        W+P       P+  Y+APE  L       SD++SLG+++ +++N G  +   ++      +++++D++      + SK+P+ + + V+ +LS     RPD +++ ++  F D   ++L    SL  +   ++  F+    K++    + +   RILP L   F  + ++  FVLP++L +  + +K ++ + +  +L  +       + SN    + L  ++  + +   ++I + +LP+  R LE P          +   N +    N++    +K  ++ ++K     +   L V++  L CL ++LE LD   ++DE++PFL  +     ++ + ILGIYK   + +  GI  + +A K +P L+  ++   L   +F   M V+R++L+++E +   +L
Sbjct:   28 VTREFEVGRHIASGGPGMCWRIYNGTKKSTKQEVAVFVFDKKIVDR-YQKFEKDQIIDSLKKGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGQWDNLPSPVPTDIKDYKLYDVETKYGLLQISEGLSFLHSGVKMVHGNLCPENIILNKSGAWKIMGFDFSISSSNPSDAEPKYVCKEWDPNSPPLCLPNPEYVAPEYILSVSCDSASDMYSLGVVVHAVFNEGKPVFRVNKQDIFKSFSRQLDQLSRLSPGVLSKIPDEVREHVKMLLSVTANVRPDADQMTKIPFFDDVGAVTLQYFDSLFQRDNLQKSQFYKGLPKVLPKLPKRVVVYRILPALTSEF-VNPDMVPFVLPNVLLIAEECTKEEYVRLILPDLTPVFKQQEPIQASNMILLIFLQKMDLLLTKTPPEDIKNSVLPMVYRALEAP-----SIQIQELCLNIIPSFANLIDYPSMKNALIPRIKSAC-LQTSSLAVRVNSLVCLGKILEYLDKWFVIDEILPFLQQIPSREPAVLMGILGIYKCTFAHKKLGIPKEHLAGKSVPHLVSISIENNLNLNQFNSFMAVIREMLNRMEAEHKTKL 614          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: si:ch211-244b2.1 (SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:103035475])

HSP 1 Score: 194.126 bits (492), Expect = 8.466e-51
Identity = 142/591 (24.03%), Postives = 290/591 (49.07%), Query Frame = 2
Query:  254 IKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHN----YSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRN--VSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNKENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQL 2008
            + + F +G  I+  G    W+    TK  + Q  ++ +++K+ +++ Y+   K+ + + L++ ++ L   RH  LL +   + E+ D L F  EP+  SLAN++ + + LP     DIK  KL  +E   G  Q+ E L  LH    ++HGNLCP NI+++    WK+ G  F I  +    +        W+P       P+  Y+APE  L       SD++SLG+++ +++N G  +   ++      +++++D++      + SK+P+ + + V+ +LS     RPD +++ ++  F D   ++L    SL  +   ++  F+    K++    + +   RILP L   F  + ++  FVLP++L +  + +K ++ + +  +L  +   +   Q   + L  ++  + +   ++I + +LP+  R LE P          +   N +    N++    +K  ++ ++K     +   L V++  L CL ++LE LD   ++DE++PFL  +     ++ + IL       ++   GI  + +A K +P L+  ++   L   +F   M V+R++L+++E +   +L
Sbjct:   28 VTREFEVGRHIASGGPGMCWRIYNGTKKSTKQEVAVFVFDKKIVDR-YQKFEKDQIIDSLKKGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGQWDNLPSPVPTDIKDYKLYDVETKYGLLQISEGLSFLHSGVKMVHGNLCPENIILNKSGAWKIMGFDFSISSSNPSDAEPKYVCKEWDPNSPPLCLPNPEYVAPEYILSVSCDSASDMYSLGVVVHAVFNEGKPVFRVNKQDIFKSFSRQLDQLSRLSPGVLSKIPDEVREHVKMLLSVTANVRPDADQMTKIPFFDDVGAVTLQYFDSLFQRDNLQKSQFYKGLPKVLPKLPKRVVVYRILPALTSEF-VNPDMVPFVLPNVLLIAEECTKEEYVRLILPDLTPVFKQQEPIQILLIFLQKMDLLLTKTPPEDIKNSVLPMVYRALEAPS-----IQIQELCLNIIPSFANLIDYPSMKNALIPRIKSAC-LQTSSLAVRVNSLVCLGKILEYLDKWFVIDEILPFLQQIPSREPAVLMGIL-------ASLFTGIPKEHLAGKSVPHLVSISIENNLNLNQFNSFMAVIREMLNRMEAEHKTKL 603          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: plk2b (serine/threonine-protein kinase PLK2 [Source:NCBI gene;Acc:103027010])

HSP 1 Score: 65.0846 bits (157), Expect = 2.238e-10
Identity = 76/282 (26.95%), Postives = 124/282 (43.97%), Query Frame = 2
Query:  320 CQCTKIDSGQNCSIQIYE--KRTMEKIYKSK-------RKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNN--GCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQ----MLSRIPTERPDIEEL 1120
            C C     G+    + YE    +  K+Y +K        K +  E + REIE      H +++  + S  + ++  + +      SLA+++  R+VL E              E+     Q V AL++LH    I+H +L   N+ +S   + KV   G   KL           N ++   G P  NY++PE+  K    ++SDI++LG   C +Y    G    E +     Y + I E R      YS LP++I  + +Q    MLSR PT+RP ++E+
Sbjct:   54 CYCRGKVLGKGGFAKCYELTDLSAGKVYAAKIIPHSRVAKPHQREKINREIELHRALSHKHIVHFYHSFEDKDNIYILLEYCSRRSLAHILKARKVLTEP-------------EVRYYLRQTVSALKYLH-DQEILHRDLKLGNLFVSDSMELKVGDFGLAAKLEPVS-------NRRKTICGTP--NYLSPEVLNKQGHGWESDIWALG---CVMYTMLLGKPPFETTNLRETY-RCIREAR------YS-LPSTISLSARQLIASMLSRNPTDRPRLDEI 301          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: ENSAMXT00000054016.1 (pep primary_assembly:Astyanax_mexicanus-2.0:3:23125160:23127852:-1 gene:ENSAMXG00000032327.1 transcript:ENSAMXT00000054016.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 4.891e-9
Identity = 69/293 (23.55%), Postives = 121/293 (41.30%), Query Frame = 2
Query:  278 EIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMF-VCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDL--------NYIAPEIQL-KNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELRE 1126
            +++SF G  +  K    +      N +I++ ++        SK    V + L RE+E +    H Y++Q++  VHE    L+F V E  +  L  +I E    P      +             F Q+V A+ +LH  + I+H +L   NIL++     KVT  GF                  ++  G P+L        NY APE+   K+    +SD++SLG+I+ ++          +  +    + I  ++   L+    +  S  D +  ML   P  RP + E+ +
Sbjct:   13 KVVSFLGEGSYGKVYLASSKRYLNNVAIKVMDR--------SKMAPSVEKFLTRELEIIKYLDHPYIVQVY-EVHETPQGLIFIVMEAAMMDLKQMIVELNYFPVDLAKAV-------------FSQLVSAVVYLHEQD-IVHRDLKSENILLTPDGTIKVTDFGF-----------------SRMSRGFPELCNSLCGTPNYCAPEVLCGKSYDGKKSDVWSLGVILYTM---------VTGELPFNYENILYLQKKPLQYSIPVEKSCRDFISYMLQYDPFTRPSVTEVAQ 256          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003368.1 (pep scaffold:Pmarinus_7.0:GL479057:9948:36045:-1 gene:ENSPMAG00000003073.1 transcript:ENSPMAT00000003368.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 223.016 bits (567), Expect = 6.026e-61
Identity = 156/616 (25.32%), Postives = 312/616 (50.65%), Query Frame = 2
Query:  188 KAMISRITSIKRHSAAPEIPISIKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNY----SWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSI---YTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNK--ENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQL 2008
            K+ ++++T+    + +  +   + + F I   ++  G    WK     K  + Q  ++ ++EK+ ++++ +++R E+  E+L+R ++ L   RH  LL +   + E+ D L F  EP+  SL+N++ + E LP     +I+  +L  +E   G  Q+ E L  LH    ++HGNL P NI+++ +  WK+ G  FCI  +   +         W P      QP + ++APE  L       SD++SLG+++ +++N G  + +      +   +++ +D++ +    +  K+P  + D ++ +L+  PT RPD ++L ++  F D   ++L  L SL  +   ++  FF   SK+++   + +  QR+LP L   F  + ++  FVLP++L +    +K ++ + +  +L  +   +   Q   + L  ++  + +   ++I   +LP+  R LE P      T   +     +    N++    +K  ++ ++K   N   +   L V++  L CL +LLE +D   ++DE++PFL  +     ++ + ILGIYK   S +  GI+ +++A K LP LIP  ++  L   +F   M ++R++L K+E +   +L
Sbjct:    9 KSTVTKVTADVTSAVSVVLGNPVTREFEITRHVASGGPALSWKIYHGFKKSTKQEVAVFVFEKKQVDRLGRTER-EHAVEVLKRGVQQLTRLRHPRLLTVQHPIEESRDCLAFCTEPVFASLSNVLGQHENLPCPVPLEIRDHQLHDVETKYGLLQLAEGLSFLHNGVKMVHGNLTPENIVLNKNGAWKIMGFDFCISSSNPSEREVAFTCKEWVPDLPPMCQPRIEFLAPEYILSVSCDVASDMYSLGMLMYAVFNKGQPIFQMDGTHDMFKSFSRHLDKLSNLGPSVMQKVPEDVRDHLKMLLNVTPTVRPDADQLAKIPYFDDVGAMTLQYLDSLFQRDNLQKSQFFKGLSKVLSKLPKRVVQQRVLPSLTTEF-VNPDMVPFVLPNVLLIAEDCTKEEYVRMVLPDLIPVFKLQEPIQVLLIFLQKMDLLLTKTPAEDIKQHVLPMIFRALEAPS-----TQIQELCLGIIPTFANLIEYPSMKNALIPRIK---NSCLQTTSLAVRVNALVCLGKLLEHMDKWYVLDEILPFLQQIPSKEPAVLMGILGIYKCTFSHKKLGITKEILAGKALPHLIPLCIDNNLNLNQFNSYMGMIREMLSKVESEHRTKL 614          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000175.1 (pep scaffold:Pmarinus_7.0:GL476590:10927:25170:1 gene:ENSPMAG00000000155.1 transcript:ENSPMAT00000000175.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 2.154e-7
Identity = 57/236 (24.15%), Postives = 104/236 (44.07%), Query Frame = 2
Query:  224 HSAAPEIPISIKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPK-QVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLI 928
             S A     SIKQ  ++G            +  +C +  SG   + ++ + + +      K K+ V+     EI  +++ +HN LLQL+ +    ND+++ +           I   E+       D     L  L+ ++   Q+ E + ++H    I+H +L P NIL        V   G  IK+ + G +  Y    K +V +G P+  ++APE+   +   F +D++SLG+I
Sbjct:   23 QSEAVSTSYSIKQKDVLG-------GGRFGRVHKCVERTSGMTLAAKVIKAKGV------KEKDEVNN----EISIMNQLKHNNLLQLYDAYESKNDFVLIM---------EYIHGGELFDRIVSEDY---NLTELDAIIFIRQICEGIHYMH-QQYILHLDLKPENILC-------VNRKGNQIKIIDFGLARRYKPREKLKVHFGTPE--FLAPEVVNYDYVSFPTDMWSLGVI 219          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: stk11 (serine/threonine kinase 11 [Source:ZFIN;Acc:ZDB-GENE-050417-383])

