SMED30019429

Overview
NameSMED30019429
Smed IDSMED30019429
Length (bp)1111
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30019429 (SMED30019429) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30019429 (SMED30019429) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30019429 (SMED30019429) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30019429 (SMED30019429) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019429

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30019429h1SMcG0021229 SmedASXL_006689SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
posterior sideSMED30019429h1SMcG0021229 dd_Smed_v4_9331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30019429h1SMcG0021229 dd_Smed_v4_9331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30019429 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000395:87612..92262 -5377
Homology
BLAST of SMED30019429 vs. Ensembl Human
Match: MRM3 (mitochondrial rRNA methyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:18485])

HSP 1 Score: 149.443 bits (376), Expect = 1.397e-40
Identity = 102/315 (32.38%), Postives = 164/315 (52.06%), Query Frame = -1
Query:   35 FERIESTDDRLGPV--ILKARILSDVENDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRPETTKLLVDPF-LSRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRXXXXXXXXXXXFQNLTWDDIQNSLNPNCVVHYAD---------ISNDTGESYPYYDENIVDFTK-----------------------------EKTYGLVLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKI 856
            +++    D RL  V  I+K+R   + +   +++EG  +I DA++  A     +FS+ E L E+PV+   K   +  V ++ +K +S+L TP GIM IF +P+  K+      L   LP+ LI DN+RDPGN+G I+RSAAG    ++ +TKGCVD +  KVLR+ M + F +PI  NL W+ + N L P+  V+ AD         +SN   +     D+ ++ F K                             E    +V+GGE  GVS ++ +++  T G  L IP+   V+SLN  +A +I+L E ++++
Sbjct:   94 YDKAYPGDRRLSSVMTIVKSRPFRE-KQGKILLEGRRLISDALKAGAVPKMFFFSRLEYLKELPVDKL-KGVSLIKVKFEDIKDWSDLVTPQGIMGIFAKPDHVKMTYPKTQLQHSLPLLLICDNLRDPGNLGTILRSAAGAGCSKVLLTKGCVDAWEPKVLRAGMGAHFRMPIINNLEWETVPNYLPPDTRVYVADNCGLYAQAEMSNKASDHGWVCDQRVMKFHKYEEEEDVETGASQDWLPHVEVQSYDSDWTEAPAAVVIGGETYGVSLESLQLAESTGGKRLLIPVVPGVDSLNSAMAASILLFEGKRQL 406          
BLAST of SMED30019429 vs. Ensembl Human
Match: MRM3 (mitochondrial rRNA methyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:18485])

HSP 1 Score: 98.9821 bits (245), Expect = 4.724e-24
Identity = 56/152 (36.84%), Postives = 89/152 (58.55%), Query Frame = -1
Query:  410 FERIESTDDRLGPV--ILKARILSDVENDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRPETTKLLVDPF-LSRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKG 856
            +++    D RL  V  I+K+R   + +   +++EG  +I DA++  A     +FS+ E L E+PV+   K   +  V ++ +K +S+L TP GIM IF +P+  K+      L   LP+ LI DN+RDPGN+G I+RSAAG    ++ +TKG
Sbjct:   21 YDKAYPGDRRLSSVMTIVKSRPFRE-KQGKILLEGRRLISDALKAGAVPKMFFFSRLEYLKELPVDKL-KGVSLIKVKFEDIKDWSDLVTPQGIMGIFAKPDHVKMTYPKTQLQHSLPLLLICDNLRDPGNLGTILRSAAGAGCSKVLLTKG 170          
BLAST of SMED30019429 vs. Ensembl Fly
Match: CG14100 (gene:FBgn0036889 transcript:FBtr0074971)

HSP 1 Score: 140.969 bits (354), Expect = 7.234e-38
Identity = 89/275 (32.36%), Postives = 147/275 (53.45%), Query Frame = -1
Query:   32 ENDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILA----EIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRP----------ETTKLLVDPFLSRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRXXXXXXXXXXXFQNLTWDDIQNSLNP----NCVVHYADISNDTGESYPYYDENIVDFTKEKTYG----LVLGGEIGGVSDDAKRI--SAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKIL 784
            +N  +I+EG  +I++A++   KM  L FS+++ LA    E+ V        IY VP   +K +S+L TPPG+MAIF RP          E  +L   PF     P+T++ DN+R+P N+G IIR+ A     ++ +T GC D +  K LR      F +PI  ++TWD++  ++ P    +C V  A+ +    E     +   +D+   K  G    L++GGE  GVS++A R        G C++IP+ + ++SLN+  A  ++L E ++K++
Sbjct:  136 KNRQIIVEGRRLIQEALQCGLKMEVLLFSQKDQLALVKEEVGVAQVETGTKIYKVPQHDLKTWSSLVTPPGLMAIFDRPSDKGLEKNLAEQQRLGSQPF-----PITVVCDNIREPNNLGSIIRTCAALPCSQVVVTHGCCDPWESKALRGGCGGQFRVPIRDDVTWDELALTIPPEAADDCHVFIAETNQRKRE-----NNQTIDYADIKGLGAHNLLIIGGESHGVSEEAYRFLNLVGGKGKCIYIPLAAGIDSLNVASALTLLLFELRRKLI 400          
BLAST of SMED30019429 vs. Ensembl Zebrafish
Match: mrm3a (mitochondrial rRNA methyltransferase 3a [Source:NCBI gene;Acc:550390])

HSP 1 Score: 152.91 bits (385), Expect = 5.182e-42
Identity = 105/310 (33.87%), Postives = 165/310 (53.23%), Query Frame = -1
Query:   32 FERIESTDDRLGPV--ILKARILSDVENDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRPETTKLLV--DPFLSRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRXXXXXXXXXXXFQNLTWDDIQNSLNPNCVVHYAD-ISNDTGESYPYYDENIV------------------------------DFTKEKTYGLVLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKIL 856
            FE+  + D+RL  V  + ++R   D E   +++EG  +I DA+   A    ++FS  E L E+P++   + A +  V Y+ +K +S+L TP G++AIF +P+ ++L    D  L + +P+ LI DNVRD GN+G  +R AA     R+ ++KGCVD +  KVLRS+M + F +P+F NL WDDI   L  N +VH AD  S  T +      EN                                +   +++  LV+GGE  G+S +A R++ ET G  L +P+   V SLN  +A  I+L E ++++L
Sbjct:  113 FEKAPAGDNRLARVSSVARSRAFRDKEG-KVLLEGRRLICDALSAGASPQMIFFSLLERLQELPLDKLQQ-AKLIKVKYEDIKMWSDLVTPQGLIAIFSKPDASRLTFPKDARL-QSVPLFLICDNVRDAGNLGTTLRCAAAAGCDRVLLSKGCVDAWEPKVLRSAMGAHFRLPVFPNLDWDDISKHLPKNVIVHVADNYSTSTKQLVSGQTENASSDDYSESDSDDDDDEKDEDSLPHVKPQVYHECWAQRSTALVIGGETHGLSVEALRLAEETDGKRLFVPMAPGVESLNSAMAAGILLFEGRRQLL 419          
BLAST of SMED30019429 vs. Ensembl Zebrafish
Match: mrm3a (mitochondrial rRNA methyltransferase 3a [Source:NCBI gene;Acc:550390])

