SMED30019431

Overview
NameSMED30019431
Smed IDSMED30019431
Length (bp)1983
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30019431 (SMED30019431) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30019431 (SMED30019431) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30019431 (SMED30019431) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30019431 (SMED30019431) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019431

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30019431SMESG000032527.1 SMESG000022725.1 dd_Smed_v4_1563_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30019431SMESG000032527.1 SMESG000022725.1 dd_Smed_v4_1563_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019431SMESG000032527.1 SMESG000022725.1 dd_Smed_v4_1563_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30019431SMESG000032527.1 SMESG000022725.1 dd_Smed_v4_1563_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30019431SMESG000026144.1 dd_Smed_v4_9738_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30019431SMESG000032527.1 SMESG000022725.1 dd_Smed_v6_1563_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30019431SMESG000032527.1 SMESG000022725.1 dd_Smed_v6_1563_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019431SMESG000032527.1 SMESG000022725.1 dd_Smed_v4_1563_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30019431 vs. Ensembl Human
Match: DBP (D-box binding PAR bZIP transcription factor [Source:HGNC Symbol;Acc:HGNC:2697])

HSP 1 Score: 59.3066 bits (142), Expect = 4.340e-10
Identity = 30/68 (44.12%), Postives = 45/68 (66.18%), Query Frame = 1
Query: 1078 TPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
             P+E K E+YW +R KNNEAAKRSR+ARR KE  ++     L+ EN  +R+E+  V+ ++   + +LS
Sbjct:   47 VPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLS 114          
BLAST of SMED30019431 vs. Ensembl Human
Match: DBP (D-box binding PAR bZIP transcription factor [Source:HGNC Symbol;Acc:HGNC:2697])

HSP 1 Score: 59.3066 bits (142), Expect = 4.340e-10
Identity = 30/68 (44.12%), Postives = 45/68 (66.18%), Query Frame = 1
Query: 1078 TPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
             P+E K E+YW +R KNNEAAKRSR+ARR KE  ++     L+ EN  +R+E+  V+ ++   + +LS
Sbjct:   47 VPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLS 114          
BLAST of SMED30019431 vs. Ensembl Human
Match: DBP (D-box binding PAR bZIP transcription factor [Source:HGNC Symbol;Acc:HGNC:2697])

HSP 1 Score: 60.8474 bits (146), Expect = 2.464e-9
Identity = 30/68 (44.12%), Postives = 45/68 (66.18%), Query Frame = 1
Query: 1078 TPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
             P+E K E+YW +R KNNEAAKRSR+ARR KE  ++     L+ EN  +R+E+  V+ ++   + +LS
Sbjct:  249 VPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLS 316          
BLAST of SMED30019431 vs. Ensembl Human
Match: HLF (HLF transcription factor, PAR bZIP family member [Source:HGNC Symbol;Acc:HGNC:4977])

HSP 1 Score: 59.3066 bits (142), Expect = 2.664e-9
Identity = 38/100 (38.00%), Postives = 54/100 (54.00%), Query Frame = 1
Query:  982 EMLEKIKLKFGHIFENCNTTISNPRMVRHPDMTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
            EM +  K KF          I   R V  PD    +LK ++YW +RRKNN AAKRSR+ARR KE  +      L+ EN  +R+E+  ++ ++   K IL+
Sbjct:  106 EMFDPRKRKFSEEELKPQPMIKKARKVFIPD----DLKDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILA 201          
BLAST of SMED30019431 vs. Ensembl Human
Match: HLF (HLF transcription factor, PAR bZIP family member [Source:HGNC Symbol;Acc:HGNC:4977])

HSP 1 Score: 59.3066 bits (142), Expect = 2.664e-9
Identity = 38/100 (38.00%), Postives = 54/100 (54.00%), Query Frame = 1
Query:  982 EMLEKIKLKFGHIFENCNTTISNPRMVRHPDMTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
            EM +  K KF          I   R V  PD    +LK ++YW +RRKNN AAKRSR+ARR KE  +      L+ EN  +R+E+  ++ ++   K IL+
Sbjct:  106 EMFDPRKRKFSEEELKPQPMIKKARKVFIPD----DLKDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILA 201          
BLAST of SMED30019431 vs. Ensembl Celegans
Match: ces-2 (Cell death specification protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q94126])

HSP 1 Score: 60.077 bits (144), Expect = 5.807e-10
Identity = 28/66 (42.42%), Postives = 47/66 (71.21%), Query Frame = 1
Query: 1081 PKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKIL 1278
            P+E K   Y+E+RRKNN+AAKRSR+ARRQKEE + +    L+ EN ++R ++ +++ +   ++ +L
Sbjct:  111 PEEKKDSAYFERRRKNNDAAKRSRDARRQKEEQIASKAHALERENMQLRGKVSSLEQEAAQLRFLL 176          
BLAST of SMED30019431 vs. Ensembl Celegans
Match: atf-8 (ATF (cAMP-dependent transcription factor) family [Source:UniProtKB/TrEMBL;Acc:O16213])

HSP 1 Score: 54.299 bits (129), Expect = 6.090e-8
Identity = 26/75 (34.67%), Postives = 48/75 (64.00%), Query Frame = 1
Query: 1087 ELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS*S*ITAPSDT 1311
            ++K   YWE+RRKNN+AAKRSR+ RR KE+ + +    L+ EN  +R E++ ++ +   ++ ++    +T P+ +
Sbjct:  113 QVKDVAYWERRRKNNDAAKRSRDQRRMKEDEMAHRATSLERENMLLRVELDQLRAETDKLRALI----LTTPTTS 183          
BLAST of SMED30019431 vs. Ensembl Celegans
Match: atf-2 (ATF (cAMP-dependent transcription factor) family [Source:UniProtKB/TrEMBL;Acc:Q21361])

HSP 1 Score: 51.6026 bits (122), Expect = 1.136e-6
Identity = 26/63 (41.27%), Postives = 41/63 (65.08%), Query Frame = 1
Query: 1093 KTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
            K+ +Y ++RR+NNEAAKR R  RR   E  +   + L+ EN+ +R +IET+K +I   K +L+
Sbjct:  328 KSPQYVDRRRRNNEAAKRCRANRRAVFEYRSRRVQLLEGENEDLRTQIETLKAEIAHFKSVLA 390          

HSP 2 Score: 49.6766 bits (117), Expect = 4.285e-6
Identity = 21/54 (38.89%), Postives = 36/54 (66.67%), Query Frame = 1
Query: 1090 LKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKL 1251
            +K E YWE+RR+NN+A++RSRE RRQ +  +      L  EN++++ ++ T  +
Sbjct:   52 IKDEHYWERRRRNNDASRRSREKRRQNDLAMEEKIMLLSAENERLKSQLGTTPI 105          
BLAST of SMED30019431 vs. Ensembl Fly
Match: Pdp1 (gene:FBgn0016694 transcript:FBtr0332081)