HSP 1 Score: 46.9802 bits (110), Expect = 2.063e-6
Identity = 28/113 (24.78%), Postives = 54/113 (47.79%), Query Frame = 2
Query:  437 REIECLHEFRHNYLLQLFTSVH--ENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLG 769
            REI+ L   +H  ++ L   ++  E    +  V E  +C +  ++D            +  +K    +    F Q+V+ L +LH + GI+H ++ P N+L++T    K++ LG
Sbjct:    1 REIQLLKRLKHKNVISLVDVLYNEEKQKLVYMVMEYCVCGMQEMLDS-----------VTGKKFPIFQAHGYFSQLVDGLEYLH-SQGIVHKDIKPGNLLLTTEGTLKISDLG 101          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: plk3 (polo-like kinase 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-030131-6134])

HSP 1 Score: 49.6766 bits (117), Expect = 2.553e-6
Identity = 59/250 (23.60%), Postives = 106/250 (42.40%), Query Frame = 2
Query:  380 TMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIIC---SLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYN--NGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIE 1114
            T +++ K   +  + +    EI    +  H +++Q  +S  + N ++  + E  +C   SLA+++  R+VL E+             E+     Q++  LR+LH   G++H +L   N  ++   + K+  LG    L             K+   G P  NY+APE+  K     ++DI+SLG   C+++    G      S   + Y   I   R NF       P S+    + +L+   T  PD+ 
Sbjct:   59 TKQRVEKPGHRAKIEQ----EISLHRKLHHRHIVQFISSFKDEN-FIYIILE--LCNGQSLAHMLRSRKVLTET-------------EVKYYLRQLISGLRYLHQC-GVVHRDLKLGNFFVTDSMEVKIGDLGLATTLEPPEMR-------KRTVCGTP--NYLAPEVLNKRGHGPEADIWSLG---CAVFTMLAGRPPFSTSDLANTYA-CIRSGRFNF-------PPSLSHAARDLLTSALTPDPDLR 267          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: STK36 (serine/threonine kinase 36 [Source:HGNC Symbol;Acc:HGNC:17209])

HSP 1 Score: 48.9062 bits (115), Expect = 6.321e-6
Identity = 58/269 (21.56%), Postives = 114/269 (42.38%), Query Frame = 2
Query:  359 IQIYEKRTMEKIYKSKRKEYVSEI------------------LRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDI 1111
            +++  + +  K+YK  RK Y  ++                  LRREI+ +   +H  ++Q+  S  E +  ++ V +     L  ++++   LPE  V +I               Q+V AL +LH ++ I+H ++ P NIL+         G G  +KL + G +   S N   +   +    Y++PE+  +      +D++S+G I+  ++               YT  I ++ S  +K   K P ++    +  L  + T+ P +
Sbjct:    7 LEMIGEGSFGKVYKG-RKRYTGQVVALKFIPKVGRSDKELRNLRREIDIMRGLQHPNIVQMLDSF-ETDKEVVVVTDYAEGELFQILEDDGNLPEEQVREIAC-------------QLVSALYYLH-SHRILHRDMKPQNILL---------GKGGVVKLCDFGFARAMSINTLVLTSIKGTPLYMSPELVEEKPYDHTADLWSMGCILYELFVG---------TPPFYTNSIFQLVSLIIKDPVKWPKNMSSEFRNFLQGLLTKEPKL 241          
BLAST of Protein kinase vs. Ensembl Yeast
Match: SCY1 (Putative kinase; suppressor of GTPase mutant; similar to bovine rhodopsin kinase; may have a role in intracellular sterol transport [Source:SGD;Acc:S000003051])

HSP 1 Score: 98.9821 bits (245), Expect = 1.207e-21
Identity = 103/393 (26.21%), Postives = 183/393 (46.56%), Query Frame = 2
Query:  425 EILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLI----DEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNY---SWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRS-----NFLKIYSKLPNSIGDTVQQMLSRIPTERPD-IEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFR-------FSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYV-LLDLLEFYIDRLDQQEILSKIL-PLFLRVLED 1537
            EILR +   L + +H  +L L   + E++   MFV E +  SL  +     DE +   +  V D        + +  G  Q+V AL  +H     +H N+ P  I I+ ++ WK++GLG+ +K+     +  Y    ++P+   +    LNY APEI  +N   F++D FSLGL+I  +Y  G  L     + S Y  + ++  S     ++  I+SK+P  +   + ++++R    R D I  + + + F+D L+ +L+ L  L  K+  E+  F      L+ ++   L  ++ LP+L++           S       L  I+ +    S+  F + +Y  L    N  +  + A + L+D L+    ++ + + L  IL PLF  VL D
Sbjct:   82 EILRNQANNLAKLKHPNILTLIEPLEEHSKNFMFVTEFVTSSLETVFRETDDEEQNFLQGHVKD-------NIVVQRGILQLVNALDFVHNRASFVHLNIQPRAIFINENSDWKISGLGYLVKIPPGTNTSEYFLPQYDPRVPPFMHLQLNYTAPEIVFENTLTFKNDYFSLGLLIYFLY-TGKDLFRSENSTSEYKLEYNKFESKISTMSWDNIFSKVPQKLRHCIPKLINRDIYSRYDNITLILDSEFFQDPLVKTLNFLDDLPTKNNEEKYVFLEGLVNLLPEFPPALLQKKFLPILLELLSQFCAEKVVSDKCVGKSLDLIIKIGSTLSQLSFQEKVYPVLLSDANFPVLLKKATICLIDNLDTLKQKVKRSDFLENILKPLFNYVLHD 466          
BLAST of Protein kinase vs. Ensembl Yeast
Match: SWE1 (Protein kinase that regulates the G2/M transition; negative regulator of the Cdc28p kinase; morphogenesis checkpoint kinase; positive regulator of sphingolipid biosynthesis via Orm2p; phosphorylates a tyrosine residue in the N-terminus of Hsp90 in a cell-cycle associated manner, thus modulating the ability of Hsp90 to chaperone a selected clientele; localizes to the nucleus and to the daughter side of the mother-bud neck; homolog of S. pombe Wee1p; potential Cdc28p substrate [Source:SGD;Acc:S000003723])

HSP 1 Score: 50.447 bits (119), Expect = 1.150e-6
Identity = 70/271 (25.83%), Postives = 118/271 (43.54%), Query Frame = 2
Query:  191 AMISRITSIKRHS--AAPEIPISIKQSFIIGEIISFCGNENVW-KTCQCTKIDSGQNCSI-QIYEKRTMEK--IYKSKRKEYVSEILRR---EIECLHEFRHN---------YLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNN 949
            A+++  TS + HS  +    P++ K+  I    +S   + +++ K      I  GQ  ++ Q+   +T +K  I   K  +Y S  L+R   EI+ L+E  +          Y++   +S    N Y +      +C   NL      L E  +   K ++L    I     ++  ALR +H +  I+H +L P+N++I+     K+   G    L  + KS             + D  YIAPEI       +++DIFSLGL+I  I  N
Sbjct:  399 AIVTNTTSAETHSISSTDSSPLNSKRRLISSNKLSANPDSHLFEKFTNVHSIGKGQFSTVYQVTFAQTNKKYAIKAIKPNKYNS--LKRILLEIKILNEVTNQITMDQEGKEYIIDYISSWKFQNSYYIMTE---LCENGNL---DGFLQEQVI--AKKKRLEDWRIWKIIVELSLALRFIHDSCHIVHLDLKPANVMITFEGNLKLGDFGMATHLPLEDKSFE----------NEGDREYIAPEIISDCTYDYKADIFSLGLMIVEIAAN 649          
BLAST of Protein kinase vs. Ensembl Yeast
Match: SNF1 (AMP-activated S/T protein kinase; forms a complex with Snf4p and members of the Sip1p/Sip2p/Gal83p family; required for transcription of glucose-repressed genes, thermotolerance, sporulation, and peroxisome biogenesis; regulates nucleocytoplasmic shuttling of Hxk2p; regulates filamentous growth and acts as a non-canonical GEF, activating Arf3p during invasive growth; SUMOylation by Mms21p inhibits its function and targets Snf1p for destruction via the Slx5-Slx8 Ub ligase [Source:SGD;Acc:S000002885])