HSP 1 Score: 153.295 bits (386), Expect = 5.498e-42
Identity = 105/310 (33.87%), Postives = 165/310 (53.23%), Query Frame = -1
Query:   32 FERIESTDDRLGPV--ILKARILSDVENDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRPETTKLLV--DPFLSRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRXXXXXXXXXXXFQNLTWDDIQNSLNPNCVVHYAD-ISNDTGESYPYYDENIV------------------------------DFTKEKTYGLVLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKIL 856
            FE+  + D+RL  V  + ++R   D E   +++EG  +I DA+   A    ++FS  E L E+P++   + A +  V Y+ +K +S+L TP G++AIF +P+ ++L    D  L + +P+ LI DNVRD GN+G  +R AA     R+ ++KGCVD +  KVLRS+M + F +P+F NL WDDI   L  N +VH AD  S  T +      EN                                +   +++  LV+GGE  G+S +A R++ ET G  L +P+   V SLN  +A  I+L E ++++L
Sbjct:  122 FEKAPAGDNRLARVSSVARSRAFRDKEG-KVLLEGRRLICDALSAGASPQMIFFSLLERLQELPLDKLQQ-AKLIKVKYEDIKMWSDLVTPQGLIAIFSKPDASRLTFPKDARL-QSVPLFLICDNVRDAGNLGTTLRCAAAAGCDRVLLSKGCVDAWEPKVLRSAMGAHFRLPVFPNLDWDDISKHLPKNVIVHVADNYSTSTKQLVSGQTENASSDDYSESDSDDDDDEKDEDSLPHVKPQVYHECWAQRSTALVIGGETHGLSVEALRLAEETDGKRLFVPMAPGVESLNSAMAAGILLFEGRRQLL 428          
BLAST of SMED30019429 vs. Ensembl Zebrafish
Match: mrm3b (mitochondrial rRNA methyltransferase 3b [Source:NCBI gene;Acc:792923])

HSP 1 Score: 142.124 bits (357), Expect = 6.836e-38
Identity = 107/348 (30.75%), Postives = 165/348 (47.41%), Query Frame = -1
Query:   32 TSRIRRGSTIFDNCSDKSFERIESTDDRLGPVILKARILSD--VENDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRPETTKL-LVDPFLSRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRXXXXXXXXXXXFQNLTWDDIQNSLNPNCVVHYADISNDT-----------------------GESYP---------------------YYDENIVDFTKEKTY--------GLVLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKIL 910
            TSR R     F       +E++   D  L  +   ARI     +    +++EG +++  A+   A+   LYFS  + L E+P++   +  ++  V  +  + +S L T   I+AIFKRPE ++L   +    R +P+TLI D VRDPGN+G ++RSAA    H + +TKGCVD++  KVLR++M + F +PI  NLTW DI N L     VH AD  + T                       G  Y                      Y D+N      +  Y         L++GGE  G+S +A +++  T G  L IP+   V+SLN  +A  ++L E +K++L
Sbjct:  104 TSRTR-----FGEVDGLLYEKLHPGDKSLAKL---ARIAGSKKLREHQVVLEGKHLVCSALDAGAEAQTLYFSSVDALRELPLDKL-RQTNVVKVKMEDAQVWSELDTSQEIIAIFKRPEASRLTFSEEKYGRAVPLTLICDTVRDPGNLGSVLRSAAAAGCHSVLLTKGCVDIWELKVLRAAMGAHFRLPIIPNLTWTDISNHLPKTSTVHVADNHSTTMAKHNDNTTPQKHRRPSDYGWVKGHQYQSKAHDDDDDDDDANDLCSLEDYCDKNSKSLETQLYYTDWVAGHTSLIIGGETHGLSREALQLAERTSGRRLLIPMVDGVDSLNSAIAAGVLLFEGRKQLL 442          
BLAST of SMED30019429 vs. Ensembl Xenopus
Match: hhatl (hedgehog acyltransferase like [Source:Xenbase;Acc:XB-GENE-5744180])

HSP 1 Score: 125.946 bits (315), Expect = 5.829e-32
Identity = 98/341 (28.74%), Postives = 175/341 (51.32%), Query Frame = -1
Query:   35 TTSRIRRGSTIFDNCS-DKSFERIESTDDRLGPV--ILKARILSDVENDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRPETTKLLVDPFLSRK-LPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRXXXXXXXXXXXFQNLTWDDIQNSLNPNCVVHYA-----DISNDTGE------SYPYYDENI--VDFTKE-------------KTY------------------GLVLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKI 913
            T+  +R+ S + +  + +  +ER    D RL  V  I K++   D  +  +++EG  ++ DA+   A +  L+FS+ + L   P +   K A++  V +  +K +S++  P G+M IF +P+  K+      ++  LP++LI DN+RDPGN+G I+R AAG   +++ +TKGCVD +  KVLR+ M + F +P+  +L WD + N L+    V  A     D+ + TG+       Y +   N   +  T+E             K Y                   +V+GGE  G+S ++  ++ ++ G  L+IP+   ++SLN  +A +I+L E +++I
Sbjct:   69 TSQGVRQASALTEAPALEFRYERALPGDKRLSKVVTIAKSKKFRD-RHGQVLLEGRRLLTDALESGAVLQTLFFSRVDYLKLFPPDKLRK-ANLIKVNFDNIKIWSDVVAPQGLMGIFAKPDHEKISYPTTQTKHTLPLSLICDNIRDPGNLGTILRCAAGAGCNKVLLTKGCVDAWEPKVLRAGMGAHFRLPVISSLDWDIVPNYLSAGTKVFLADNFRPDMKHKTGDVSEKASDYGWVSTNPRRILITEEGYESSSDEEDNADKLYIPGLEVQSYFESWAQSPCAIVIGGETHGLSIESLLLAEKSNGKRLYIPVVPDIDSLNSAMAASILLFEGKRQI 407          
BLAST of SMED30019429 vs. Ensembl Mouse
Match: Mrm3 (mitochondrial rRNA methyltransferase 3 [Source:MGI Symbol;Acc:MGI:1914640])

