SMED30019441
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30019441 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 4
Alignments
SMED30019441 aligns in the following genomic locations:
Homology
BLAST of SMED30019441 vs. Planmine SMEST
Match: SMESG000035049.1 (SMESG000035049.1) HSP 1 Score: 74.3294 bits (181), Expect = 3.034e-17 Identity = 31/54 (57.41%), Postives = 40/54 (74.07%), Query Frame = 3 Query: 177 FRTGLDWPISEYDSYIERILENPSRFYNKEHHKGITSIMTKLREEYVDVRWRNS 338 FR LDWP S D Y+E+ILENP +++N + HK I SIM KL+EEY D++WR S Sbjct: 122 FRAMLDWPASRMDQYVEKILENPIKYFNGDAHKKIHSIMCKLKEEYADIKWRGS 175
BLAST of SMED30019441 vs. Planmine SMEST
Match: SMESG000032608.1 (SMESG000032608.1) HSP 1 Score: 75.485 bits (184), Expect = 1.222e-16 Identity = 30/54 (55.56%), Postives = 39/54 (72.22%), Query Frame = 3 Query: 177 FRTGLDWPISEYDSYIERILENPSRFYNKEHHKGITSIMTKLREEYVDVRWRNS 338 FR LDWP S D Y+E+ILENP +++N + HK + SIM KL+EEY D +WR S Sbjct: 774 FRAMLDWPASRMDQYVEKILENPFKYFNGDAHKKMHSIMCKLKEEYADSKWRES 827
BLAST of SMED30019441 vs. Planmine SMEST
Match: SMESG000032574.1 (SMESG000032574.1) HSP 1 Score: 71.2478 bits (173), Expect = 5.236e-16 Identity = 30/54 (55.56%), Postives = 39/54 (72.22%), Query Frame = 3 Query: 177 FRTGLDWPISEYDSYIERILENPSRFYNKEHHKGITSIMTKLREEYVDVRWRNS 338 FR LDWP S D Y+E+ILENP +++N + HK + SIM KL+EEY D +WR S Sbjct: 122 FRAMLDWPASRMDQYVEKILENPFKYFNGDAHKKMHSIMCKLKEEYADSKWRES 175
BLAST of SMED30019441 vs. Planmine SMEST
Match: SMESG000015578.1 (SMESG000015578.1) HSP 1 Score: 70.0922 bits (170), Expect = 1.280e-15 Identity = 30/69 (43.48%), Postives = 46/69 (66.67%), Query Frame = 3 Query: 171 YYFRTGLDWPISEYDSYIERILENPSRFYNKEHHKGITSIMTKLREEYVDVRWRNSLRTENNKFADPPT 377 Y R L WP+S YD Y+E +L+NP+++YN + K + ++MT+L+E++ D +WR S R EN A PT Sbjct: 49 YRLRAELAWPVSTYDKYVENLLKNPTKYYNGKQQKEMLTMMTELKEKHFDEKWRRSHRMENQDNATGPT 117
BLAST of SMED30019441 vs. Planmine SMEST
Match: SMESG000045763.1 (SMESG000045763.1) HSP 1 Score: 67.0106 bits (162), Expect = 4.519e-14 Identity = 29/69 (42.03%), Postives = 44/69 (63.77%), Query Frame = 3 Query: 171 YYFRTGLDWPISEYDSYIERILENPSRFYNKEHHKGITSIMTKLREEYVDVRWRNSLRTENNKFADPPT 377 Y R L WP+S YD Y+E +L+NP+++YN + K + ++MT L+EE D +WR+S + EN PT Sbjct: 49 YRLRAELAWPVSTYDKYVENMLKNPTKYYNGKQQKEMLTMMTALKEEQFDEKWRSSHKLENQDNTTGPT 117 The following BLAST results are available for this feature:
BLAST of SMED30019441 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30019441 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30019441 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30019441 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30019441 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30019441 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30019441 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30019441 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 0
BLAST of SMED30019441 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30019441 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30019441 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30019441 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30019441 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30019441 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 5
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30019441 ID=SMED30019441|Name=SMED30019441|organism=Schmidtea mediterranea sexual|type=transcript|length=406bpback to top Annotated Terms
The following terms have been associated with this transcript:
|