HSP 1 Score: 63.1586 bits (152), Expect = 1.350e-10
Identity = 32/69 (46.38%), Postives = 45/69 (65.22%), Query Frame = 1
Query: 1075 MTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
              P ELK ++YW +RRKNN AAKRSR+ARRQKE  +      L+ EN  + +E+E +K +  D++  LS
Sbjct:  202 FVPDELKDDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQLKQENMDLRARLS 270          
BLAST of SMED30019431 vs. Ensembl Fly
Match: Pdp1 (gene:FBgn0016694 transcript:FBtr0076775)

HSP 1 Score: 62.7734 bits (151), Expect = 1.353e-10
Identity = 32/69 (46.38%), Postives = 45/69 (65.22%), Query Frame = 1
Query: 1075 MTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
              P ELK ++YW +RRKNN AAKRSR+ARRQKE  +      L+ EN  + +E+E +K +  D++  LS
Sbjct:  177 FVPDELKDDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQLKQENMDLRARLS 245          
BLAST of SMED30019431 vs. Ensembl Fly
Match: Pdp1 (gene:FBgn0016694 transcript:FBtr0076776)

HSP 1 Score: 63.1586 bits (152), Expect = 1.363e-10
Identity = 32/69 (46.38%), Postives = 45/69 (65.22%), Query Frame = 1
Query: 1075 MTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
              P ELK ++YW +RRKNN AAKRSR+ARRQKE  +      L+ EN  + +E+E +K +  D++  LS
Sbjct:  197 FVPDELKDDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQLKQENMDLRARLS 265          
BLAST of SMED30019431 vs. Ensembl Fly
Match: Pdp1 (gene:FBgn0016694 transcript:FBtr0346536)

HSP 1 Score: 63.1586 bits (152), Expect = 1.363e-10
Identity = 32/69 (46.38%), Postives = 45/69 (65.22%), Query Frame = 1
Query: 1075 MTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
              P ELK ++YW +RRKNN AAKRSR+ARRQKE  +      L+ EN  + +E+E +K +  D++  LS
Sbjct:  197 FVPDELKDDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQLKQENMDLRARLS 265          
BLAST of SMED30019431 vs. Ensembl Fly
Match: Pdp1 (gene:FBgn0016694 transcript:FBtr0306535)

HSP 1 Score: 63.1586 bits (152), Expect = 1.363e-10
Identity = 32/69 (46.38%), Postives = 45/69 (65.22%), Query Frame = 1
Query: 1075 MTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
              P ELK ++YW +RRKNN AAKRSR+ARRQKE  +      L+ EN  + +E+E +K +  D++  LS
Sbjct:  197 FVPDELKDDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQLKQENMDLRARLS 265          
BLAST of SMED30019431 vs. Ensembl Zebrafish
Match: dbpb (D site albumin promoter binding protein b [Source:ZFIN;Acc:ZDB-GENE-100922-6])

HSP 1 Score: 60.8474 bits (146), Expect = 2.447e-9
Identity = 29/68 (42.65%), Postives = 46/68 (67.65%), Query Frame = 1
Query: 1075 MTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKIL 1278
            + P++LK E+YW +R KNNEAAKRSR+ARR KE  ++     L+ EN  +R+E+  ++ ++   + IL
Sbjct:  297 LVPEDLKDEKYWSRRCKNNEAAKRSRDARRLKENQISVRAAFLERENAALRQEVADMRKELGRCRNIL 364          
BLAST of SMED30019431 vs. Ensembl Zebrafish
Match: dbpb (D site albumin promoter binding protein b [Source:ZFIN;Acc:ZDB-GENE-100922-6])

HSP 1 Score: 60.4622 bits (145), Expect = 2.502e-9
Identity = 29/68 (42.65%), Postives = 46/68 (67.65%), Query Frame = 1
Query: 1075 MTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKIL 1278
            + P++LK E+YW +R KNNEAAKRSR+ARR KE  ++     L+ EN  +R+E+  ++ ++   + IL
Sbjct:  296 LVPEDLKDEKYWSRRCKNNEAAKRSRDARRLKENQISVRAAFLERENAALRQEVADMRKELGRCRNIL 363          
BLAST of SMED30019431 vs. Ensembl Zebrafish
Match: dbpb (D site albumin promoter binding protein b [Source:ZFIN;Acc:ZDB-GENE-100922-6])

HSP 1 Score: 60.4622 bits (145), Expect = 2.592e-9
Identity = 29/68 (42.65%), Postives = 46/68 (67.65%), Query Frame = 1
Query: 1075 MTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKIL 1278
            + P++LK E+YW +R KNNEAAKRSR+ARR KE  ++     L+ EN  +R+E+  ++ ++   + IL
Sbjct:  296 LVPEDLKDEKYWSRRCKNNEAAKRSRDARRLKENQISVRAAFLERENAALRQEVADMRKELGRCRNIL 363          
BLAST of SMED30019431 vs. Ensembl Zebrafish
Match: hlfb (HLF transcription factor, PAR bZIP family member b [Source:ZFIN;Acc:ZDB-GENE-110420-3])

HSP 1 Score: 58.5362 bits (140), Expect = 8.750e-9
Identity = 30/67 (44.78%), Postives = 44/67 (65.67%), Query Frame = 1
Query: 1081 PKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
            P +LK E+YW +RRKNN AAKRSR+ARR KE  +      L+ EN  +R+E+  ++ ++   K IL+
Sbjct:  224 PDDLKDEKYWARRRKNNVAAKRSRDARRLKENQIAIRAGFLEKENMALRQEVADLRKELGRCKNILT 290          
BLAST of SMED30019431 vs. Ensembl Zebrafish
Match: si:dkey-60d5.3 (si:dkey-60d5.3 [Source:ZFIN;Acc:ZDB-GENE-131127-467])

HSP 1 Score: 57.3806 bits (137), Expect = 1.689e-8
Identity = 30/70 (42.86%), Postives = 42/70 (60.00%), Query Frame = 1
Query: 1036 TTISNPRMVRHPDMTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETV 1245
            T ++N    R  + TP ELK   YW KR +NNEAAK+SR+ +R +E  L     +LQ ENDK++  +  V
Sbjct:   30 TRLANTGTRRKREFTPDELKDSNYWLKRNRNNEAAKKSRQRKRMEEHLLETRAVELQRENDKLKAALSAV 99          
BLAST of SMED30019431 vs. Ensembl Xenopus
Match: mbd2 (methyl-CpG binding domain protein 2 [Source:Xenbase;Acc:XB-GENE-493776])