HSP 1 Score: 152.14 bits (383), Expect = 1.087e-41
Identity = 106/316 (33.54%), Postives = 174/316 (55.06%), Query Frame = -1
Query:   35 DKSFERIESTDDRLGPV--ILKARILSDVENDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRPETTKLLV-DPFLSRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRXXXXXXXXXXXFQNLTWDDIQNSLNPNCVVHYAD---------ISNDTGE----------SYPYYDENIVDFTKE--------KTYGL---------VLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKI 865
            DK+F      D RL  V  I+K+R   + +   +++EG  +I DA++  A     +FS+ E + E+PV+   KD  +  V ++ +K +S+L TP GIM IF +P+  K+   +  L   LP+ LI DN+RDPGN+G I+RSAAG    ++ +TKGCVD +  KVLR+ M + F +PI  N+ W+ + N L P+  V+ AD         +S+ TG+           +  Y+E++   T++        ++Y L         V+GGE  GVS ++ +++  T G  L IP+   V+SLN  +A +I+L E ++++
Sbjct:   95 DKAF----PGDRRLSSVMTIVKSRPFREKQG-KILLEGRRLIADALKAGAVPKAFFFSRLEYVKELPVDKL-KDVSLIKVKFEDIKDWSDLVTPQGIMGIFAKPDPVKMTYPETPLHHTLPLVLICDNLRDPGNLGTILRSAAGAGCSKVLLTKGCVDAWEPKVLRAGMGAHFQVPIVNNVEWETVPNHLPPDTRVYVADNCGHYAQVQMSDKTGDRDWACDRRFLKFHKYEEDLDTKTRKDWLPKLEVQSYDLDWTGAPAAVVIGGETHGVSLESLQLAESTGGKRLLIPVVPGVDSLNSAMAASILLFEGKRQL 404          
BLAST of SMED30019429 vs. UniProt/SwissProt
Match: sp|Q566V3|MRM3A_DANRE (rRNA methyltransferase 3A, mitochondrial OS=Danio rerio OX=7955 GN=mrm3a PE=2 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 6.660e-42
Identity = 106/311 (34.08%), Postives = 167/311 (53.70%), Query Frame = -1
Query:   32 FERIESTDDRLGPV--ILKARILSDVENDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRPETTKLLV--DPFLSRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRXXXXXXXXXXXFQNLTWDDIQNSLNPNCVVHYAD-ISNDTGESYPYYDENIV-------------------------------DFTKEKTYGLVLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKIL 856
            FE+  + D+RL  V  + ++R   D E   +++EG  +I DA+   A    ++FS  E L E+P++   + A +  V Y+ +K +S+L TP G++AIF +P+ ++L    D  L + +P+ LI DNVRD GN+G I+R AA     R+ ++KGCVD +  KVLRS+M + F +P+F NL WDDI   L  N +VH AD  S  T +      EN+                                +   +++  LV+GGE  G+S +A R++ ET G  L +P+   V SLN  +A  I+L E ++++L
Sbjct:  113 FEKAPAGDNRLARVSSVARSRAFRDKEG-KVLLEGRRLICDALSAGASPQMIFFSLLERLQELPLDKLQQ-AKLIKVKYEDIKLWSDLVTPQGLIAIFSKPDASRLTFPKDARL-QSVPLFLICDNVRDAGNLGTILRCAAAAGGDRVLLSKGCVDAWEPKVLRSAMGAHFRLPVFPNLDWDDISKHLPKNVIVHVADNYSTSTKQLVSGQTENVSSDDYSESDSDDDDDEEEDEDSLPHVKPQVYHECWAQRSAALVIGGETHGLSVEALRLAEETDGKRLFVPMAPGVESLNSAMAAGILLFEGRRQLL 420          
BLAST of SMED30019429 vs. UniProt/SwissProt
Match: sp|Q5ND52|MRM3_MOUSE (rRNA methyltransferase 3, mitochondrial OS=Mus musculus OX=10090 GN=Mrm3 PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 7.601e-41
Identity = 106/316 (33.54%), Postives = 174/316 (55.06%), Query Frame = -1
Query:   35 DKSFERIESTDDRLGPV--ILKARILSDVENDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRPETTKLLV-DPFLSRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRXXXXXXXXXXXFQNLTWDDIQNSLNPNCVVHYAD---------ISNDTGE----------SYPYYDENIVDFTKE--------KTYGL---------VLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKI 865
            DK+F      D RL  V  I+K+R   + +   +++EG  +I DA++  A     +FS+ E + E+PV+   KD  +  V ++ +K +S+L TP GIM IF +P+  K+   +  L   LP+ LI DN+RDPGN+G I+RSAAG    ++ +TKGCVD +  KVLR+ M + F +PI  N+ W+ + N L P+  V+ AD         +S+ TG+           +  Y+E++   T++        ++Y L         V+GGE  GVS ++ +++  T G  L IP+   V+SLN  +A +I+L E ++++
Sbjct:   95 DKAF----PGDRRLSSVMTIVKSRPFREKQG-KILLEGRRLIADALKAGAVPKAFFFSRLEYVKELPVDKL-KDVSLIKVKFEDIKDWSDLVTPQGIMGIFAKPDPVKMTYPETPLHHTLPLVLICDNLRDPGNLGTILRSAAGAGCSKVLLTKGCVDAWEPKVLRAGMGAHFQVPIVNNVEWETVPNHLPPDTRVYVADNCGHYAQVQMSDKTGDRDWACDRRFLKFHKYEEDLDTKTRKDWLPKLEVQSYDLDWTGAPAAVVIGGETHGVSLESLQLAESTGGKRLLIPVVPGVDSLNSAMAASILLFEGKRQL 404          
BLAST of SMED30019429 vs. UniProt/SwissProt
Match: sp|Q9HC36|MRM3_HUMAN (rRNA methyltransferase 3, mitochondrial OS=Homo sapiens OX=9606 GN=MRM3 PE=1 SV=2)

HSP 1 Score: 149.443 bits (376), Expect = 6.708e-40
Identity = 102/315 (32.38%), Postives = 164/315 (52.06%), Query Frame = -1
Query:   35 FERIESTDDRLGPV--ILKARILSDVENDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRPETTKLLVDPF-LSRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRXXXXXXXXXXXFQNLTWDDIQNSLNPNCVVHYAD---------ISNDTGESYPYYDENIVDFTK-----------------------------EKTYGLVLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKI 856
            +++    D RL  V  I+K+R   + +   +++EG  +I DA++  A     +FS+ E L E+PV+   K   +  V ++ +K +S+L TP GIM IF +P+  K+      L   LP+ LI DN+RDPGN+G I+RSAAG    ++ +TKGCVD +  KVLR+ M + F +PI  NL W+ + N L P+  V+ AD         +SN   +     D+ ++ F K                             E    +V+GGE  GVS ++ +++  T G  L IP+   V+SLN  +A +I+L E ++++
Sbjct:   94 YDKAYPGDRRLSSVMTIVKSRPFRE-KQGKILLEGRRLISDALKAGAVPKMFFFSRLEYLKELPVDKL-KGVSLIKVKFEDIKDWSDLVTPQGIMGIFAKPDHVKMTYPKTQLQHSLPLLLICDNLRDPGNLGTILRSAAGAGCSKVLLTKGCVDAWEPKVLRAGMGAHFRMPIINNLEWETVPNYLPPDTRVYVADNCGLYAQAEMSNKASDHGWVCDQRVMKFHKYEEEEDVETGASQDWLPHVEVQSYDSDWTEAPAAVVIGGETYGVSLESLQLAESTGGKRLLIPVVPGVDSLNSAMAASILLFEGKRQL 406          
BLAST of SMED30019429 vs. UniProt/SwissProt
Match: sp|A1L2E4|MRM3B_DANRE (rRNA methyltransferase 3B, mitochondrial OS=Danio rerio OX=7955 GN=rnmtl1b PE=2 SV=2)