HSP 1 Score: 49.2914 bits (116), Expect = 2.257e-6
Identity = 69/297 (23.23%), Postives = 125/297 (42.09%), Query Frame = 2
Query:  278 EIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPEI---QLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSR------NVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFK 1141
            +I+   G  +  K        +GQ  +++I  K+ + K     R       + REI  L   RH ++++L+  V ++ D ++ V E     L + I +R+ + E      + R+         F Q++ A+ + H  + I+H +L P N+L+  H   K+   G    + +         N  +   G P  NY APE+   +L   P  + D++S G+I+         ++ C R      ++ +  K I        K  S  P + G  +++ML   P  R  I E+ + D FK
Sbjct:   56 QIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGR-------IEREISYLRLLRHPHIIKLY-DVIKSKDEIIMVIEYAGNELFDYIVQRDKMSEQ-----EARRF--------FQQIISAVEYCH-RHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDG--------NFLKTSCGSP--NYAAPEVISGKLYAGP--EVDVWSCGVILY--------VMLCRRLPFDDESIPVLFKNISNGVYTLPKFLS--PGAAG-LIKRMLIVNPLNRISIHEIMQDDWFK 307          
BLAST of Protein kinase vs. Ensembl Yeast
Match: PKH3 (Protein kinase with similarity to mammalian PDK1 and yeast Pkh1p/Phk2p; yeast Pkh1p and Pkh2p are two redundant upstream activators of Pkc1p; identified as a multicopy suppressor of a pkh1 pkh2 double mutant [Source:SGD;Acc:S000002874])

HSP 1 Score: 48.1358 bits (113), Expect = 6.753e-6
Identity = 53/193 (27.46%), Postives = 89/193 (46.11%), Query Frame = 2
Query:  392 IYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVH-ENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVT--GLGFCIKLAEKGKSHNYSWNPKQVKYGQ------PDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIY 943
            I K  + +YV+ I +  +  L +  H  +++L+ + H E N Y +    P    L +L+ +       T NDI TR            Q+++AL  +H ++GIIH +L P N+L+    +  +T  G    I  +  G S  ++ +    K  Q          Y++PE+ L N   + SDI++LG   C IY
Sbjct:   48 IIKEAKVKYVT-IEKNTMNLLAQKHHAGIIKLYYTFHDEENLYFVLDFAPG-GELLSLLHKM-----GTFNDIWTRHFTA--------QLIDALEFIH-SHGIIHRDLKPENVLLDRDGRLMITDFGAAATIDPSLSGDSAKFNSDSNGSKDNQNCASFVGTAEYVSPELLLYNQCGYGSDIWALG---CMIY 221          
BLAST of Protein kinase vs. Ensembl Yeast
Match: ISR1 (Predicted protein kinase; overexpression causes sensitivity to staurosporine, which is a potent inhibitor of protein kinase C [Source:SGD;Acc:S000006310])

HSP 1 Score: 47.3654 bits (111), Expect = 7.893e-6
Identity = 34/103 (33.01%), Postives = 56/103 (54.37%), Query Frame = 2
Query:  653 QMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFC----IKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPEI---QLKNVPMFQSDIFSLGLIICSI 940
            QM++AL+ L  TNGIIHG++  +NILI+   +  V   G C      LA+   + + +  P  +      + Y APE+      +VP F+SD++++GL + S 
Sbjct:  263 QMIDALKSLK-TNGIIHGDIKTANILIT---EMHVLNGGHCKDFDFYLADFTSAFHINQTPTDL---NTTVEYCAPELIDSSSDHVPTFESDLYAVGLCLLSF 358          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO42744 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0J5])

HSP 1 Score: 221.476 bits (563), Expect = 3.229e-62
Identity = 158/593 (26.64%), Postives = 289/593 (48.74%), Query Frame = 2
Query:  254 IKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYS---WNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEV--RSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTT--FVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNKENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQLN 2011
            + + + +G+ ++  G    WK  +     +GQ  S+ ++EKR ++ + K  R + V E++++    L   RH  LL +  ++ E+ D L F  EPI  SL+N++   + +P     +    ++  +E + G YQ+VE L  LH    I+ GNL P NI+I+ + QWK+ GL F            YS   W P+     QPDLNY APE  L       SD++SLG +I ++YN G    +C  N++ + + +++V   S        +P S+   V  +LS  P+ RPD  ++ ++  F++   L+L  L SL  +    +  FF    K++      +  QR+LP L       SNL    FVLP+IL +    +  ++ K +   L+ +   +   Q   + L  L+  + +  +  +   +LP+  R LE      S     + + N +    +++    +K  ++ ++K +  + +  L V++ CL C  ++LE LD  +++++++PFL  +        +AILGI+K  +  +  G+    +A + +P L P AV P L  ++F   M +L  ++ ++E +   +L 
Sbjct:   16 LTKDYEVGKHVASFGPNLAWKVFEGKAKTTGQEASLVVFEKRLLDTVDKRDR-DVVLELMKKGAVQLTRLRHPRLLLIQHAMEESRDCLAFATEPIFASLSNVLGRHDNMPSPPPPEFANFEMYDVERVYGLYQLVEGLMFLHNDAKILQGNLSPENIVITKNGQWKIAGLFFSSTPTIVEGQSTYSGCEWEPRLYPLAQPDLNYAAPEFILSRTCDTSSDMYSLGALIHAVYNKGAPPYQCDNNMTAFKRNVEQVCLMSKSHASLGSVPGSLKSQVHSLLSMTPSLRPDCHQMAKIPFFENVAALTLQYLDSLMQRDDVAKTQFFKSLYKVMPKLPRRVVMQRVLPQLCLQL---SNLQVIPFVLPNILLITEDCTAEEYTKLILPELKPVFKVQEPVQVTIIFLQKLDLLLSKTPKDSVRDDVLPMVFRALE-----ASSIQIQEMVLNVIPKFASMVDYPSMKNAVIPRIKTLCLQTSS-LSVRVNCLVCFGKILEHLDKYLVIEDILPFLAQIPSREAPTLMAILGIFKQTMVHKKLGMDKDYLAMRAIPYLFPLAVEPSLNLKQFSQYMKLLGDMIKRVEVEHKAKLE 598          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO33652 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRL3])

HSP 1 Score: 64.3142 bits (155), Expect = 1.358e-10
Identity = 70/306 (22.88%), Postives = 134/306 (43.79%), Query Frame = 2
Query:  236 PEIPISIK----QSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTR-KLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCF 1138
            P++P  I     + +  G ++   G   V+   + T + + +  ++++  K+ + K  K  RK      +  EIE     RH+Y++    S  +  ++ + +    +CS  +L           V  +KTR KL   E+     Q +EA  +LH    +IH ++   N  I+++ + ++   G  ++L    K   Y     +   G P  NYIAPE+  K    ++ D ++LG ++ ++   G    E       Y +    +R+N   I S++ +S    +Q+ML   P  RP + ++   D F
Sbjct:    3 PDVPKVIDNGNGRRYFRGRLLGKGGFARVY---EVTDMSTNKIYALKVVPKKRLSKSTKEYRK------IEMEIELHRTLRHHYVVGFHGSFQDEMNFYILL---ELCSRKSL-----------VQMLKTRGKLTEPEVRFFMQQAIEACSYLH-EQRVIHRDIKVGNFFINSNMELRLGDFGLAVRL----KPDEYKI---RTMCGTP--NYIAPEVLSKEGHSYEVDTWALGCVMYTMLV-GHPPFETKSLRETYRR----IRNNDYTIPSRVSDSAARLIQRMLHANPENRPKLSDIFSDDFF 270          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO37827 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEP8])

HSP 1 Score: 62.7734 bits (151), Expect = 4.325e-10
Identity = 74/310 (23.87%), Postives = 137/310 (44.19%), Query Frame = 2
Query:  230 AAPEIPISIKQSFIIGEI------ISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFK 1141
            A P IP  + Q  +  +         F G     K  + T +D+ +  + +I  K  + K ++        E +  EIE   +  H +++  F    E+ DY+  + E  +C   +L++  +          + R L   E+     Q+++A  +LH +  IIH +L   N+ ++   + KV   G   + AE+G+        K+   G P  NYIAPE+  K    F+ D++S+G I+ ++   G    E     + Y    D ++ N   I SK+ ++    + ++L   PT RP ++++ + D FK
Sbjct:    2 APPSIPRELDQIIVDADRKKRYYRGKFLGKGGFAKCYELTDLDTNKIYAGKIISKSMLTKPHQK-------EKMAMEIEIHGKVMHKHIVG-FHGYFEDRDYIYILLE--LCPRRSLMELHK----------RRRALTEPEVRYFMKQIIDACIYLHKSR-IIHRDLKLGNLFLNDDMEVKVGDFGLATR-AEEGER-------KKTLCGTP--NYIAPEVLSKRGHSFEVDVWSVGCILYTLL-VGKPPFETQSLKTTY----DRIKRNEYYIPSKVSHTAQLLIIKLLRPDPTTRPTMQQVLDDDFFK 275          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO45439 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTB4])