HSP 1 Score: 59.6918 bits (143), Expect = 2.517e-10
Identity = 31/68 (45.59%), Postives = 45/68 (66.18%), Query Frame = 1
Query: 1078 TPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
             P+E K E+YW +R KNNEAAKRSR+ARR KE  +T     L+ EN  +R+E+  ++ ++   + ILS
Sbjct:   43 VPEEQKDEKYWNRRYKNNEAAKRSRDARRLKENQITVRAAFLEKENSVLRQEVAKIRQELSRYRNILS 110          
BLAST of SMED30019431 vs. Ensembl Xenopus
Match: mbd2 (methyl-CpG binding domain protein 2 [Source:Xenbase;Acc:XB-GENE-493776])

HSP 1 Score: 61.2326 bits (147), Expect = 1.570e-9
Identity = 31/68 (45.59%), Postives = 45/68 (66.18%), Query Frame = 1
Query: 1078 TPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
             P+E K E+YW +R KNNEAAKRSR+ARR KE  +T     L+ EN  +R+E+  ++ ++   + ILS
Sbjct:  235 VPEEQKDEKYWNRRYKNNEAAKRSRDARRLKENQITVRAAFLEKENSVLRQEVAKIRQELSRYRNILS 302          
BLAST of SMED30019431 vs. Ensembl Xenopus
Match: mga (MGA, MAX dimerization protein [Source:Xenbase;Acc:XB-GENE-492360])

HSP 1 Score: 59.3066 bits (142), Expect = 5.535e-9
Identity = 29/68 (42.65%), Postives = 44/68 (64.71%), Query Frame = 1
Query: 1078 TPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
             P++LK E+YW +R KNN AAKRSR+ARR KE  +T     L+ EN  +R E+  ++ ++   + I+S
Sbjct:  214 VPEDLKDEKYWTRRNKNNVAAKRSRDARRLKENQITVRAAFLEKENSALRSEVADLRKELSKCRNIIS 281          
BLAST of SMED30019431 vs. Ensembl Xenopus
Match: mga (MGA, MAX dimerization protein [Source:Xenbase;Acc:XB-GENE-492360])

HSP 1 Score: 58.9214 bits (141), Expect = 6.753e-9
Identity = 29/68 (42.65%), Postives = 44/68 (64.71%), Query Frame = 1
Query: 1078 TPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
             P++LK E+YW +R KNN AAKRSR+ARR KE  +T     L+ EN  +R E+  ++ ++   + I+S
Sbjct:  203 VPEDLKDEKYWTRRNKNNVAAKRSRDARRLKENQITVRAAFLEKENSALRSEVADLRKELSKCRNIIS 270          
BLAST of SMED30019431 vs. Ensembl Xenopus
Match: chm (choroideremia (Rab escort protein 1) [Source:Xenbase;Acc:XB-GENE-956389])

HSP 1 Score: 55.0694 bits (131), Expect = 2.001e-7
Identity = 28/66 (42.42%), Postives = 40/66 (60.61%), Query Frame = 1
Query: 1072 DMTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIK 1269
            + TP E K + YW+KRRKNNEAAKRSRE RR  +  L      L  EN ++R E+  ++ +   ++
Sbjct:   80 EFTPDEKKDDCYWDKRRKNNEAAKRSREKRRAGDLALEGRVIALLEENARLRAELLALRFRFGLVR 145          
BLAST of SMED30019431 vs. Ensembl Mouse
Match: Dbp (D site albumin promoter binding protein [Source:MGI Symbol;Acc:MGI:94866])

HSP 1 Score: 59.6918 bits (143), Expect = 9.126e-10
Identity = 30/68 (44.12%), Postives = 45/68 (66.18%), Query Frame = 1
Query: 1078 TPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
             P+E K E+YW +R KNNEAAKRSR+ARR KE  ++     L+ EN  +R+E+  V+ ++   + +LS
Sbjct:  112 VPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLS 179          
BLAST of SMED30019431 vs. Ensembl Mouse
Match: Dbp (D site albumin promoter binding protein [Source:MGI Symbol;Acc:MGI:94866])

HSP 1 Score: 59.6918 bits (143), Expect = 1.374e-9
Identity = 30/68 (44.12%), Postives = 45/68 (66.18%), Query Frame = 1
Query: 1078 TPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
             P+E K E+YW +R KNNEAAKRSR+ARR KE  ++     L+ EN  +R+E+  V+ ++   + +LS
Sbjct:  149 VPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLS 216          
BLAST of SMED30019431 vs. Ensembl Mouse
Match: Dbp (D site albumin promoter binding protein [Source:MGI Symbol;Acc:MGI:94866])

HSP 1 Score: 60.8474 bits (146), Expect = 2.007e-9
Identity = 30/68 (44.12%), Postives = 45/68 (66.18%), Query Frame = 1
Query: 1078 TPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
             P+E K E+YW +R KNNEAAKRSR+ARR KE  ++     L+ EN  +R+E+  V+ ++   + +LS
Sbjct:  249 VPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLS 316          
BLAST of SMED30019431 vs. Ensembl Mouse
Match: Hlf (hepatic leukemia factor [Source:MGI Symbol;Acc:MGI:96108])

HSP 1 Score: 59.6918 bits (143), Expect = 3.729e-9
Identity = 38/100 (38.00%), Postives = 54/100 (54.00%), Query Frame = 1
Query:  982 EMLEKIKLKFGHIFENCNTTISNPRMVRHPDMTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
            EM +  K KF          I   R V  PD    +LK ++YW +RRKNN AAKRSR+ARR KE  +      L+ EN  +R+E+  ++ ++   K IL+
Sbjct:  191 EMFDPRKRKFSEEELKPQPMIKKARKVFIPD----DLKDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILA 286          
BLAST of SMED30019431 vs. Ensembl Mouse
Match: Tef (thyrotroph embryonic factor [Source:MGI Symbol;Acc:MGI:98663])