HSP 1 Score: 145.591 bits (366), Expect = 3.223e-38
Identity = 108/344 (31.40%), Postives = 165/344 (47.97%), Query Frame = -1
Query:   32 TSRIRRGSTIFDNCSDKSFERIESTDDRLGPVILKARILSD--VENDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRPETTKL-LVDPFLSRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRXXXXXXXXXXXFQNLTWDDIQNSLNPNCVVHYADISNDT-----------------------GESYP-----------------YYDENIVDFTKEKTY--------GLVLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKIL 910
            TSR R     F       +E++   D  L  +   ARI     +    +++EG +++  A+   A+   LYFS  + L E+P++   +  ++  V  +  + +S L T   I+AIFKRPE ++L   +    R +P+TLI D VRDPGN+G ++RSAA    H + +TKGCVD++  KVLR++M + F +PI  NLTW DI N L     VH AD  + T                       G  Y                  Y DEN      +  Y         L++GGE  G+S +A +++  T G  L IP+   V+SLN  +A  ++L E +K++L
Sbjct:  104 TSRTR-----FGEVDGLLYEKLHPGDKSLAKL---ARIAGSKKLREHQVVLEGKHLVCSALDAGAEAQTLYFSSVDALRELPLDKL-RQTNVVKVKMEDAQVWSELDTSQEIIAIFKRPEASRLTFSEEKYGRAVPLTLICDTVRDPGNLGSVLRSAAAAGCHSVLLTKGCVDIWELKVLRAAMGAHFRLPIIPNLTWTDISNHLPKTSTVHVADNHSTTMGKHNDNTTPQKHRRPSDYGWVKGHQYQSKAHDDDDANDLCSLEDYCDENSKSLETQLYYTDWVAGHTSLIIGGETHGLSREALQLAERTSGRRLLIPMVDGVDSLNSAIAAGVLLFEGRKQLL 438          
BLAST of SMED30019429 vs. UniProt/SwissProt
Match: sp|Q9VW14|MRM3_DROME (rRNA methyltransferase 3, mitochondrial OS=Drosophila melanogaster OX=7227 GN=CG14100 PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 7.251e-37
Identity = 89/275 (32.36%), Postives = 147/275 (53.45%), Query Frame = -1
Query:   32 ENDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILA----EIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRP----------ETTKLLVDPFLSRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRXXXXXXXXXXXFQNLTWDDIQNSLNP----NCVVHYADISNDTGESYPYYDENIVDFTKEKTYG----LVLGGEIGGVSDDAKRI--SAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKIL 784
            +N  +I+EG  +I++A++   KM  L FS+++ LA    E+ V        IY VP   +K +S+L TPPG+MAIF RP          E  +L   PF     P+T++ DN+R+P N+G IIR+ A     ++ +T GC D +  K LR      F +PI  ++TWD++  ++ P    +C V  A+ +    E     +   +D+   K  G    L++GGE  GVS++A R        G C++IP+ + ++SLN+  A  ++L E ++K++
Sbjct:  136 KNRQIIVEGRRLIQEALQCGLKMEVLLFSQKDQLALVKEEVGVAQVETGTKIYKVPQHDLKTWSSLVTPPGLMAIFDRPSDKGLEKNLAEQQRLGSQPF-----PITVVCDNIREPNNLGSIIRTCAALPCSQVVVTHGCCDPWESKALRGGCGGQFRVPIRDDVTWDELALTIPPEAADDCHVFIAETNQRKRE-----NNQTIDYADIKGLGAHNLLIIGGESHGVSEEAYRFLNLVGGKGKCIYIPLAAGIDSLNVASALTLLLFELRRKLI 400          
BLAST of SMED30019429 vs. TrEMBL
Match: A0A212ERF7 (Putative RNA methyltransferase like 1 OS=Danaus plexippus plexippus OX=278856 GN=KGM_213012 PE=4 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 8.827e-45
Identity = 98/297 (33.00%), Postives = 172/297 (57.91%), Query Frame = -1
Query:   29 IFDNCSDKSFERIESTDDRLGPVILKARILSD-VENDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRPETTKLLVDPFLSRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRXXXXXXXXXXXFQNLTWDDIQNSLNPNCVVHYAD----ISNDTGESYPYYDENI-------VDFTKEKTYGLVLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKILK 883
            +FD+  +  +E++ + D R+  ++++ +   + + +  +++EG  +I D +     + Y+ FS+ E L ++     +     Y +PYK ++ +SN+ TPPGI+ +F  P T  +    +LS+ LP+ LI DNVR PGN+G I+R+AAG    ++ +TKGCVDL++ KV+RS   + F  PI  ++ W+++ N+L     +  AD    + ND  ES    D NI       VDF   K   L++GGE  G+S+++ R++A   G  L+IP+   V+SLN  +A A+I  E +K++++
Sbjct:   81 VFDDNGEIIYEKLNNNDGRISSLLVRLKSKKERLRSQQIMVEGWRLIVDGLEAKCALRYVIFSQLEDLNKLRPFLPDTGVKFYKIPYKEIELWSNVDTPPGIIGVFDTPTTDNV---KWLSKPLPIHLICDNVRTPGNLGGILRAAAGVGCEKVLLTKGCVDLWDPKVVRSGAGAHFRQPIISSIEWEELPNNLAEKTTIFIADSNVKLMNDDFESENALDCNIPVVPYYSVDFGILKHITLIIGGETEGISENSYRLAANRNGLRLNIPLQKGVDSLNTGMATAVIAFEMRKQLIQ 374          
BLAST of SMED30019429 vs. TrEMBL
Match: A0A2G8L9L8 (Putative rRNA methyltransferase 3, mitochondrial OS=Stichopus japonicus OX=307972 GN=BSL78_06135 PE=4 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 7.337e-43
Identity = 93/285 (32.63%), Postives = 166/285 (58.25%), Query Frame = -1
Query:   23 FERIESTDDRLGPVILKARILSDVE-NDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRPETTKL---LVDPFLSRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRXXXXXXXXXXXFQNLTWDDIQNSLNPNCVVHYADISNDTG---ESYPYYDENIVDFTKEKTYGLVLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKILKNK 856
            + +  STD R G ++  A+     E N+ +I+EG  ++ DA+ + AK   L+FS    L  +P++    +  +  +PYK  K +S L+TP GI+ +F +P    +   + DP +    P+TL+ DN+RDPGN+G I+R+AA  N  +I +T+GCVD+++ KVLR+   + F  P+   + W ++ N L+ +  ++ AD  N T    ++ P    + +D+T +    LV+GGE  G+S +A  + A T+G  + IP++  V+SLN  ++ +I+L E +++ L ++
Sbjct:  152 YTKAPSTDKRFGSIMTMAKNRKLRERNNKVILEGKRLVHDALSVGAKCHTLFFSLTSNLNGLPIDKM--ETELVKIPYKEFKIWSGLSTPQGIVGVFTKPSYDMIKTDVSDPCI----PLTLVCDNIRDPGNLGTILRAAAAANCEKILVTRGCVDIWDPKVLRAGAGAHFHTPVTNRIAWPEVPNYLDADTSLYIADTFNQTDGREDALPQLLHSDMDWTMQS--ALVIGGETEGISQEALELCASTHGTTVFIPMSKAVDSLNSAMSASILLFEAKRQWLAHQ 428          
BLAST of SMED30019429 vs. TrEMBL
Match: A0A2A4K1Y3 (SpoU_methylase domain-containing protein OS=Heliothis virescens OX=7102 GN=B5V51_5799 PE=4 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 8.259e-43
Identity = 95/298 (31.88%), Postives = 168/298 (56.38%), Query Frame = -1
Query:   29 IFDNCSDKSFERIESTDDRLGPVILKARILSD-VENDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRPETTKLLVDPFLSRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRXXXXXXXXXXXFQNLTWDDIQNSLNPNCVVHYADISNDTGESYPYYDENI------------VDFTKEKTYGLVLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKILK 883
            +FD+  D  FE+++  D RL  ++++ +   + + +  + +EG  +I D +  N  + Y+ FS+ E L+++           Y V YK M+ +S++ T PGI  IF+ P    +     +SR LP+  I DN+R PGN+G I+R A G    ++ ++KGCVD+++ KV+RS+  + F +PI+Q++ WD++ + L  +  V  AD +    +    ++EN             VD++  K   L+LGGE  G+SDD+ R++A   G  ++IP+   V+SLN  +A A+I  E +K+++K
Sbjct:  117 VFDDKGDIIFEKLKENDGRLSTLLVRLKSKKERLRSGHMFVEGWRLIVDGLEANCTLKYVIFSRPEELSKLKPFLPKTGVRFYKVAYKEMQMWSDVETSPGIFGIFETPTAKTVKT---ISRPLPLQFICDNIRVPGNLGAILRVAVGAGCEKVLLSKGCVDVWDPKVIRSAAGAHFRLPIYQSIDWDEMPSHLEKDTSVLIADSNTTALDDSSEFEENDKRSDMPVLPYYGVDYSSFKHTTLILGGETEGISDDSYRLAAAKNGVRINIPLQRGVDSLNTGMATAVIAFEIRKQLIK 411          
BLAST of SMED30019429 vs. TrEMBL
Match: A0A3Q3JVY6 (Mitochondrial rRNA methyltransferase 3a OS=Monopterus albus OX=43700 PE=4 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 1.368e-42
Identity = 111/309 (35.92%), Postives = 170/309 (55.02%), Query Frame = -1
Query:   29 FERIESTDDRLGPVILKARILSDVENDS-LIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRPETTKLLVDPFLSR--KLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRXXXXXXXXXXXFQNLTWDDIQNSLNPNCVVHYADISNDTGESYPYYDENIVDFTKEKTY------------------------------GLVLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKILK 856
            FER    D RL  ++  AR  +  E+   +++EG  +I DA+   A    ++FS  + L E+P++   K A +  V ++ +K +S+L  P G++AIF RP+ ++L    F +R   +P++LI DN+RDPGN+G ++RSAA    H + +TKGCVD +  KVLR++M + F +PIF +L WDDI+N L     VH AD S D G S    D  I    KEK Y                               LV+GGE  G+S +A +++ +T G  L IP+   ++SLN  +A +I+L E +K++LK
Sbjct:  117 FERAFPGDKRLARLVSVARSRTFREHQGKIVLEGRRLICDALDAGASPQTVFFSMVDRLRELPLDKL-KRATLVKVKFEDIKIWSDLVAPQGVIAIFSRPDPSRL---NFANRGHSVPLSLICDNIRDPGNLGTMLRSAAAAGCHNVLLTKGCVDAWEPKVLRAAMGAHFRLPIFPSLNWDDIENHLPTPVTVHVADSSCDAGRSRETEDSQI---NKEKDYDSEWESEDEGLSLPRVDAKRYHESWAQSPTALVIGGETHGLSVEAVQLAEKTAGHRLFIPVVPDMDSLNSAMAASILLFEGRKQLLK 418          
BLAST of SMED30019429 vs. TrEMBL
Match: A0A504YSM1 (RNA methyltransferase 1 OS=Fasciola gigantica OX=46835 GN=FGIG_07682 PE=4 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 5.052e-41
Identity = 96/302 (31.79%), Postives = 158/302 (52.32%), Query Frame = -1
Query:   38 LSDVENDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRP---ETTKLLVDPFLSRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRXXXXXXXXXXXFQNLTWDDIQNSLNPN---------CVVHYADISN-------------------DTGESY--------PY----YDENIVDF------TKEKTYGLVLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKK 796
            L  + + ++++EG  +IRDA+R   ++ YL FS R++L EIP   ++K  ++Y+VP++ +K++S L TPPGI+AI + P     +K   D ++ + LP  LILDN+RDPGN+G ++R+AAGF +H + ++KG VD++NDKV+R+                 DI N +  N          ++  + IS+                   D+ E+         P+    Y  NI  F      T   +  LV+GGE  G+S +A  ++  T G  +++PI     SLN+  A + IL E Q++
Sbjct:   89 LKSLGDQTILLEGYRLIRDAVRSGGQVVYLLFSSRDVLQEIP--EYDKIPNVYFVPHRILKQWSRLKTPPGILAILRVPGPSSQSKTNNDLWIWKPLPAILILDNIRDPGNLGSLLRTAAGFGLHSVLVSKGSVDVWNDKVVRA-----------------DISNKMTTNNAISRSVSSALISRSQISDEWVEGDDDDNDEERTPLQLDSSEAAFRLPLPQSPHFTTDYFPNITSFPSSPDLTVRPSVALVVGGEAHGLSPEAYHLAHLTDGSRIYVPIAPETESLNVLSAASAILGEMQRQ 371          
BLAST of SMED30019429 vs. Ensembl Cavefish
Match: mrm3a (mitochondrial rRNA methyltransferase 3 [Source:NCBI gene;Acc:103032027])