HSP 1 Score: 59.6918 bits (143), Expect = 2.496e-9
Identity = 64/291 (21.99%), Postives = 138/291 (47.42%), Query Frame = 2
Query:  266 FIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMF-VCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLC--PSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPEIQ--LKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELR 1123
            +++G+++       V +   C  +   + C+++I +KR + +I   ++       ++REI  L    H  ++QL+  +++     M+ + E  +  L  +++        +V+D   RK    +    F Q+++ L++LH   G++H ++   PSN+L+ST    K++ LG   +L+       +S +    +  Q    +  PEI   L+    F+ DI++ G+ + +I   G    E     +IY +  + +      I  ++ +S+ D ++ ML+  P +R  IE++R
Sbjct:   73 YLMGDMLGEGSYGKVKEMLDCENL---RRCAVKILKKRRLRRIPNGEQN------VKREIRLLKRLNHKNVIQLYDVIYDEVKQKMYMIFEYCVGELQEMLE--------SVDD---RKFPISQAHGYFCQLMDGLKYLHC-QGVVHKDILFQPSNLLLSTDGTLKISDLGVAERLSP------FSAD-DTCRTSQGSPAFQPPEIANGLETFSGFKVDIWAAGVTLYNI-TTGKYPFEGD---NIY-RLFENIGKGEFSIPDEVDDSLSDLLKGMLNPDPEKRLTIEQIR 330          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO48026 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKQ3])

HSP 1 Score: 56.9954 bits (136), Expect = 1.142e-8
Identity = 76/270 (28.15%), Postives = 111/270 (41.11%), Query Frame = 2
Query:  326 CTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPEST---VNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCI---KLAEKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEE 1117
              +I +G+  +I++ EKR    I K K+   VS    RE E L    H + + L+ +  ++ D L F          +   + E+LP  T     D K  +  + EI       + AL HLH    IIH +L P NIL+  +   K+T  G      K  EK K  N      Q         Y++PE+         SDI++LG II  +  +G +         I+ K I     N     S  P    D V+Q+L   PT+R   EE
Sbjct:   26 AQEISTGKEYAIKVLEKR---HIQKEKKVAQVS----REKEVLSRLNHPFFVILYFTF-QDRDKLYFGL--------SYAKKGELLPYITRLGSFDEKCTQFYSAEI-------ISALEHLHGLQ-IIHRDLKPENILLDENMHIKITDFGTAKILNKDEEKNKGRNSFVGTAQ---------YVSPELLTDKRACKSSDIWALGCIIYQLL-SGLTPYRAGNEYQIFQKII----KNDYSFPSGFPEIPKDLVEQLLILDPTKRLGCEE 257          
BLAST of Protein kinase vs. Ensembl Medaka
Match: si:ch211-244b2.1 (SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:101171295])

HSP 1 Score: 211.46 bits (537), Expect = 2.003e-56
Identity = 148/591 (25.04%), Postives = 297/591 (50.25%), Query Frame = 2
Query:  254 IKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSH-NYS---WNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRN--VSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNKENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQL 2008
            + + F +G+ I+  G    W+    TK  + Q  ++ +++K+ ++K Y+   K+ + + L++ ++ L   RH  LL +   + E+ D L F  EP+  SL+N++ + + LP     DIK  KL  +E   G  Q+ E L  LH    ++HGNLCP NI+++    WK+ G  F I       +   Y+   W P       P+  Y+APE  L       SD++SLG+++ +++N G  + + +++     +++++D++ S    +  K+P  + +  + +LS  P  RPD +++ ++  F D   ++L    SL  +   ++  F+    K++    + +   RILP L   F  + ++  FVLP++L +  + +K ++ + +  +L  +   +   Q   + L  ++  + +   ++I + +LP+  R +E P          +   N +    N++    +K  ++ ++K     +   L V++  L CL ++LE LD   ++DE++PFL  +     ++ + ILGIYK   S +  GI  + +A K LP L+  +++  L   +F   M V+R++L+++E +   +L
Sbjct:   28 VTREFEVGKHIASGGPGLCWRIYNGTKKSTKQEVAVFVFDKKMIDK-YQKFDKDQIIDSLKKGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWDNLPSPVPKDIKEYKLYDVETKYGLLQISEGLSFLHSGVKMVHGNLCPENIILNKSGAWKIMGFDFSISSTNPSDAEPKYTCKEWEPNLPPLCLPNPEYLAPEYILSVSCDSASDMYSLGVVMHAVFNEGKPVFQVNKHDIFKSFSRQLDQLSSMSPTVLGKIPEEVREHAKMLLSVTPNVRPDADQITKIPFFDDVGAVTLQYFDSLFQRDNLQKSQFYKGLPKVLPKLPKRVVVYRILPALTSEF-VNPDMVPFVLPNVLLIAEECTKEEYVRLIMPDLSPVFKLQEPVQILLIFLQKMDLLLTKTPPEDIKNSVLPMVYRAVEAP-----SIQIQELCLNIIPSFANLIDYPSMKNSLIPRIKSAC-LQTSSLAVRVNSLVCLGKILEYLDKWFVIDEILPFLQQIPSREPAVLMGILGIYKCTFSHKKLGIPKEHLATKSLPHLVSLSIDNNLNLNQFNSFMVVIREMLNRMEAEHKTKL 610          
BLAST of Protein kinase vs. Ensembl Medaka
Match: si:ch211-244b2.1 (SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:101171295])

HSP 1 Score: 209.534 bits (532), Expect = 7.806e-56
Identity = 149/595 (25.04%), Postives = 298/595 (50.08%), Query Frame = 2
Query:  254 IKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSH-NYS---WNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRN--VSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILN----TEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNKENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQL 2008
            + + F +G+ I+  G    W+    TK  + Q  ++ +++K+ ++K Y+   K+ + + L++ ++ L   RH  LL +   + E+ D L F  EP+  SL+N++ + + LP     DIK  KL  +E   G  Q+ E L  LH    ++HGNLCP NI+++    WK+ G  F I       +   Y+   W P       P+  Y+APE  L       SD++SLG+++ +++N G  + + +++     +++++D++ S    +  K+P  + +  + +LS  P  RPD +++ ++  F D   ++L    SL  +   ++  F+    K++    + +   RILP L   F  + ++  FVLP++L +  + +K ++ + +  +L  +       + SN    + L  ++  + +   ++I + +LP+  R +E P          +   N +    N++    +K  ++ ++K     +   L V++  L CL ++LE LD   ++DE++PFL  +     ++ + ILGIYK   S +  GI  + +A K LP L+  +++  L   +F   M V+R++L+++E +   +L
Sbjct:   28 VTREFEVGKHIASGGPGLCWRIYNGTKKSTKQEVAVFVFDKKMIDK-YQKFDKDQIIDSLKKGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWDNLPSPVPKDIKEYKLYDVETKYGLLQISEGLSFLHSGVKMVHGNLCPENIILNKSGAWKIMGFDFSISSTNPSDAEPKYTCKEWEPNLPPLCLPNPEYLAPEYILSVSCDSASDMYSLGVVMHAVFNEGKPVFQVNKHDIFKSFSRQLDQLSSMSPTVLGKIPEEVREHAKMLLSVTPNVRPDADQITKIPFFDDVGAVTLQYFDSLFQRDNLQKSQFYKGLPKVLPKLPKRVVVYRILPALTSEF-VNPDMVPFVLPNVLLIAEECTKEEYVRLIMPDLSPVFKLQEPVQASNMILLIFLQKMDLLLTKTPPEDIKNSVLPMVYRAVEAP-----SIQIQELCLNIIPSFANLIDYPSMKNSLIPRIKSAC-LQTSSLAVRVNSLVCLGKILEYLDKWFVIDEILPFLQQIPSREPAVLMGILGIYKCTFSHKKLGIPKEHLATKSLPHLVSLSIDNNLNLNQFNSFMVVIREMLNRMEAEHKTKL 614          
BLAST of Protein kinase vs. Ensembl Medaka
Match: plk2b (polo like kinase 2 [Source:NCBI gene;Acc:101166557])

HSP 1 Score: 61.2326 bits (147), Expect = 3.485e-9
Identity = 74/288 (25.69%), Postives = 123/288 (42.71%), Query Frame = 2
Query:  320 CQCTKIDSGQNCSIQIYEKR--TMEKIYKSK-------RKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNN--GCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQ----MLSRIPTERPDIEELREMDCF 1138
            C C     G+    + YE    +  K+Y +K        K +  E + REIE      H +++  +    +  +  + +      SLA+++  R+VL E              E+     Q+V  L++LH    I+H +L   N  +S   + KV   G   KL   G       N ++   G P  NY++PE+  K     +SDI++LG   C +Y    G    E + N+    K I E R      YS LP+S+    +Q    +L++IP +RP+++ +   D F
Sbjct:   50 CYCRGKVLGKGGFAKCYEMTDLSTSKVYAAKIIPHARVSKPHQREKIDREIELHRALNHRHVVHFYHHFEDKENIYILLEYCSRKSLAHILKARKVLTEP-------------EVRYYLRQIVSGLKYLHEQE-ILHRDLKLGNFFVSESMELKVGDFGLAAKLEPVG-------NRRKTICGTP--NYLSPEVLNKQGHGCESDIWALG---CVMYTMLLGRPPFETT-NLKETYKCIREAR------YS-LPSSLSPQAKQLISSLLAKIPEDRPNLDHILRHDFF 303          
BLAST of Protein kinase vs. Ensembl Medaka
Match: plk2b (polo like kinase 2 [Source:NCBI gene;Acc:101166557])