HSP 1 Score: 58.5362 bits (140), Expect = 8.072e-9
Identity = 30/69 (43.48%), Postives = 43/69 (62.32%), Query Frame = 1
Query: 1075 MTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
              P E K E+YW +R+KNN AAKRSR+ARR KE  +T     L+ EN  +R E+  ++ ++   K I+S
Sbjct:  224 FVPDEQKDEKYWTRRKKNNVAAKRSRDARRLKENQITIRAAFLEKENTALRTEVAELRKEVGKCKTIVS 292          
BLAST of SMED30019431 vs. UniProt/SwissProt
Match: sp|Q94126|CES2_CAEEL (Cell death specification protein 2 OS=Caenorhabditis elegans OX=6239 GN=ces-2 PE=1 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 7.386e-9
Identity = 28/66 (42.42%), Postives = 47/66 (71.21%), Query Frame = 1
Query: 1081 PKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKIL 1278
            P+E K   Y+E+RRKNN+AAKRSR+ARRQKEE + +    L+ EN ++R ++ +++ +   ++ +L
Sbjct:  111 PEEKKDSAYFERRRKNNDAAKRSRDARRQKEEQIASKAHALERENMQLRGKVSSLEQEAAQLRFLL 176          
BLAST of SMED30019431 vs. UniProt/SwissProt
Match: sp|Q10586|DBP_HUMAN (D site-binding protein OS=Homo sapiens OX=9606 GN=DBP PE=1 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 1.183e-8
Identity = 30/68 (44.12%), Postives = 45/68 (66.18%), Query Frame = 1
Query: 1078 TPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
             P+E K E+YW +R KNNEAAKRSR+ARR KE  ++     L+ EN  +R+E+  V+ ++   + +LS
Sbjct:  249 VPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLS 316          
BLAST of SMED30019431 vs. UniProt/SwissProt
Match: sp|Q32PF6|DBP_BOVIN (D site-binding protein OS=Bos taurus OX=9913 GN=DBP PE=2 SV=2)

HSP 1 Score: 60.8474 bits (146), Expect = 1.283e-8
Identity = 30/68 (44.12%), Postives = 45/68 (66.18%), Query Frame = 1
Query: 1078 TPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
             P+E K E+YW +R KNNEAAKRSR+ARR KE  ++     L+ EN  +R+E+  V+ ++   + +LS
Sbjct:  249 VPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLS 316          
BLAST of SMED30019431 vs. UniProt/SwissProt
Match: sp|P16443|DBP_RAT (D site-binding protein OS=Rattus norvegicus OX=10116 GN=Dbp PE=1 SV=2)

HSP 1 Score: 60.8474 bits (146), Expect = 1.391e-8
Identity = 30/68 (44.12%), Postives = 45/68 (66.18%), Query Frame = 1
Query: 1078 TPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
             P+E K E+YW +R KNNEAAKRSR+ARR KE  ++     L+ EN  +R+E+  V+ ++   + +LS
Sbjct:  249 VPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLS 316          
BLAST of SMED30019431 vs. UniProt/SwissProt
Match: sp|Q60925|DBP_MOUSE (D site-binding protein OS=Mus musculus OX=10090 GN=Dbp PE=1 SV=2)

HSP 1 Score: 60.8474 bits (146), Expect = 1.404e-8
Identity = 30/68 (44.12%), Postives = 45/68 (66.18%), Query Frame = 1
Query: 1078 TPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
             P+E K E+YW +R KNNEAAKRSR+ARR KE  ++     L+ EN  +R+E+  V+ ++   + +LS
Sbjct:  249 VPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLS 316          
BLAST of SMED30019431 vs. TrEMBL
Match: A0A0N4V3E6 (BZIP domain-containing protein OS=Enterobius vermicularis OX=51028 GN=EVEC_LOCUS4278 PE=4 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.713e-10
Identity = 35/75 (46.67%), Postives = 49/75 (65.33%), Query Frame = 1
Query: 1057 MVRHPDMTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
            M + P   P ELK E Y E+R KNNE+A+RSRE RRQKEE     C+ L  EN+ +R E+  ++ Q+  +K++LS
Sbjct:   98 MKKKPTPVPDELKDEAYRERRMKNNESARRSREMRRQKEESTQRRCDQLMHENNLLRAELSLLRSQVDHLKQVLS 172          
BLAST of SMED30019431 vs. TrEMBL
Match: A0A0N4V5J4 (BZIP domain-containing protein OS=Enterobius vermicularis OX=51028 GN=EVEC_LOCUS5117 PE=4 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 4.738e-10
Identity = 35/72 (48.61%), Postives = 50/72 (69.44%), Query Frame = 1
Query: 1063 RHPDMTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKIL 1278
            RH    P+E K E Y+E+RRKNN+AAKRSR+ARRQKEE +      L+ EN ++R +IE +K +I  ++ +L
Sbjct:  105 RHAAPVPQEKKDEAYYERRRKNNDAAKRSRDARRQKEELIAAKAAFLEQENIRLRSQIELLKNEIAALRVML 176          
BLAST of SMED30019431 vs. TrEMBL
Match: A0A0N5A9E1 (BZIP domain-containing protein OS=Syphacia muris OX=451379 PE=4 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.629e-9
Identity = 35/71 (49.30%), Postives = 45/71 (63.38%), Query Frame = 1
Query: 1069 PDMTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
            P   P ELK E Y E+R KNNE+A+RSRE RRQKEE     C+ L  EN  +R E+  ++ QI+ +K  LS
Sbjct:   47 PTPVPDELKDEAYRERRLKNNESARRSREMRRQKEESTQRRCDQLLHENSILRTELSLLRNQIEQMKHALS 117          
BLAST of SMED30019431 vs. TrEMBL
Match: A0A3S5AZC2 (BZIP domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS2301 PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.886e-9
Identity = 40/74 (54.05%), Postives = 55/74 (74.32%), Query Frame = 1
Query: 1036 TTISNPRMVRHPDMTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQI 1257
             T SNPRM RHP+MTP+ELK  EYWEKR +NNEAA+RSR+ARR KE  L  + + L+ EN+ +R ++  +K ++
Sbjct:  589 ATYSNPRMKRHPNMTPQELKNAEYWEKRLRNNEAARRSRQARRSKESQLAKYADQLECENEALRDQVAALKAEV 662          
BLAST of SMED30019431 vs. TrEMBL
Match: A0A074ZHV3 (BZIP domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_05999 PE=4 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.110e-9
Identity = 46/101 (45.54%), Postives = 66/101 (65.35%), Query Frame = 1
Query:  967 DDLSDEMLEKIKLKFGHIFENCNTTISNPRMVRHPDMTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIK 1269
            D L D++  K+   F  + E  ++++ NPRM R P+MTP+E+K E YWEKR KNNEAA+RSR AR+ KE  L  + E L+  N K+  EIE +K ++  +K
Sbjct:  294 DSLKDDV--KLVKTFKVVHEKADSSVCNPRMRRFPEMTPREVKDETYWEKRVKNNEAARRSRRARKTKETKLREYAEKLEKTNAKLLGEIEILKSEVCRLK 392          
BLAST of SMED30019431 vs. Ensembl Cavefish
Match: dbpb (hepatic leukemia factor [Source:NCBI gene;Acc:103029963])