HSP 1 Score: 141.354 bits (355), Expect = 1.108e-37
Identity = 99/313 (31.63%), Postives = 163/313 (52.08%), Query Frame = -1
Query:   29 FERIESTDDRLGPV--ILKARILSDVENDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRPETTKLLVDPFLS-RKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRXXXXXXXXXXXFQNLTWDDIQNSLNPNCVVHYADISN------------DTG----------------------ESYPYYDENIVDFTKEKTYGLVLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKILK 856
            +E     D RL  V  I ++R+  + +   +++EG  +I DA+   A    L+FS+ E L E+P++   + A +  V ++ +K +S+L+ P G++AIF +P+ ++L     L  + +P  LI D ++DPGN+G I+R AA     R+ + KGCVD +  KVLR++M + F +PIF  L W+DI   L     VH AD +N            DTG                      E  PY+ EN      +++  LV+GGE  G+S +A  ++ ET G  L +P+   V  LN  +  +I+L E +++++K
Sbjct:  120 YETARPGDKRLAKVASIAQSRVFRE-QQGKVLLEGRRLICDALAAGASPQTLFFSRVERLGELPLDRLGQ-ASLVKVKFEDIKIWSDLSAPQGVIAIFSKPDASRLKFPRDLRLQTVPFFLICDTIKDPGNLGTILRCAAAAGCERVLLNKGCVDAWEPKVLRAAMGAHFRLPIFPGLDWNDILEHLPHPVTVHVADPTNQLMMRQAVPQSGDTGCEEYVESDSEDESEDEGLPLSVEPKPYH-ENWA----QRSTALVIGGEAHGLSCEALELAEETRGHKLFVPMAPGVECLNSAMTASILLFEGRRQLMK 425          
BLAST of SMED30019429 vs. Ensembl Cavefish
Match: mrm3b (rRNA methyltransferase 3B, mitochondrial-like [Source:NCBI gene;Acc:103040490])