HSP 1 Score: 61.2326 bits (147), Expect = 3.586e-9
Identity = 74/288 (25.69%), Postives = 123/288 (42.71%), Query Frame = 2
Query:  320 CQCTKIDSGQNCSIQIYEKR--TMEKIYKSK-------RKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNN--GCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQ----MLSRIPTERPDIEELREMDCF 1138
            C C     G+    + YE    +  K+Y +K        K +  E + REIE      H +++  +    +  +  + +      SLA+++  R+VL E              E+     Q+V  L++LH    I+H +L   N  +S   + KV   G   KL   G       N ++   G P  NY++PE+  K     +SDI++LG   C +Y    G    E + N+    K I E R      YS LP+S+    +Q    +L++IP +RP+++ +   D F
Sbjct:   50 CYCRGKVLGKGGFAKCYEMTDLSTSKVYAAKIIPHARVSKPHQREKIDREIELHRALNHRHVVHFYHHFEDKENIYILLEYCSRKSLAHILKARKVLTEP-------------EVRYYLRQIVSGLKYLHEQE-ILHRDLKLGNFFVSESMELKVGDFGLAAKLEPVG-------NRRKTICGTP--NYLSPEVLNKQGHGCESDIWALG---CVMYTMLLGRPPFETT-NLKETYKCIREAR------YS-LPSSLSPQAKQLISSLLAKIPEDRPNLDHILRHDFF 303          
BLAST of Protein kinase vs. Ensembl Medaka
Match: plk2b (polo like kinase 2 [Source:NCBI gene;Acc:101166557])

HSP 1 Score: 60.4622 bits (145), Expect = 6.650e-9
Identity = 74/288 (25.69%), Postives = 123/288 (42.71%), Query Frame = 2
Query:  320 CQCTKIDSGQNCSIQIYEKR--TMEKIYKSK-------RKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNN--GCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQ----MLSRIPTERPDIEELREMDCF 1138
            C C     G+    + YE    +  K+Y +K        K +  E + REIE      H +++  +    +  +  + +      SLA+++  R+VL E              E+     Q+V  L++LH    I+H +L   N  +S   + KV   G   KL   G       N ++   G P  NY++PE+  K     +SDI++LG   C +Y    G    E + N+    K I E R      YS LP+S+    +Q    +L++IP +RP+++ +   D F
Sbjct:   50 CYCRGKVLGKGGFAKCYEMTDLSTSKVYAAKIIPHARVSKPHQREKIDREIELHRALNHRHVVHFYHHFEDKENIYILLEYCSRKSLAHILKARKVLTEP-------------EVRYYLRQIVSGLKYLHEQE-ILHRDLKLGNFFVSESMELKVGDFGLAAKLEPVG-------NRRKTICGTP--NYLSPEVLNKQGHGCESDIWALG---CVMYTMLLGRPPFE-TTNLKETYKCIREAR------YS-LPSSLSPQAKQLISSLLAKIPEDRPNLDHILRHDFF 303          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000012946.1 (SMESG000012946.1)

HSP 1 Score: 1580.07 bits (4090), Expect = 0.000e+0
Identity = 841/845 (99.53%), Postives = 844/845 (99.88%), Query Frame = 2
Query:  194 MISRITSIKRHSAAPEIPISIKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNKENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQLNIEXXXXXXXXXXXXXXXXXCNRVLPLISMQQPTMEIDYGSQNSFNSRMTGSRRGSNVTDYRRGSTDNTPGSRRNSALLNRLKLNNSESLLFPTRNRRGSAFDNRNWSKTNSNPAFISQLSGENSRENIQLSSNSMQYRRLSGNTSSYLNKGLAVPNNQFPRRHSYESSHNASINSLITASVCEGPFISPXXXXXXXXXXXXXXLGPQIIPGNNSRRMSSTGSRRLSFNAFSDTLINLFQ 2728
            MISRITSIKRHSAAPEIPISIKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKDSLILSLDSLFSLDGKSMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDR+DQQEILSKILPLFLRV+EDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNKENQVLKVQILCLECLDQLLEDLDNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQLNIESVRSNSGSLSSIGSNVNCNRVLPLISMQQPTMEIDYGSQNSFNSRMTGSRRGSNVTDYRRGSTDNTPGSRRNSALLNRLKLNNSESLLFPTRNRRGS FDNRNWSKTNSNPAFISQLSGENSRENIQLSSNSMQYRRLSGNTSSYLNKGLAVPNNQFPRRHSYESSHNASINSLITASVCEGPFISPSNSRAQSRRTSAQSLGPQ+IPGNNSRRMSSTGSRRLSFNAFSDTLINLFQ
Sbjct:    1 MISRITSIKRHSAAPEIPISIKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKDSLILSLDSLFSLDGKSMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRMDQQEILSKILPLFLRVIEDPGNSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNKENQVLKVQILCLECLDQLLEDLDNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQLNIESVRSNSGSLSSIGSNVNCNRVLPLISMQQPTMEIDYGSQNSFNSRMTGSRRGSNVTDYRRGSTDNTPGSRRNSALLNRLKLNNSESLLFPTRNRRGSVFDNRNWSKTNSNPAFISQLSGENSRENIQLSSNSMQYRRLSGNTSSYLNKGLAVPNNQFPRRHSYESSHNASINSLITASVCEGPFISPSNSRAQSRRTSAQSLGPQVIPGNNSRRMSSTGSRRLSFNAFSDTLINLFQ 845          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000009222.1 (SMESG000009222.1)

HSP 1 Score: 481.1 bits (1237), Expect = 3.126e-156
Identity = 323/834 (38.73%), Postives = 513/834 (61.51%), Query Frame = 2
Query:  194 MISRITSIKRHSAAPEIPISIKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYK-SKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSHNYSWNP--KQVKYGQP-DLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDSLWNCLVILQNIL-TPLQLKEQILSKLKVIFNKENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQLNIEXXXXXXXXXXXXXXXXXCNRV-LPLISMQQPTMEID-YGSQNSFNSRMTGSRRGSNVTDYRRGSTDNTPGSRRNSALLNRLKLNN--SESLLFPTRN-RRGSAFDNRNWSKTNSNPAFISQLSGENSRENIQLSSNSMQ-YRRLSGN-------TSSYLNKGLAVPNNQFPRRHSYESSHNASINSLITASVCEGPFISPXXXXXXXXXXXXXXLGPQIIP 2641
            MISRITSIKR++  PE     ++++ + + I+  GN+ +WK      I++ Q+C++ ++EKR MEKI++ S ++E + + L+RE+  L +++H+ +L++   + E  D++ FV EP++  L+N + + E         IK  K   LE++LG YQ+++ALR+L+ T+ ++HGN+ P+NILI  H  WK++G      LAEK   +N+  N    + +   P DL+Y APE+Q        SDIFSLGL+I +IYNNG S ++C +++S Y+KK+DE+ S F +I   +P  + + ++++L      RP  + +  + CF +  + SL+   SL+ KSMN++K FFN FSKLVA+Y +DLRY+RILPLLM+WF+ S  L +FVLPSILT+++ ++  +F+ +L  NL+Y++ +E + QT+ VLLDL+EF+I RL   E+LS+++   L  LED   SE+Q    ++  N   +LQ+   TP    + +     ++ N  N   K++I  LEC++++L++LD  II+D ++P L  ++ +     +++L IY+H++++      + +IA  ILP LIP  V+  L   EF + M  +R +LDKIER R  Q+  E+      S  S   +   N   +PLI+MQQPT++ID   + N+F S      + S   DY   S DN     +++ L+NR++ ++  S++ ++ +RN    S  D R W+KTNSNP+F   LS  NSRE    S++S+Q  RR SGN       + S  +  L VP    PRRHSY S   +S+NSLITA++CEGPFI+P  S++ SRRTSAQSLGP ++P
Sbjct:    1 MISRITSIKRNNTTPEPLYPTRKNYDLKQPIARTGNDYIWKLYSSFTIETNQDCTVFVFEKRAMEKIHRFSNKREALLDSLKREVVYLEKYKHSQILKVIAGLEETRDFMTFVSEPVLGCLSNFVRKNEKWNFQMPKHIKNYKFYDLEVILGLYQIIDALRYLNSTHEMVHGNINPNNILICKHGHWKLSGFN----LAEKITMNNFKGNSYISRTERAIPTDLDYTAPEVQKSAHVTPLSDIFSLGLVIVTIYNNGVSPLQCYKSLSAYSKKLDELPSLFSRISENIPRDLIEPLRKLLCIDVKNRPTPQLISMLKCFNEPYVKSLEVFLSLEYKSMNQKKTFFNNFSKLVAEYPKDLRYERILPLLMEWFQQSEVLASFVLPSILTILHNSTDEEFNAYLAMNLKYLIKSEKNIQTSIVLLDLIEFFITRLKDDELLSELINNLLICLEDVS-SEAQ----EAAINAFSVLQDYFNTPEFSLKMLKKLKDLVDNSHNA--KIEISILECVNRMLDNLDRDIIIDHIVPLLLKIDLTIPLKLMSVLEIYRHIITSNQIMFPYTIIANTILPTLIPITVDSNLSLPEFRMTMDTVRMMLDKIERSRFSQIKPENSGFTHNSSCSSIGSFYNNNCRVPLIAMQQPTLDIDSRRNSNNFYSYQDRLNKRSMSGDYCHDSFDNEIS--KSAILMNRMRSSSQVSDNSIYNSRNLSNSSTSDRRLWNKTNSNPSFNIHLST-NSRE--LSSAHSLQILRRHSGNLPVQNDSSGSRNSASLLVPEEYNPRRHSYGSQCASSVNSLITANICEGPFITPPGSKSASRRTSAQSLGPTVVP 818          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000078112.1 (SMESG000078112.1)