HSP 1 Score: 60.8474 bits (146), Expect = 1.826e-9
Identity = 28/69 (40.58%), Postives = 45/69 (65.22%), Query Frame = 1
Query: 1075 MTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
            + P  +K ++YW +R KNNEAAKRSR+ARR KE  ++     L+ EN  +R+E+  ++ ++   + ILS
Sbjct:  283 LVPDNMKDDKYWSRRSKNNEAAKRSRDARRLKENQISVRAAFLERENASLRQEVADIRKELGRCRNILS 351          
BLAST of SMED30019431 vs. Ensembl Cavefish
Match: nfil3-4 (nuclear factor, interleukin 3 regulated, member 4 [Source:ZFIN;Acc:ZDB-GENE-070424-214])

HSP 1 Score: 58.9214 bits (141), Expect = 3.163e-9
Identity = 31/61 (50.82%), Postives = 38/61 (62.30%), Query Frame = 1
Query: 1072 DMTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQ 1254
            + TP+E K   YWEKRRKNNEAAKRSRE RR  +  L      L  EN  +R E+  +KL+
Sbjct:   31 EFTPEEKKDTSYWEKRRKNNEAAKRSREKRRANDYMLETRLVALSEENAALRSELLALKLR 91          
BLAST of SMED30019431 vs. Ensembl Cavefish
Match: hlfa (hepatic leukemia factor-like [Source:NCBI gene;Acc:103025365])

HSP 1 Score: 58.151 bits (139), Expect = 9.043e-9
Identity = 28/67 (41.79%), Postives = 44/67 (65.67%), Query Frame = 1
Query: 1081 PKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
            P+++K ++YW +RRKNN AAKRSR+ARR KE  +      L+ EN  +R+E+  ++ ++   K IL 
Sbjct:  218 PEDMKDDKYWARRRKNNVAAKRSRDARRLKENQIAIRAAFLEKENAALRQEVADLRKELGRCKNILG 284          
BLAST of SMED30019431 vs. Ensembl Cavefish
Match: dbpa (thyrotroph embryonic factor-like [Source:NCBI gene;Acc:103025119])

HSP 1 Score: 57.3806 bits (137), Expect = 1.990e-8
Identity = 28/68 (41.18%), Postives = 44/68 (64.71%), Query Frame = 1
Query: 1075 MTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKIL 1278
            + P E K E+YW +R KNNEAAKRSR+ARR KE  ++     L+ EN  +R+E+  ++ ++   + I+
Sbjct:  287 LVPDEQKDEKYWSRRVKNNEAAKRSRDARRLKENQISVRASFLERENAALRQEVADMRKELGRCRNII 354          
BLAST of SMED30019431 vs. Ensembl Cavefish
Match: tefa (thyrotroph embryonic factor [Source:NCBI gene;Acc:103028774])

HSP 1 Score: 56.6102 bits (135), Expect = 2.394e-8
Identity = 30/69 (43.48%), Postives = 43/69 (62.32%), Query Frame = 1
Query: 1075 MTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
              P+E K E+YW++R+KNN AAKRSR+ARR KE  +T     L+ EN  +R+E+  ++      K  LS
Sbjct:  213 FVPEEQKDEKYWQRRKKNNIAAKRSRDARRLKENQITVRAAFLERENTALRQEVSELRKDFGRCKTTLS 281          
BLAST of SMED30019431 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004452.1 (pep scaffold:Pmarinus_7.0:GL482388:4981:7461:-1 gene:ENSPMAG00000004057.1 transcript:ENSPMAT00000004452.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 4.651e-9
Identity = 29/64 (45.31%), Postives = 40/64 (62.50%), Query Frame = 1
Query: 1063 RHPDMTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQ 1254
            R  + TP E K   YW+KRRKNNEAAKRSRE RR  +  L      L  EN +++ E+ +++L+
Sbjct:   27 RKREFTPSEKKDASYWDKRRKNNEAAKRSREKRRLNDLVLETRVLGLLDENARLKTELISLRLR 90          
BLAST of SMED30019431 vs. Ensembl Nematostella
Match: EDO49642 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFQ5])

HSP 1 Score: 56.6102 bits (135), Expect = 1.291e-10
Identity = 27/58 (46.55%), Postives = 41/58 (70.69%), Query Frame = 1
Query: 1063 RHPDMTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEI 1236
            R     P E+K ++YWE+R KNN AAKRSR+ +RQKE  +    ++L++EN+K+R E+
Sbjct:    2 RQRTSVPGEMKDQKYWERRLKNNVAAKRSRDLKRQKEMTVAKRAQNLEIENEKLRNEV 59          
BLAST of SMED30019431 vs. Ensembl Nematostella
Match: EDO47009 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN55])

HSP 1 Score: 49.2914 bits (116), Expect = 1.282e-7
Identity = 27/69 (39.13%), Postives = 46/69 (66.67%), Query Frame = 1
Query: 1075 MTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
              P + K + YW +R KNN AA+RSR+ RRQKE  ++   + L+ EN ++R+E++ +K +  +++K LS
Sbjct:   17 FVPDQEKDDRYWARRVKNNVAARRSRDMRRQKEIEISMKWKQLEKENARLREELQQLKDRASELEKKLS 85          
BLAST of SMED30019431 vs. Ensembl Nematostella
Match: EDO27663 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8M2])

HSP 1 Score: 48.9062 bits (115), Expect = 1.898e-7
Identity = 27/69 (39.13%), Postives = 46/69 (66.67%), Query Frame = 1
Query: 1075 MTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
              P + K + YW +R KNN AA+RSR+ RRQKE  ++   + L+ EN ++R+E++ +K +  +++K LS
Sbjct:   23 FVPDQEKDDRYWARRVKNNVAARRSRDMRRQKEIEISMKWKQLEKENARLREELQQLKDRASELEKKLS 91          
BLAST of SMED30019431 vs. Ensembl Nematostella
Match: EDO48945 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHZ9])

HSP 1 Score: 50.0618 bits (118), Expect = 1.963e-6
Identity = 28/64 (43.75%), Postives = 42/64 (65.62%), Query Frame = 1
Query: 1087 ELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKIL 1278
            ++KTE+Y EKRRKNN +AKRSREAR+ +E         LQ EN K+R  +  +K +   +++I+
Sbjct:  285 DVKTEQYREKRRKNNASAKRSREARKMREIHAQTAAAYLQDENAKLRALVNVLKEENVYLREIM 348          
BLAST of SMED30019431 vs. Ensembl Medaka
Match: dbpb (hepatic leukemia factor [Source:NCBI gene;Acc:101163688])