HSP 1 Score: 129.798 bits (325), Expect = 2.152e-33
Identity = 91/309 (29.45%), Postives = 150/309 (48.54%), Query Frame = -1
Query:   32 ENDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRPETTKL-LVDPFLSRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRXXXXXXXXXXXFQNLTWDDIQNSLNPNCVVHYADISNDTGESYPY------------------------------------------YDENIVDFTKEKT---------------YGLVLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKIL 784
            +   +++EG  +I DA+     +  ++FS  E L E+P+      A +  V  + ++ + +L TP  ++A+FKRPE +++   +    + LP+TLI DNVRDPGN+G  +R AA    H + +TKGCVD++  KVLR++M S F +PI  +LTW D+   L  N  VH AD    T E   +                                          Y+E+   FTK +                  +V+GGE  G+S +A +++  T G  L IP+   V+SLN  +A +++L E +++++
Sbjct:  142 QQGKILLEGRRLITDALDAGVSLQTVFFSSVEKLKELPLEKL-AHASLIKVKLEDIRIWPDLDTPQ-LIAVFKRPEVSQMQFCEEKYGKALPLTLICDNVRDPGNLGTTLRCAAAAGCHSVLLTKGCVDIWEPKVLRAAMGSHFRLPIIPSLTWTDLNRHLPANTTVHVADNCRGTTEEAEFPATPQPQKKPGDYGWVRSRHNSRKMSYDDDYDDNYDLSEFQDYEED--GFTKTRLDLQTQPYHNGWVGRHTAIVIGGETHGLSQEAMQLANRTGGRRLMIPMVHGVDSLNSAMAASVLLFEGRRQLM 446          
BLAST of SMED30019429 vs. Ensembl Sea Lamprey
Match: MRM3 (mitochondrial rRNA methyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:18485])

HSP 1 Score: 133.265 bits (334), Expect = 3.645e-36
Identity = 97/338 (28.70%), Postives = 162/338 (47.93%), Query Frame = -1
Query:   23 DKSFERIESTDDRLGPV--ILKARILSDVENDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRPETT---KLLVDPFLSRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRXXXXXXXXXXXFQNLTWDDIQNSLNPNCVVHYAD-----------------------ISNDTGESYPYYDENIVDFTKE-----------------------------KTYGLVLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKILKNK 865
            D  FER    D RL  V  I K+R   + ++  +++EG  +IRDA+   A +  ++F     L E+P+    + A I  V  + ++ +S+L TP G++AIF+RP+     +L      S  LP++L+ DNVRDPGN+G IIRSAA     ++ + KGCVD++  KVLR+   + F +P+   L W D+   L  + VVH AD                        + ++G S  ++     D  ++                             +   LV+ GE  G+  +A R++  T G  LH+ + + V SLN+ VA +++L E ++++   +
Sbjct:    1 DLRFERAGPDDKRLRTVVTIAKSRQYRE-KHGKILLEGTRLIRDALEAGAVLQTIFFDSVTQLQELPLELIARAALIR-VRMRDIRLWSDLVTPQGLLAIFRRPDYASDKELRSRAEGSECLPISLVCDNVRDPGNMGTIIRSAAAVGCSKVLLIKGCVDVWEPKVLRAGAGAHFRVPLLPCLRWKDVPEILGVHTVVHVADNRPIGHTLRIYQPQDLHLGAHNFSTINSGLSTIFFTHGETDMREKEMLRKLSSMPAHAYTRPWAGSGPGGEDGARETALVVSGEAQGLGVEALRLAEGTGGRRLHVGMAAGVESLNVGVAASVLLFEARRQLTMGR 336          
BLAST of SMED30019429 vs. Ensembl Nematostella
Match: EDO41927 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S341])