HSP 1 Score: 279.256 bits (713), Expect = 2.188e-80
Identity = 234/819 (28.57%), Postives = 402/819 (49.08%), Query Frame = 2
Query:  254 IKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSH--NYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISN--QTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDS--LWNCLV---ILQNILTPLQLKEQILSKLKVIFNKENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQLNIEXXXXXXXXXXXXXXXXXCNRVLPLISMQQPTMEIDYGSQNSFNSRMTGSRRGSNVTDYRRGSTDNTPGSRRNSALLNRLKLNNSESLLFPTRNR--RGSAF-------DNRNWSKTNSN--------PAFISQLSGE------------NSRENIQLSSNSMQYRRLS-----GNTSSYLNKGLAVPNNQFPRRHSYE-SSHNASINSLITASVCEGPFISP 2578
            + +SF + +    CG E  WK     ++  G +CS+ I+EKR  EK++K +RKE + + LR+E+  L  F H+ +L++   + ENN+ L F  E II SLANL+     L +S    IK  KL  LEI  G YQ+ + LR+LH +  +IH N+ PS +LI+    WK+ G GF        +    +  W+ K+ K  QPDL+YIAPE+QL        D+FSLGL+IC+ Y  G SLI  ++ +S Y KKI+E+   F  I S LP ++ + V++ML++    RP+ +    +  F D ++LS+D + + + KS  E+  F     +++ +Y ++L   RI P        S +L       ++  I  ++   F  H+   +  IL     N    + ++L  +E    ++  +++  K++P+ ++ + +    E+Q ++ DS  L+ C +    L NI+ P         K+K I N+  ++LKV+   L  +  L+  L+N +I+DEVIPFL  +  ++  I + ++  YK M++ +      ++I  +I+  L+    NP LK       + +L  LL+K++ ++    + ES        + + S   C++                  Q + + R  GS R S++   R   T  +P  R+ SA + R+  N S ++   +  +  + +AF       +N ++ KT+ N         +   +LSG+            NS +N+++   ++ +  L+         + L + +  P     RRHS+  SS   S   LITASVCEGPF  P
Sbjct:   23 LSRSFSVKKQTGSCGVEMPWKIYDAVRLVDGMDCSLFIFEKRIAEKLHKPRRKEVICDFLRKEVFQLQSFNHSKILKVLHPMEENNETLAFATERIIGSLANLLGNDLRLSQSAAQAIKKHKLTDLEIKHGIYQLTDCLRYLHTSQQVIHSNVNPSTVLITESGHWKMFGTGFVTSNTNCTEEQITDMQWSAKKPKMTQPDLDYIAPELQLGGPITASIDMFSLGLLICTAYCGGKSLINANKTLSNYLKKIEELHKEFSSIASILPQALVEPVEKMLNKEIRYRPNSQLFSLLKYFDDMVLLSIDGIVNFEEKSSEEKMSFLQSLPEIIPEYPKELLSSRIFPFFFHHLMESRDLYEICFELLMATIQASTLDQFLDHMKPGITDILTRAKVNSIHESTIILQFVEPLFYKMTNEDMQLKVMPILVQCI-NSEIVEAQIAALDSLRLFKCCIDDETLNNIILP---------KIKFILNRR-KLLKVRCSALTAMSALITILENSVIIDEVIPFLNEIKTNDVEILMCVIQNYKEMINKKIKITKEQII--QIIHSLLNHLKNPLLKRPHIRCTVDILHLLLEKVDVEQMD--SFESNSEQKSETNEMSSIEICDKTTGSFEEDNEFESEIERIQINLSPRFNGSDRNSSM---RSSFTLGSPAMRKVSAPILRVNKNLSTAINLKSSEKSIKATAFIIGSTKEENSDYKKTSFNHHRRQTIDASMGLRLSGQQLPSSTSSSYRLNSGKNLKIIPRNIVFSALAQSQITDEEKTILKQQMTPP--PMGRRHSFAFSSIPDSPVDLITASVCEGPFQHP 821          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000078112.1 (SMESG000078112.1)

HSP 1 Score: 278.87 bits (712), Expect = 3.050e-80
Identity = 234/819 (28.57%), Postives = 402/819 (49.08%), Query Frame = 2
Query:  254 IKQSFIIGEIISFCGNENVWKTCQCTKIDSGQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSH--NYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISN--QTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDS--LWNCLV---ILQNILTPLQLKEQILSKLKVIFNKENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQLNIEXXXXXXXXXXXXXXXXXCNRVLPLISMQQPTMEIDYGSQNSFNSRMTGSRRGSNVTDYRRGSTDNTPGSRRNSALLNRLKLNNSESLLFPTRNR--RGSAF-------DNRNWSKTNSN--------PAFISQLSGE------------NSRENIQLSSNSMQYRRLS-----GNTSSYLNKGLAVPNNQFPRRHSYE-SSHNASINSLITASVCEGPFISP 2578
            + +SF + +    CG E  WK     ++  G +CS+ I+EKR  EK++K +RKE + + LR+E+  L  F H+ +L++   + ENN+ L F  E II SLANL+     L +S    IK  KL  LEI  G YQ+ + LR+LH +  +IH N+ PS +LI+    WK+ G GF        +    +  W+ K+ K  QPDL+YIAPE+QL        D+FSLGL+IC+ Y  G SLI  ++ +S Y KKI+E+   F  I S LP ++ + V++ML++    RP+ +    +  F D ++LS+D + + + KS  E+  F     +++ +Y ++L   RI P        S +L       ++  I  ++   F  H+   +  IL     N    + ++L  +E    ++  +++  K++P+ ++ + +    E+Q ++ DS  L+ C +    L NI+ P         K+K I N+  ++LKV+   L  +  L+  L+N +I+DEVIPFL  +  ++  I + ++  YK M++ +      ++I  +I+  L+    NP LK       + +L  LL+K++ ++    + ES        + + S   C++                  Q + + R  GS R S++   R   T  +P  R+ SA + R+  N S ++   +  +  + +AF       +N ++ KT+ N         +   +LSG+            NS +N+++   ++ +  L+         + L + +  P     RRHS+  SS   S   LITASVCEGPF  P
Sbjct:   23 LSRSFSVKKQTGSCGVEMPWKIYDAVRLVDGMDCSLFIFEKRIAEKLHKPRRKEVICDFLRKEVFQLQSFNHSKILKVLHPMEENNETLAFATERIIGSLANLLGNDLRLSQSAAQAIKKHKLTDLEIKHGIYQLTDCLRYLHTSQQVIHSNVNPSTVLITESGHWKMFGTGFVTSNTNCTEEQITDMQWSAKKPKMTQPDLDYIAPELQLGGPITASIDMFSLGLLICTAYCGGKSLINANKTLSNYLKKIEELHKEFSSIASILPQALVEPVEKMLNKEIRYRPNSQLFSLLKYFDDMVLLSIDGIVNFEEKSSEEKMSFLQSLPEIIPEYPKELLSSRIFPFFFHHLMESRDLYEICFELLMATIQASTLDQFLDHMKPGITDILTRAKVNSIHESTIILQFVEPLFYKMTNEDMQLKVMPILVQCI-NSEIVEAQIAALDSLRLFKCCIDDETLNNIILP---------KIKFILNRR-KLLKVRCSALTAMSALITILENSVIIDEVIPFLNEIKTNDVEILMCVIQNYKEMINKKIKITKEQII--QIIHSLLNHLKNPLLKRPHIRCTVDILHLLLEKVDVEQMD--SFESNSEQKSETNEMSSIEICDKTTGSFEEDNEFESEIERIQINLSPRFNGSDRNSSM---RSSFTLGSPAMRKVSAPILRVNKNLSTAINLKSSEKSIKATAFIIGSTKEENSDYKKTSFNHHRRQTIDASMGLRLSGQQLPSSTSSSYRLNSGKNLKIIPRNIVFSALAQSQITDEEKTILKQQMTPP--PMGRRHSFAFSSIPDSPVDLITASVCEGPFQHP 821          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000078112.1 (SMESG000078112.1)