HSP 1 Score: 60.8474 bits (146), Expect = 1.963e-9
Identity = 29/69 (42.03%), Postives = 45/69 (65.22%), Query Frame = 1
Query: 1075 MTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
            + P  +K E+YW +R KNNEAAKRSR+ARR KE  ++     L+ EN  +R+E+  ++ ++   + ILS
Sbjct:  298 LVPDNMKDEKYWSRRHKNNEAAKRSRDARRLKENQISVRAAYLERENAALRQEVAEMRKELGRCRNILS 366          
BLAST of SMED30019431 vs. Ensembl Medaka
Match: dbpa (thyrotroph embryonic factor [Source:NCBI gene;Acc:101159928])

HSP 1 Score: 57.7658 bits (138), Expect = 2.097e-8
Identity = 28/68 (41.18%), Postives = 44/68 (64.71%), Query Frame = 1
Query: 1075 MTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKIL 1278
            + P E K E+YW +R KNNEAAKRSR+ARR KE  ++     L+ EN  +R+E+  ++ ++   + I+
Sbjct:  307 LVPDEQKDEKYWSRRVKNNEAAKRSRDARRLKENQISVRAAFLERENAALRQEVADMRKELGRCRNII 374          
BLAST of SMED30019431 vs. Ensembl Medaka
Match: dbpa (thyrotroph embryonic factor [Source:NCBI gene;Acc:101159928])

HSP 1 Score: 57.3806 bits (137), Expect = 2.104e-8
Identity = 28/68 (41.18%), Postives = 44/68 (64.71%), Query Frame = 1
Query: 1075 MTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKIL 1278
            + P E K E+YW +R KNNEAAKRSR+ARR KE  ++     L+ EN  +R+E+  ++ ++   + I+
Sbjct:  307 LVPDEQKDEKYWSRRVKNNEAAKRSRDARRLKENQISVRAAFLERENAALRQEVADMRKELGRCRNII 374          
BLAST of SMED30019431 vs. Ensembl Medaka
Match: hlfa (HLF transcription factor, PAR bZIP family member [Source:NCBI gene;Acc:101160073])

HSP 1 Score: 56.9954 bits (136), Expect = 2.147e-8
Identity = 37/100 (37.00%), Postives = 53/100 (53.00%), Query Frame = 1
Query:  982 EMLEKIKLKFGHIFENCNTTISNPRMVRHPDMTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
            EM +  K KF          I   R V  PD    ++K ++YW +RRKNN AAKRSR+ARR KE  +      L+ EN  +R E+  ++ ++   K IL+
Sbjct:  213 EMFDPRKRKFSAEELKPQPMIKKARKVFIPD----DMKDDKYWARRRKNNVAAKRSRDARRLKENQIAIRAGFLEKENAALRMEVADLRKELGRCKNILA 308          
BLAST of SMED30019431 vs. Ensembl Medaka
Match: hlfa (HLF transcription factor, PAR bZIP family member [Source:NCBI gene;Acc:101160073])

HSP 1 Score: 56.6102 bits (135), Expect = 2.426e-8
Identity = 37/100 (37.00%), Postives = 53/100 (53.00%), Query Frame = 1
Query:  982 EMLEKIKLKFGHIFENCNTTISNPRMVRHPDMTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
            EM +  K KF          I   R V  PD    ++K ++YW +RRKNN AAKRSR+ARR KE  +      L+ EN  +R E+  ++ ++   K IL+
Sbjct:  177 EMFDPRKRKFSAEELKPQPMIKKARKVFIPD----DMKDDKYWARRRKNNVAAKRSRDARRLKENQIAIRAGFLEKENAALRMEVADLRKELGRCKNILA 272          
BLAST of SMED30019431 vs. Planmine SMEST
Match: SMESG000026144.1 (SMESG000026144.1)