HSP 1 Score: 105.531 bits (262), Expect = 3.297e-26
Identity = 77/281 (27.40%), Postives = 150/281 (53.38%), Query Frame = -1
Query:   35 NDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPY--KTMKRFSNLTTPPGIMAIFKRPETTKLLVDPFLSRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRXXXXXXXXXXXFQNLTWDDIQNSLNPNCVVHYADISNDTGE---------------SY---------------PYYDENIVDFTKEKTYGLVLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKI 781
            ++ +++EG+ ++ DA+  N +   +++S + ++ ++     +K    Y+VP   KTMK      TPPGI+ +FK+P  ++L ++   S  LP+T+I D V+DP N+G I+R+ A      +  T+   DL++ KVLR      F +P++  L+W  I + L  +  ++ A+ S++TG+               S+               PY++   VD+T   +  L++GGE  G+S +A+ ++    G  +HIP+  +++SL+  ++ A+I+ E  ++I
Sbjct:    7 HNRILLEGLRIVHDALLANMEPITIFYSNKNLIDKLT----SKLPSRYFVPVDDKTMKNLLTALTPPGIVGVFKKP-CSQLKIE---SNVLPLTVICDRVKDPSNLGTIVRTCAAAGCQALITTEYSTDLWDPKVLRGGAGGHFRVPLYGLLSWKQIADMLGDDTRLYLAE-SDNTGKIIISPWKYFVVENPISWHCYGTLNLDLGSIIIPYFE---VDWTLGPS-ALIVGGETTGISTEAQMLACGERGQAVHIPMVGNIDSLSAGISVALIVYEAFRQI 274          
BLAST of SMED30019429 vs. Ensembl Medaka
Match: mrm3a (mitochondrial rRNA methyltransferase 3 [Source:NCBI gene;Acc:101164664])

HSP 1 Score: 137.502 bits (345), Expect = 2.632e-36
Identity = 104/340 (30.59%), Postives = 171/340 (50.29%), Query Frame = -1
Query:   29 ETTSRIRRGSTIFDNCSDKSFERIESTDDRLGPVILKARILSDVENDS-LIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRPETTKLLVDPFLSRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRXXXXXXXXXXXFQNLTWDDIQNSLNPNCVVHYAD------------------------------------------ISNDTGESYPYYDENI-VDFTKEKTYGLVLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKILK 916
            ++T +  R +   D      FER    D RL  ++  AR  +  E+   +++EG  +I DA+   A    ++FS  + L E+P++   K A +  V ++ +K +S++  P G++AIF R + ++L       + + ++LI DN+RDPGN+G ++R AA      I +TKGCVD +  KVLR++M + F +PI+ NL W DI+N L  +  VH AD                                           S+D G S P  D  +  +   +    LV+GGE  G+S +A +++ +T G  L IPI   V+SLN  +A +I+L E ++++LK
Sbjct:   92 DSTVQHPRAAGTKDQVDGLRFERASQGDKRLAKLVSVARSRTFREHQGKILLEGRRLICDALHAGAMPQTVFFSTVDRLRELPLDKL-KRAALVKVKFEEIKLWSDVVAPQGVIAIFSRSDPSRLNY-ANKGQSVGLSLICDNIRDPGNLGTMLRCAAAAGCSSILLTKGCVDAWEPKVLRAAMGAHFKLPIYPNLEWGDIENHLPASVTVHVADHNCGSETELDLLQKPTKAGDFGWVSSKPNPKNVCHEEYNSDSDSDDDGLSVPRVDAKVYYENWAQTPTALVIGGETHGLSLEAVQLAEKTDGLRLFIPIVPGVDSLNSAMAASILLFEGRRQLLK 429          
BLAST of SMED30019429 vs. Planmine SMEST
Match: SMESG000062794.1 (SMESG000062794.1)

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 327/329 (99.39%), Postives = 328/329 (99.70%), Query Frame = -1
Query:    5 KKYARPIITQDEQIIPDGNIIPIVKETTSRIRRGSTIFDNCSDKSFERIESTDDRLGPVILKARILSDVENDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRPETTKLLVDPFLSRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRXXXXXXXXXXXFQNLTWDDIQNSLNPNCVVHYADISNDTGESYPYYDENIVDFTKEKTYGLVLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKILKNKIYIH*F 991
            KKYARPIITQDEQIIPDGNIIPIVKETTSRIRRGSTIFDNCSDKSFERIESTDDRLGPVILKARILSDVENDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRPETTKLLVDPF+SRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRSSMSSIFSIPIFQNLTWDDIQNSLNPNCVVHYADISNDTGESYPYYDENIVDFTKEKTYGLVLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKILKNKIYIH F
Sbjct:   24 KKYARPIITQDEQIIPDGNIIPIVKETTSRIRRGSTIFDNCSDKSFERIESTDDRLGPVILKARILSDVENDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRPETTKLLVDPFISRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRSSMSSIFSIPIFQNLTWDDIQNSLNPNCVVHYADISNDTGESYPYYDENIVDFTKEKTYGLVLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKILKNKIYIHYF 352          

HSP 2 Score: 52.7582 bits (125), Expect = 2.039e-7
Identity = 25/28 (89.29%), Postives = 26/28 (92.86%), Query Frame = -3
Query:  978 MLNFTNKFIRNALIFDRKLYSVMKKICK 1061
            MLNFTNKFIRNALIFDRKLYSVMKK  +
Sbjct:    1 MLNFTNKFIRNALIFDRKLYSVMKKYAR 28          
BLAST of SMED30019429 vs. Planmine SMEST
Match: SMESG000062794.1 (SMESG000062794.1)