HSP 1 Score: 265.388 bits (677), Expect = 8.740e-76
Identity = 227/788 (28.81%), Postives = 389/788 (49.37%), Query Frame = 2
Query:  347 QNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFTSVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILLGFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEKGKSH--NYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIYNNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIPTERPDIEELREMDCFKXXXXXXXXXXXXXXXXXMNERKDFFNLFSKLVADYSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYYNLQYILNTEISN--QTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPGNSESQTSSNDS--LWNCLV---ILQNILTPLQLKEQILSKLKVIFNKENQVLKVQIXXXXXXXXXXXXXXNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVSTRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERDRCCQLNIEXXXXXXXXXXXXXXXXXCNRVLPLISMQQPTMEIDYGSQNSFNSRMTGSRRGSNVTDYRRGSTDNTPGSRRNSALLNRLKLNNSESLLFPTRNR--RGSAF-------DNRNWSKTNSN--------PAFISQLSGE------------NSRENIQLSSNSMQYRRLS-----GNTSSYLNKGLAVPNNQFPRRHSYE-SSHNASINSLITASVCEGPFISP 2578
            Q+CS+ I+EKR  EK++K +RKE + + LR+E+  L  F H+ +L++   + ENN+ L F  E II SLANL+     L +S    IK  KL  LEI  G YQ+ + LR+LH +  +IH N+ PS +LI+    WK+ G GF        +    +  W+ K+ K  QPDL+YIAPE+QL        D+FSLGL+IC+ Y  G SLI  ++ +S Y KKI+E+   F  I S LP ++ + V++ML++    RP+ +    +  F D ++LS+D + + + KS  E+  F     +++ +Y ++L   RI P        S +L       ++  I  ++   F  H+   +  IL     N    + ++L  +E    ++  +++  K++P+ ++ + +    E+Q ++ DS  L+ C +    L NI+ P         K+K I N+  ++LKV+   L  +  L+  L+N +I+DEVIPFL  +  ++  I + ++  YK M++ +      ++I  +I+  L+    NP LK       + +L  LL+K++ ++    + ES        + + S   C++                  Q + + R  GS R S++   R   T  +P  R+ SA + R+  N S ++   +  +  + +AF       +N ++ KT+ N         +   +LSG+            NS +N+++   ++ +  L+         + L + +  P     RRHS+  SS   S   LITASVCEGPF  P
Sbjct:    9 QDCSLFIFEKRIAEKLHKPRRKEVICDFLRKEVFQLQSFNHSKILKVLHPMEENNETLAFATERIIGSLANLLGNDLRLSQSAAQAIKKHKLTDLEIKHGIYQLTDCLRYLHTSQQVIHSNVNPSTVLITESGHWKMFGTGFVTSNTNCTEEQITDMQWSAKKPKMTQPDLDYIAPELQLGGPITASIDMFSLGLLICTAYCGGKSLINANKTLSNYLKKIEELHKEFSSIASILPQALVEPVEKMLNKEIRYRPNSQLFSLLKYFDDMVLLSIDGIVNFEEKSSEEKMSFLQSLPEIIPEYPKELLSSRIFPFFFHHLMESRDLYEICFELLMATIQASTLDQFLDHMKPGITDILTRAKVNSIHESTIILQFVEPLFYKMTNEDMQLKVMPILVQCI-NSEIVEAQIAALDSLRLFKCCIDDETLNNIILP---------KIKFILNRR-KLLKVRCSALTAMSALITILENSVIIDEVIPFLNEIKTNDVEILMCVIQNYKEMINKKIKITKEQII--QIIHSLLNHLKNPLLKRPHIRCTVDILHLLLEKVDVEQMD--SFESNSEQKSETNEMSSIEICDKTTGSFEEDNEFESEIERIQINLSPRFNGSDRNSSM---RSSFTLGSPAMRKVSAPILRVNKNLSTAINLKSSEKSIKATAFIIGSTKEENSDYKKTSFNHHRRQTIDASMGLRLSGQQLPSSTSSSYRLNSGKNLKIIPRNIVFSALAQSQITDEEKTILKQQMTPP--PMGRRHSFAFSSIPDSPVDLITASVCEGPFQHP 776          
The following BLAST results are available for this feature:
BLAST of Protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCYL22.632e-5925.85SCY1 like pseudokinase 2 [Source:HGNC Symbol;Acc:H... [more]
SCYL29.879e-5925.85SCY1 like pseudokinase 2 [Source:HGNC Symbol;Acc:H... [more]
SCYL22.870e-5825.85SCY1 like pseudokinase 2 [Source:HGNC Symbol;Acc:H... [more]
AC091230.16.310e-927.41unc-51 like kinase 3 [Source:NCBI gene;Acc:25989][more]
AC091230.16.985e-926.67unc-51 like kinase 3 [Source:NCBI gene;Acc:25989][more]
back to top
BLAST of Protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZC581.94.558e-2526.18pep chromosome:WBcel235:I:6665077:6673840:-1 gene:... [more]
ZC581.95.227e-2526.18pep chromosome:WBcel235:I:6665077:6673602:-1 gene:... [more]
ZC581.95.505e-2526.18pep chromosome:WBcel235:I:6665077:6670409:-1 gene:... [more]
ZC581.96.122e-2526.18pep chromosome:WBcel235:I:6665077:6673807:-1 gene:... [more]
dyf-52.997e-825.45Serine/threonine-protein kinase dyf-5 [Source:Uni... [more]
back to top
BLAST of Protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bma2.425e-7026.70gene:FBgn0085385 transcript:FBtr0331577[more]
bma2.425e-7026.70gene:FBgn0085385 transcript:FBtr0331578[more]
bma4.720e-7026.70gene:FBgn0085385 transcript:FBtr0331579[more]
CG19511.551e-5025.89gene:FBgn0039623 transcript:FBtr0085342[more]
PEK2.273e-728.48gene:FBgn0037327 transcript:FBtr0330026[more]
back to top
BLAST of Protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCYL23.799e-5524.70si:ch211-244b2.1 [Source:ZFIN;Acc:ZDB-GENE-041210-... [more]
SCYL23.799e-5524.70si:ch211-244b2.1 [Source:ZFIN;Acc:ZDB-GENE-041210-... [more]
si:ch211-197l9.53.929e-823.02si:ch211-197l9.5 [Source:ZFIN;Acc:ZDB-GENE-091204-... [more]
plk2b1.439e-724.13polo-like kinase 2b (Drosophila) [Source:ZFIN;Acc:... [more]
plk2b1.439e-724.13polo-like kinase 2b (Drosophila) [Source:ZFIN;Acc:... [more]
back to top
BLAST of Protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gatad2b1.032e-5926.57GATA zinc finger domain containing 2B [Source:Xenb... [more]
gatad2b2.484e-5626.62GATA zinc finger domain containing 2B [Source:Xenb... [more]
gatad2b1.009e-5526.61GATA zinc finger domain containing 2B [Source:Xenb... [more]
gatad2b1.445e-5526.61GATA zinc finger domain containing 2B [Source:Xenb... [more]
gatad2b1.934e-5526.61GATA zinc finger domain containing 2B [Source:Xenb... [more]
back to top
BLAST of Protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Scyl22.051e-5925.85SCY1-like 2 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Scyl22.146e-5925.85SCY1-like 2 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Scyl31.705e-1022.33SCY1-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Scyl31.705e-1022.33SCY1-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Plk53.966e-1024.69polo like kinase 5 [Source:MGI Symbol;Acc:MGI:3026... [more]
back to top
BLAST of Protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8CFE4|SCYL2_MOUSE1.501e-5825.85SCY1-like protein 2 OS=Mus musculus OX=10090 GN=Sc... [more]
sp|Q6P3W7|SCYL2_HUMAN4.744e-5825.85SCY1-like protein 2 OS=Homo sapiens OX=9606 GN=SCY... [more]
sp|Q9P7X5|PPK32_SCHPO3.123e-3123.94Protein kinase domain-containing protein ppk32 OS=... [more]
sp|Q55BQ3|SCY2_DICDI5.887e-2624.56Probable inactive serine/threonine-protein kinase ... [more]
sp|P53009|SCY1_YEAST8.382e-2026.21Protein kinase-like protein SCY1 OS=Saccharomyces ... [more]
back to top
BLAST of Protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LX642.181e-12835.26Protein kinase domain-containing protein OS=Opisth... [more]
A0A4S2LX665.316e-12835.52Protein kinase domain-containing protein OS=Opisth... [more]
A0A4S2LX679.666e-12835.52Protein kinase domain-containing protein OS=Opisth... [more]
A0A5K4EU337.260e-11433.10Protein kinase OS=Schistosoma mansoni OX=6183 PE=4... [more]
A0A5K4ET091.429e-11333.29Protein kinase OS=Schistosoma mansoni OX=6183 PE=4... [more]
back to top
BLAST of Protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-244b2.15.020e-5624.70SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:103... [more]
si:ch211-244b2.11.827e-5524.71SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:103... [more]
si:ch211-244b2.18.466e-5124.03SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:103... [more]
plk2b2.238e-1026.95serine/threonine-protein kinase PLK2 [Source:NCBI ... [more]
ENSAMXT00000054016.14.891e-923.55pep primary_assembly:Astyanax_mexicanus-2.0:3:2312... [more]
back to top
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003368.16.026e-6125.32pep scaffold:Pmarinus_7.0:GL479057:9948:36045:-1 g... [more]
ENSPMAT00000000175.12.154e-724.15pep scaffold:Pmarinus_7.0:GL476590:10927:25170:1 g... [more]
stk112.063e-624.78serine/threonine kinase 11 [Source:ZFIN;Acc:ZDB-GE... [more]
plk32.553e-623.60polo-like kinase 3 (Drosophila) [Source:ZFIN;Acc:Z... [more]
STK366.321e-621.56serine/threonine kinase 36 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SCY11.207e-2126.21Putative kinase; suppressor of GTPase mutant; simi... [more]
SWE11.150e-625.83Protein kinase that regulates the G2/M transition;... [more]
SNF12.257e-623.23AMP-activated S/T protein kinase; forms a complex ... [more]
PKH36.753e-627.46Protein kinase with similarity to mammalian PDK1 a... [more]
ISR17.893e-633.01Predicted protein kinase; overexpression causes se... [more]
back to top
BLAST of Protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO427443.229e-6226.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336521.358e-1022.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378274.325e-1023.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454392.496e-921.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480261.142e-828.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-244b2.12.003e-5625.04SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:101... [more]
si:ch211-244b2.17.806e-5625.04SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:101... [more]
plk2b3.485e-925.69polo like kinase 2 [Source:NCBI gene;Acc:101166557... [more]
plk2b3.586e-925.69polo like kinase 2 [Source:NCBI gene;Acc:101166557... [more]
plk2b6.650e-925.69polo like kinase 2 [Source:NCBI gene;Acc:101166557... [more]
back to top
BLAST of Protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012946.10.000e+099.53SMESG000012946.1[more]
SMESG000009222.13.126e-15638.73SMESG000009222.1[more]
SMESG000078112.12.188e-8028.57SMESG000078112.1[more]
SMESG000078112.13.050e-8028.57SMESG000078112.1[more]
SMESG000078112.18.740e-7628.81SMESG000078112.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019445 ID=SMED30019445|Name=Protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2742bp
GTAAATTTAATTTATATTTTTTACCAAACTAGAAAAACCTCTATATAATC
AAAATTTCCATCTTGAAAATAGATTATGCTGAAAATTTCTGTGCTTCGGG
ATTGTTTATAAAACTCAGATATTATAGTTTGTTTGAAGAGAATAAATAGT
AAAAAACTACTTGATCAAAGTACGTTTTCCCCAGCAAAAAGCGATGATAT
CTCGGATAACATCAATCAAAAGACATTCAGCAGCTCCTGAAATACCCATA
TCTATCAAACAATCTTTTATCATCGGTGAAATTATATCTTTTTGTGGAAA
TGAAAATGTTTGGAAAACATGCCAATGCACGAAAATCGACAGCGGACAAA
ATTGTTCAATACAAATTTACGAAAAGAGAACTATGGAAAAGATCTACAAA
TCAAAAAGAAAAGAATATGTTTCAGAAATTCTTCGCCGGGAGATTGAATG
CCTCCACGAATTCCGACATAACTACTTATTGCAACTGTTCACTTCAGTTC
ATGAAAACAATGACTATTTAATGTTCGTTTGCGAACCAATTATATGCTCT
CTTGCCAATCTTATTGACGAACGTGAAGTTCTACCGGAATCAACAGTCAA
CGATATCAAGACACGAAAACTGATGACATTGGAGATATTGCTTGGATTTT
ATCAAATGGTTGAAGCTTTAAGACATCTCCATGTGACAAATGGAATAATT
CATGGAAATTTGTGCCCAAGTAATATTCTCATTAGCACTCATAATCAGTG
GAAAGTAACTGGTCTCGGATTTTGTATAAAATTAGCTGAAAAAGGAAAAT
CCCACAACTACAGTTGGAATCCGAAACAAGTTAAATATGGACAACCAGAT
CTTAACTACATAGCACCAGAAATACAACTGAAAAATGTCCCAATGTTTCA
GTCAGATATATTTTCCTTAGGACTAATCATATGCTCAATTTACAATAATG
GTTGCTCCTTAATTGAATGCTCAAGAAACGTCTCTATATACACGAAGAAA
ATAGATGAAGTAAGATCAAATTTTTTGAAAATATATTCAAAATTGCCGAA
TTCAATCGGAGACACAGTTCAACAAATGTTGAGTAGGATACCGACAGAAA
GACCGGATATTGAAGAGCTGAGAGAAATGGATTGCTTCAAAGATTCACTA
ATACTCAGCCTGGACTCTCTGTTTTCTTTGGATGGCAAATCCATGAACGA
AAGAAAAGATTTTTTCAATTTATTTTCAAAGCTCGTTGCCGACTATTCAG
AAGATCTACGCTATCAAAGAATTTTGCCTCTTTTAATGGACTGGTTCAGA
TTTTCATCAAATTTAACAACATTTGTTTTACCAAGTATTTTGACCATGAT
TTACAAAGCATCCAAAGCAGATTTTGACAAACATCTTTATTACAATTTAC
AATATATCCTGAATACAGAGATAAGCAATCAAACTGCTTACGTTCTTTTG
GATTTGTTGGAATTCTATATCGATCGATTGGATCAACAGGAAATTTTATC
CAAAATTTTGCCATTATTTTTGAGAGTTTTAGAAGATCCTGGGAACTCAG
AATCTCAAACTTCAAGTAACGATTCATTATGGAATTGTTTGGTGATATTG
CAAAATATTCTCACCCCCCTTCAATTAAAAGAACAAATTTTATCGAAGCT
CAAAGTAATATTCAATAAAGAAAATCAAGTTCTTAAAGTACAGATTTTAT
GTTTGGAATGTCTTGATCAATTGCTGGAAGACCTAGATAATAAAATTATA
GTGGATGAAGTGATACCCTTTCTCACAACCGTCAATCACTCCAATACCTC
AATATATTTAGCAATATTAGGAATTTATAAGCACATGGTATCCACAAGGA
ACTGCGGAATTTCCTTTAAATTAATTGCTAAAAAGATTTTGCCTCCTTTG
ATTCCTCAAGCAGTCAATCCAGGGTTAAAAGCAGAAGAATTCATATTGGT
AATGCATGTGTTGAGGAAGCTTTTGGATAAAATTGAACGAGACAGGTGCT
GTCAACTTAATATAGAATCTGTAAGGAGTAATAGTGGCAGTTTATCAAGC
ATCGGATCAAATGTCAACTGCAATAGAGTTTTACCTCTTATTTCTATGCA
ACAGCCCACAATGGAAATTGATTATGGGTCCCAGAATTCTTTTAATAGTA
GGATGACCGGGTCAAGACGAGGCTCGAATGTAACAGATTATCGAAGAGGT
TCGACAGATAACACCCCGGGGTCAAGGCGGAATTCTGCACTGTTAAATCG
TTTGAAATTGAATAATTCAGAATCTCTTTTATTCCCCACAAGAAATCGTC
GAGGCTCCGCTTTTGATAATCGAAACTGGAGTAAAACAAACAGTAATCCG
GCATTTATTTCTCAACTGAGCGGGGAAAATTCAAGGGAAAATATCCAGCT
AAGCTCTAATTCAATGCAGTATAGGAGACTCTCTGGCAATACAAGTTCTT
ATCTTAATAAAGGTTTAGCTGTACCAAATAATCAGTTTCCCCGGCGCCAC
AGCTATGAATCATCACACAATGCTTCAATTAATTCATTAATTACAGCAAG
TGTTTGCGAAGGACCTTTTATTAGTCCCAGTAATTCCAGAGCACAATCCA
GAAGAACTTCCGCTCAAAGCTTAGGACCACAAATTATCCCAGGCAATAAT
TCAAGAAGGATGTCTTCAACTGGATCTCGTCGTCTAAGCTTTAATGCATT
TAGTGATACATTGATAAATTTATTCCAATAATTGGTGTTGCA
back to top