HSP 1 Score: 683.715 bits (1763), Expect = 0.000e+0
Identity = 388/388 (100.00%), Postives = 388/388 (100.00%), Query Frame = 1
Query:  118 MAPPKCFFKRPGQFYGSGNTIVQSFKYESYSMPTSPNNEVIPNLCVDNINHCSVSPLKSEPLVHDLYKNILSTQINTETINEPTDFPLDLSCNNNLFKKLSRFFQQKIDXXXXXXXXXXXXXIFYXXXXXXXXXXXXXXXXXXXXXXXIFISPPLISDINWKPPLQQFIDRSLLNTERIHDDYRLQHSPDNSLSVIDXXXXXXXXXXXXXCATNQRRKRSNKRSQDGKIIRPFKLYKGTDSKSLLEAIGITEQDEEWLKNLIEKQNADVFQILSNVMNGSHKEDDLSDEMLEKIKLKFGHIFENCNTTISNPRMVRHPDMTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 1281
            MAPPKCFFKRPGQFYGSGNTIVQSFKYESYSMPTSPNNEVIPNLCVDNINHCSVSPLKSEPLVHDLYKNILSTQINTETINEPTDFPLDLSCNNNLFKKLSRFFQQKIDSNVLSSLNLNLENIFYQLPPQLSPSLNLSLSPNQKPNPNIFISPPLISDINWKPPLQQFIDRSLLNTERIHDDYRLQHSPDNSLSVIDSGQENSSSETSSQCATNQRRKRSNKRSQDGKIIRPFKLYKGTDSKSLLEAIGITEQDEEWLKNLIEKQNADVFQILSNVMNGSHKEDDLSDEMLEKIKLKFGHIFENCNTTISNPRMVRHPDMTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS
Sbjct:    1 MAPPKCFFKRPGQFYGSGNTIVQSFKYESYSMPTSPNNEVIPNLCVDNINHCSVSPLKSEPLVHDLYKNILSTQINTETINEPTDFPLDLSCNNNLFKKLSRFFQQKIDSNVLSSLNLNLENIFYQLPPQLSPSLNLSLSPNQKPNPNIFISPPLISDINWKPPLQQFIDRSLLNTERIHDDYRLQHSPDNSLSVIDSGQENSSSETSSQCATNQRRKRSNKRSQDGKIIRPFKLYKGTDSKSLLEAIGITEQDEEWLKNLIEKQNADVFQILSNVMNGSHKEDDLSDEMLEKIKLKFGHIFENCNTTISNPRMVRHPDMTPKELKTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS 388          
BLAST of SMED30019431 vs. Planmine SMEST
Match: SMESG000012495.1 (SMESG000012495.1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.068e-7
Identity = 27/63 (42.86%), Postives = 42/63 (66.67%), Query Frame = 1
Query: 1066 HPDMTPKEL--KTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVK 1248
            +P++   ++  K E YWE+RRKNN AAKRSRE RRQ +  +    ++L++ N  +RKE+  +K
Sbjct:   51 YPNLNVSDVSEKDERYWERRRKNNAAAKRSRERRRQHDIAMEQQIQNLKLSNAILRKELFVLK 113          
BLAST of SMED30019431 vs. Planmine SMEST
Match: SMESG000012495.1 (SMESG000012495.1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.184e-7
Identity = 27/63 (42.86%), Postives = 42/63 (66.67%), Query Frame = 1
Query: 1066 HPDMTPKEL--KTEEYWEKRRKNNEAAKRSREARRQKEEGLTNHCEDLQMENDKIRKEIETVK 1248
            +P++   ++  K E YWE+RRKNN AAKRSRE RRQ +  +    ++L++ N  +RKE+  +K
Sbjct:   45 YPNLNVSDVSEKDERYWERRRKNNAAAKRSRERRRQHDIAMEQQIQNLKLSNAILRKELFVLK 107          
The following BLAST results are available for this feature:
BLAST of SMED30019431 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DBP4.340e-1044.12D-box binding PAR bZIP transcription factor [Sourc... [more]
DBP4.340e-1044.12D-box binding PAR bZIP transcription factor [Sourc... [more]
DBP2.464e-944.12D-box binding PAR bZIP transcription factor [Sourc... [more]
HLF2.664e-938.00HLF transcription factor, PAR bZIP family member [... [more]
HLF2.664e-938.00HLF transcription factor, PAR bZIP family member [... [more]
back to top
BLAST of SMED30019431 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ces-25.807e-1042.42Cell death specification protein 2 [Source:UniPro... [more]
atf-86.090e-834.67ATF (cAMP-dependent transcription factor) family ... [more]
atf-21.136e-641.27ATF (cAMP-dependent transcription factor) family ... [more]
back to top
BLAST of SMED30019431 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pdp11.350e-1046.38gene:FBgn0016694 transcript:FBtr0332081[more]
Pdp11.353e-1046.38gene:FBgn0016694 transcript:FBtr0076775[more]
Pdp11.363e-1046.38gene:FBgn0016694 transcript:FBtr0076776[more]
Pdp11.363e-1046.38gene:FBgn0016694 transcript:FBtr0346536[more]
Pdp11.363e-1046.38gene:FBgn0016694 transcript:FBtr0306535[more]
back to top
BLAST of SMED30019431 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dbpb2.447e-942.65D site albumin promoter binding protein b [Source:... [more]
dbpb2.502e-942.65D site albumin promoter binding protein b [Source:... [more]
dbpb2.592e-942.65D site albumin promoter binding protein b [Source:... [more]
hlfb8.750e-944.78HLF transcription factor, PAR bZIP family member b... [more]
si:dkey-60d5.31.689e-842.86si:dkey-60d5.3 [Source:ZFIN;Acc:ZDB-GENE-131127-46... [more]
back to top
BLAST of SMED30019431 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbd22.517e-1045.59methyl-CpG binding domain protein 2 [Source:Xenbas... [more]
mbd21.570e-945.59methyl-CpG binding domain protein 2 [Source:Xenbas... [more]
mga5.535e-942.65MGA, MAX dimerization protein [Source:Xenbase;Acc:... [more]
mga6.753e-942.65MGA, MAX dimerization protein [Source:Xenbase;Acc:... [more]
chm2.001e-742.42choroideremia (Rab escort protein 1) [Source:Xenba... [more]
back to top
BLAST of SMED30019431 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dbp9.126e-1044.12D site albumin promoter binding protein [Source:MG... [more]
Dbp1.374e-944.12D site albumin promoter binding protein [Source:MG... [more]
Dbp2.007e-944.12D site albumin promoter binding protein [Source:MG... [more]
Hlf3.729e-938.00hepatic leukemia factor [Source:MGI Symbol;Acc:MGI... [more]
Tef8.072e-943.48thyrotroph embryonic factor [Source:MGI Symbol;Acc... [more]
back to top
BLAST of SMED30019431 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q94126|CES2_CAEEL7.386e-942.42Cell death specification protein 2 OS=Caenorhabdit... [more]
sp|Q10586|DBP_HUMAN1.183e-844.12D site-binding protein OS=Homo sapiens OX=9606 GN=... [more]
sp|Q32PF6|DBP_BOVIN1.283e-844.12D site-binding protein OS=Bos taurus OX=9913 GN=DB... [more]
sp|P16443|DBP_RAT1.391e-844.12D site-binding protein OS=Rattus norvegicus OX=101... [more]
sp|Q60925|DBP_MOUSE1.404e-844.12D site-binding protein OS=Mus musculus OX=10090 GN... [more]
back to top
BLAST of SMED30019431 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0N4V3E61.713e-1046.67BZIP domain-containing protein OS=Enterobius vermi... [more]
A0A0N4V5J44.738e-1048.61BZIP domain-containing protein OS=Enterobius vermi... [more]
A0A0N5A9E11.629e-949.30BZIP domain-containing protein OS=Syphacia muris O... [more]
A0A3S5AZC21.886e-954.05BZIP domain-containing protein OS=Protopolystoma x... [more]
A0A074ZHV32.110e-945.54BZIP domain-containing protein OS=Opisthorchis viv... [more]
back to top
BLAST of SMED30019431 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dbpb1.826e-940.58hepatic leukemia factor [Source:NCBI gene;Acc:1030... [more]
nfil3-43.163e-950.82nuclear factor, interleukin 3 regulated, member 4 ... [more]
hlfa9.043e-941.79hepatic leukemia factor-like [Source:NCBI gene;Acc... [more]
dbpa1.990e-841.18thyrotroph embryonic factor-like [Source:NCBI gene... [more]
tefa2.394e-843.48thyrotroph embryonic factor [Source:NCBI gene;Acc:... [more]
back to top
BLAST of SMED30019431 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000004452.14.651e-945.31pep scaffold:Pmarinus_7.0:GL482388:4981:7461:-1 ge... [more]
back to top
BLAST of SMED30019431 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019431 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO496421.291e-1046.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470091.282e-739.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO276631.898e-739.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489451.963e-643.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30019431 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dbpb1.963e-942.03hepatic leukemia factor [Source:NCBI gene;Acc:1011... [more]
dbpa2.097e-841.18thyrotroph embryonic factor [Source:NCBI gene;Acc:... [more]
dbpa2.104e-841.18thyrotroph embryonic factor [Source:NCBI gene;Acc:... [more]
hlfa2.147e-837.00HLF transcription factor, PAR bZIP family member [... [more]
hlfa2.426e-837.00HLF transcription factor, PAR bZIP family member [... [more]
back to top
BLAST of SMED30019431 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000026144.10.000e+0100.00SMESG000026144.1[more]
SMESG000012495.11.068e-742.86SMESG000012495.1[more]
SMESG000012495.11.184e-742.86SMESG000012495.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019431 ID=SMED30019431|Name=SMED30019431|organism=Schmidtea mediterranea sexual|type=transcript|length=1983bp
GAAAACCTGGTATTCTGTGAATATCAATTAATACTGCAGCGTGATCAATT
GAAAGAAAAAAATTCTGATTTTTTAAAGAAATAGATTTATATCGTTTGGA
TTTACCATATAAAGCAAATGGCTCCGCCGAAGTGTTTTTTTAAGCGGCCA
GGACAATTCTACGGGTCTGGTAACACAATTGTTCAATCATTCAAATACGA
ATCATATTCCATGCCTACCTCTCCGAATAATGAAGTCATTCCTAATTTAT
GCGTCGACAATATTAACCACTGCTCGGTTTCTCCACTAAAATCAGAACCA
TTAGTGCATGATCTCTATAAAAATATTCTATCCACCCAAATCAATACCGA
AACAATAAACGAGCCGACTGATTTCCCATTGGATCTCAGCTGTAATAATA
ATCTATTCAAAAAGCTCAGTCGATTTTTTCAACAGAAAATCGATTCCAAT
GTGCTATCAAGTCTAAATTTAAATCTAGAAAATATATTTTATCAATTGCC
ACCTCAATTAAGTCCGTCATTAAATTTATCGCTCTCCCCCAATCAAAAAC
CCAATCCAAATATTTTCATTTCTCCTCCCTTAATATCAGACATCAATTGG
AAACCCCCCCTCCAACAATTTATAGATAGATCGTTATTAAATACCGAACG
AATTCACGATGATTATCGACTCCAACATTCCCCGGACAATTCTTTATCAG
TAATCGATTCCGGTCAAGAAAACAGTTCTTCGGAAACTTCGAGTCAATGT
GCAACAAATCAGCGTCGAAAACGGTCGAATAAACGCAGCCAAGACGGCAA
AATCATCCGTCCATTTAAACTTTACAAAGGAACCGATTCGAAAAGTTTAT
TGGAAGCAATAGGAATCACTGAGCAAGACGAAGAGTGGTTGAAAAATCTT
ATCGAAAAACAAAATGCCGACGTGTTTCAAATCCTGTCTAACGTAATGAA
CGGTTCTCATAAAGAAGACGATTTATCGGACGAGATGTTGGAGAAAATCA
AACTGAAATTCGGGCATATTTTTGAAAACTGCAACACAACGATTTCCAAT
CCGAGAATGGTTCGACATCCTGACATGACACCGAAAGAATTGAAAACCGA
AGAGTATTGGGAGAAACGTCGTAAGAATAATGAAGCGGCAAAACGATCGA
GAGAAGCCAGGCGGCAAAAAGAAGAGGGCTTAACGAATCATTGCGAAGAT
TTACAAATGGAAAATGACAAAATTCGTAAGGAAATCGAAACTGTAAAATT
GCAAATTCAAGATATTAAAAAGATTTTAAGCTGATCATGAATAACTGCAC
CAAGCGACACAAAATTTATTTATTTAATTATTATTATTAATATTATTATT
TTAGTGAATAAATTTTTGTTCTATGTTTCATTGTGAGTTGAATAACAAAT
ATAATAGTTTTTTTAGCAAAAGTAAATTGGTCAAAATGTCATGATTGTTC
ATCATAAATTGTGTGCAAATTCACTTTCAAAAAGCAGCAAATAAAAACTT
TTGGCCTACACCATTTAGTGATTTGTTTTAATTGTTAGATTTATTATTTG
TGTTTATAATTGAGAAAAATGATTTTGTTTGTTATAATCTTTGGTTTTTT
CATTTCTATTATCAATGCAATAACGTATGATGAAGCAATGAAAGAAAAGG
ATAGATACGTCGTTTTTGACGTAGAACCATTCAAGATGTGGCAGCACATT
GTTCTGTCTTTGGTGTTGTCTTATATACTTCTGGTGATCATGTGGATTAG
TATTAATGTTGTTTTTAAAATTCGTGGACCAAAGAGAAAACGCCGTTTAA
ATTGAGGTTGAAATTTACTTTTTCCTCATATGAATTATATAAATTTTTAT
ATTTTAATATATTTATATTTGTGTATATTTTTGTTAGAATTTTAGATTTT
ATTACAGTAGAAATTATTAAATAATTGACATTTATTTATCAAATTTATTG
TCAAGTAACTGCCAGTTGTTATCTTCATTGGTC
back to top