HSP 1 Score: 642.114 bits (1655), Expect = 0.000e+0
Identity = 327/329 (99.39%), Postives = 328/329 (99.70%), Query Frame = -1
Query:    5 KKYARPIITQDEQIIPDGNIIPIVKETTSRIRRGSTIFDNCSDKSFERIESTDDRLGPVILKARILSDVENDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRPETTKLLVDPFLSRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRXXXXXXXXXXXFQNLTWDDIQNSLNPNCVVHYADISNDTGESYPYYDENIVDFTKEKTYGLVLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKILKNKIYIH*F 991
            KKYARPIITQDEQIIPDGNIIPIVKETTSRIRRGSTIFDNCSDKSFERIESTDDRLGPVILKARILSDVENDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRPETTKLLVDPF+SRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRSSMSSIFSIPIFQNLTWDDIQNSLNPNCVVHYADISNDTGESYPYYDENIVDFTKEKTYGLVLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKILKNKIYIH F
Sbjct:    2 KKYARPIITQDEQIIPDGNIIPIVKETTSRIRRGSTIFDNCSDKSFERIESTDDRLGPVILKARILSDVENDSLIIEGVNMIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSNLTTPPGIMAIFKRPETTKLLVDPFISRKLPVTLILDNVRDPGNIGCIIRSAAGFNIHRIFMTKGCVDLYNDKVLRSSMSSIFSIPIFQNLTWDDIQNSLNPNCVVHYADISNDTGESYPYYDENIVDFTKEKTYGLVLGGEIGGVSDDAKRISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKILKNKIYIHYF 330          
The following BLAST results are available for this feature:
BLAST of SMED30019429 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
MRM31.397e-4032.38mitochondrial rRNA methyltransferase 3 [Source:HGN... [more]
MRM34.724e-2436.84mitochondrial rRNA methyltransferase 3 [Source:HGN... [more]
back to top
BLAST of SMED30019429 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019429 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG141007.234e-3832.36gene:FBgn0036889 transcript:FBtr0074971[more]
back to top
BLAST of SMED30019429 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mrm3a5.182e-4233.87mitochondrial rRNA methyltransferase 3a [Source:NC... [more]
mrm3a5.498e-4233.87mitochondrial rRNA methyltransferase 3a [Source:NC... [more]
mrm3b6.836e-3830.75mitochondrial rRNA methyltransferase 3b [Source:NC... [more]
back to top
BLAST of SMED30019429 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hhatl5.829e-3228.74hedgehog acyltransferase like [Source:Xenbase;Acc:... [more]
back to top
BLAST of SMED30019429 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Mrm31.087e-4133.54mitochondrial rRNA methyltransferase 3 [Source:MGI... [more]
back to top
BLAST of SMED30019429 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q566V3|MRM3A_DANRE6.660e-4234.08rRNA methyltransferase 3A, mitochondrial OS=Danio ... [more]
sp|Q5ND52|MRM3_MOUSE7.601e-4133.54rRNA methyltransferase 3, mitochondrial OS=Mus mus... [more]
sp|Q9HC36|MRM3_HUMAN6.708e-4032.38rRNA methyltransferase 3, mitochondrial OS=Homo sa... [more]
sp|A1L2E4|MRM3B_DANRE3.223e-3831.40rRNA methyltransferase 3B, mitochondrial OS=Danio ... [more]
sp|Q9VW14|MRM3_DROME7.251e-3732.36rRNA methyltransferase 3, mitochondrial OS=Drosoph... [more]
back to top
BLAST of SMED30019429 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A212ERF78.827e-4533.00Putative RNA methyltransferase like 1 OS=Danaus pl... [more]
A0A2G8L9L87.337e-4332.63Putative rRNA methyltransferase 3, mitochondrial O... [more]
A0A2A4K1Y38.259e-4331.88SpoU_methylase domain-containing protein OS=Heliot... [more]
A0A3Q3JVY61.368e-4235.92Mitochondrial rRNA methyltransferase 3a OS=Monopte... [more]
A0A504YSM15.052e-4131.79RNA methyltransferase 1 OS=Fasciola gigantica OX=4... [more]
back to top
BLAST of SMED30019429 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mrm3a1.108e-3731.63mitochondrial rRNA methyltransferase 3 [Source:NCB... [more]
mrm3b2.152e-3329.45rRNA methyltransferase 3B, mitochondrial-like [Sou... [more]
back to top
BLAST of SMED30019429 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MRM33.645e-3628.70mitochondrial rRNA methyltransferase 3 [Source:HGN... [more]
back to top
BLAST of SMED30019429 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019429 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO419273.297e-2627.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30019429 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrm3a2.632e-3630.59mitochondrial rRNA methyltransferase 3 [Source:NCB... [more]
back to top
BLAST of SMED30019429 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000062794.12.039e-799.39SMESG000062794.1[more]
SMESG000062794.10.000e+099.39SMESG000062794.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019429 ID=SMED30019429|Name=SMED30019429|organism=Schmidtea mediterranea sexual|type=transcript|length=1111bp
TTTTAAACTAATGAATATATATTTTATTTTTCAATATTTTTTTCTGAAAT
TCAGCCAAAATTATGGCTCCAGCAACGGTCATATTTAGACTGTTGACGTG
ACTGTTTATTGGTATATGCAAGCAGCAACCGTATGTTTCTGCAGAGATTC
GCTTAGCATCGTCCGAAACTCCACCGATTTCACCACCGAGTACCAAGCCA
TATGTTTTCTCCTTCGTGAAATCGACAATATTTTCATCATAATATGGATA
CGACTCGCCGGTGTCGTTTGAAATATCGGCATAGTGAACAACACAATTCG
GATTAAGAGAATTCTGAATATCATCCCACGTCAAATTTTGAAAGATAGGA
ATAGAGAAAATGCTCGACATAGAACTTCGGAGTACTTTGTCATTGTAAAG
ATCTACACATCCCTTTGTCATAAAGATTCTGTGAATATTGAATCCGGCAG
CTGACCTTATAATGCAGCCGATATTACCCGGATCTCTCACATTATCTAAT
ATTAATGTAACTGGTAGTTTTCTGCTGAGGAAAGGATCAACAAGCAATTT
TGTTGTTTCAGGTCGCTTGAAAATTGCCATTATTCCTGGTGGCGTTGTAA
GGTTTGAAAATCTTTTCATTGTTTTATATGGGACATAATATATATGAGCA
TCTTTATTGAAGGTATTCACTGGAATTTCAGCAAGTATTTCACGTTTCGA
AAAATATAAATAAGTCATTTTAGCATTAAGCCTGATTGCATCACGAATCA
TATTAACACCCTCTATTATCAATGAGTCGTTTTCCACATCAGATAAAATA
CGAGCTTTCAAGATCACTGGACCTAATCGGTCATCAGTTGATTCAATTCT
TTCGAAGGATTTGTCGCTACAATTATCAAAAATGGTTGATCCTCGTCTGA
TTCTTGAAGTTGTTTCTTTAACAATAGGAATAATATTTCCATCGGGAATA
ATTTGCTCATCTTGTGTAATTATAGGTCTTGCATATTTTTTTCATAACTG
AGTAAAGCTTTCTATCAAATATCAAAGCATTTCTGATAAATTTATTCGTG
AAATTTAGCATTTGAAAGAAACTAATTAGCGAATATTAAAACAAATAGCA
AGACCTATAAT
back to top

protein sequence of SMED30019429-orf-1

>SMED30019429-orf-1 ID=SMED30019429-orf-1|Name=SMED30019429-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=248bp
MIRDAIRLNAKMTYLYFSKREILAEIPVNTFNKDAHIYYVPYKTMKRFSN
LTTPPGIMAIFKRPETTKLLVDPFLSRKLPVTLILDNVRDPGNIGCIIRS
AAGFNIHRIFMTKGCVDLYNDKVLRSSMSSIFSIPIFQNLTWDDIQNSLN
PNCVVHYADISNDTGESYPYYDENIVDFTKEKTYGLVLGGEIGGVSDDAK
RISAETYGCCLHIPINSHVNSLNMTVAGAIILAEFQKKILKNKIYIH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR013123SpoU_subst-bd
IPR029026tRNA_m1G_MTases_N
IPR001537SpoU_MeTrfase
IPR029064L30e-like
IPR029028Alpha/beta_knot_MTases
Vocabulary: molecular function
TermDefinition
GO:0008168methyltransferase activity
GO:0008173RNA methyltransferase activity
GO:0003723RNA binding
Vocabulary: biological process
TermDefinition
GO:0006396RNA processing