protein sequence of SMED30019445-orf-1

>SMED30019445-orf-1 ID=SMED30019445-orf-1|Name=SMED30019445-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=846bp
MISRITSIKRHSAAPEIPISIKQSFIIGEIISFCGNENVWKTCQCTKIDS
GQNCSIQIYEKRTMEKIYKSKRKEYVSEILRREIECLHEFRHNYLLQLFT
SVHENNDYLMFVCEPIICSLANLIDEREVLPESTVNDIKTRKLMTLEILL
GFYQMVEALRHLHVTNGIIHGNLCPSNILISTHNQWKVTGLGFCIKLAEK
GKSHNYSWNPKQVKYGQPDLNYIAPEIQLKNVPMFQSDIFSLGLIICSIY
NNGCSLIECSRNVSIYTKKIDEVRSNFLKIYSKLPNSIGDTVQQMLSRIP
TERPDIEELREMDCFKDSLILSLDSLFSLDGKSMNERKDFFNLFSKLVAD
YSEDLRYQRILPLLMDWFRFSSNLTTFVLPSILTMIYKASKADFDKHLYY
NLQYILNTEISNQTAYVLLDLLEFYIDRLDQQEILSKILPLFLRVLEDPG
NSESQTSSNDSLWNCLVILQNILTPLQLKEQILSKLKVIFNKENQVLKVQ
ILCLECLDQLLEDLDNKIIVDEVIPFLTTVNHSNTSIYLAILGIYKHMVS
TRNCGISFKLIAKKILPPLIPQAVNPGLKAEEFILVMHVLRKLLDKIERD
RCCQLNIESVRSNSGSLSSIGSNVNCNRVLPLISMQQPTMEIDYGSQNSF
NSRMTGSRRGSNVTDYRRGSTDNTPGSRRNSALLNRLKLNNSESLLFPTR
NRRGSAFDNRNWSKTNSNPAFISQLSGENSRENIQLSSNSMQYRRLSGNT
SSYLNKGLAVPNNQFPRRHSYESSHNASINSLITASVCEGPFISPSNSRA
QSRRTSAQSLGPQIIPGNNSRRMSSTGSRRLSFNAFSDTLINLFQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR011989ARM-like
IPR011009Kinase-like_dom_sf
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0005488binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 28..315
e-value: 4.3E-10
score: 9.7
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 64..313
e-value: 5.0E-25
score: 88.4
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 25..315
score: 21.206
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 132..339
e-value: 1.4E-26
score: 95.0
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 29..116
e-value: 3.0E-5
score: 26.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 795..828
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 649..680
NoneNo IPR availablePANTHERPTHR12984:SF16BLACK MATCH, ISOFORM Fcoord: 20..766
NoneNo IPR availablePANTHERPTHR12984SCY1-RELATED S/T PROTEIN KINASE-LIKEcoord: 20..766
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 24..318
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 329..571