protein sequence of SMED30019431-orf-1

>SMED30019431-orf-1 ID=SMED30019431-orf-1|Name=SMED30019431-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=389bp
MAPPKCFFKRPGQFYGSGNTIVQSFKYESYSMPTSPNNEVIPNLCVDNIN
HCSVSPLKSEPLVHDLYKNILSTQINTETINEPTDFPLDLSCNNNLFKKL
SRFFQQKIDSNVLSSLNLNLENIFYQLPPQLSPSLNLSLSPNQKPNPNIF
ISPPLISDINWKPPLQQFIDRSLLNTERIHDDYRLQHSPDNSLSVIDSGQ
ENSSSETSSQCATNQRRKRSNKRSQDGKIIRPFKLYKGTDSKSLLEAIGI
TEQDEEWLKNLIEKQNADVFQILSNVMNGSHKEDDLSDEMLEKIKLKFGH
IFENCNTTISNPRMVRHPDMTPKELKTEEYWEKRRKNNEAAKRSREARRQ
KEEGLTNHCEDLQMENDKIRKEIETVKLQIQDIKKILS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR040223PAR_bZIP
IPR004827bZIP
Vocabulary: biological process
TermDefinition
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0006355regulation of transcription, DNA-templated
Vocabulary: molecular function
TermDefinition
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 333..386
NoneNo IPR availableGENE3DG3DSA:1.20.5.170coord: 318..388
e-value: 8.7E-19
score: 69.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 196..228
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 196..215
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 336..359
NoneNo IPR availableCDDcd14695bZIP_HLFcoord: 326..385
e-value: 7.99221E-20
score: 80.2889
NoneNo IPR availableSUPERFAMILYSSF57959Leucine zipper domaincoord: 326..386
IPR004827Basic-leucine zipper domainSMARTSM00338brlzneucoord: 325..388
e-value: 1.3E-4
score: 31.4
IPR004827Basic-leucine zipper domainPFAMPF07716bZIP_2coord: 326..377
e-value: 4.1E-14
score: 52.4
IPR004827Basic-leucine zipper domainPROSITEPS50217BZIPcoord: 327..388
score: 10.749
IPR040223PAR basic leucine zipper proteinPANTHERPTHR11988THYROTROPH EMBRYONIC FACTOR RELATEDcoord: 144..388